data_6QN4 # _entry.id 6QN4 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.313 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 6QN4 WWPDB D_1292100461 # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB 'other mutant S289A S308A' 6FHA unspecified PDB 'other mutant S289A S308E' 6FHB unspecified PDB 'other mutant S289E S308A' 6QMO unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6QN4 _pdbx_database_status.recvd_initial_deposition_date 2019-02-08 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Huart, A.-S.' 1 0000-0003-0913-1501 'Wilmanns, M.' 2 0000-0002-4643-5435 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Molecular mechanisms behind DAPK regulation: how phosphorylation switches work' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Huart, A.-S.' 1 ? primary 'Simon, B.' 2 ? primary 'Lubner, J.' 3 ? primary 'Mertens, H.D.T.' 4 ? primary 'Temmerman, K.' 5 ? primary 'Hoffmann, J.-E.' 6 ? primary 'Svergun, D.I.' 7 ? primary 'Schwartz, D.' 8 ? primary 'Schultz, C.' 9 ? primary 'Wilmanns, M.' 10 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 6QN4 _cell.details ? _cell.formula_units_Z ? _cell.length_a 47.374 _cell.length_a_esd ? _cell.length_b 77.478 _cell.length_b_esd ? _cell.length_c 99.931 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6QN4 _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Death-associated protein kinase 1' 36050.250 1 2.7.11.1 'S289E S308E' ? ? 2 non-polymer syn 'ACETATE ION' 59.044 7 ? ? ? ? 3 non-polymer syn GLYCEROL 92.094 4 ? ? ? ? 4 non-polymer syn 'SODIUM ION' 22.990 1 ? ? ? ? 5 water nat water 18.015 34 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'DAP kinase 1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GPMATVFRQENVDDYYDTGEELGSGQFAVVKKCREKSTGLQYAAKFIKKRRTKSSRRGVSREDIEREVSILKEIQHPNVI TLHEVYENKTDVILILELVAGGELFDFLAEKESLTEEEATEFLKQILNGVYYLHSLQIAHFDLKPENIMLLDRNVPKPRI KIIDFGLAHKIDFGNEFKNIFGTPEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGDTKQETLANVSAVNYEFE DEYFSNTSALAKDFIRRLLVKDPKKRMTIQDSLQHPWIKPKDTQQALSRKAEAVNMEKFKKFAARKKWKQEVR ; _entity_poly.pdbx_seq_one_letter_code_can ;GPMATVFRQENVDDYYDTGEELGSGQFAVVKKCREKSTGLQYAAKFIKKRRTKSSRRGVSREDIEREVSILKEIQHPNVI TLHEVYENKTDVILILELVAGGELFDFLAEKESLTEEEATEFLKQILNGVYYLHSLQIAHFDLKPENIMLLDRNVPKPRI KIIDFGLAHKIDFGNEFKNIFGTPEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGDTKQETLANVSAVNYEFE DEYFSNTSALAKDFIRRLLVKDPKKRMTIQDSLQHPWIKPKDTQQALSRKAEAVNMEKFKKFAARKKWKQEVR ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 MET n 1 4 ALA n 1 5 THR n 1 6 VAL n 1 7 PHE n 1 8 ARG n 1 9 GLN n 1 10 GLU n 1 11 ASN n 1 12 VAL n 1 13 ASP n 1 14 ASP n 1 15 TYR n 1 16 TYR n 1 17 ASP n 1 18 THR n 1 19 GLY n 1 20 GLU n 1 21 GLU n 1 22 LEU n 1 23 GLY n 1 24 SER n 1 25 GLY n 1 26 GLN n 1 27 PHE n 1 28 ALA n 1 29 VAL n 1 30 VAL n 1 31 LYS n 1 32 LYS n 1 33 CYS n 1 34 ARG n 1 35 GLU n 1 36 LYS n 1 37 SER n 1 38 THR n 1 39 GLY n 1 40 LEU n 1 41 GLN n 1 42 TYR n 1 43 ALA n 1 44 ALA n 1 45 LYS n 1 46 PHE n 1 47 ILE n 1 48 LYS n 1 49 LYS n 1 50 ARG n 1 51 ARG n 1 52 THR n 1 53 LYS n 1 54 SER n 1 55 SER n 1 56 ARG n 1 57 ARG n 1 58 GLY n 1 59 VAL n 1 60 SER n 1 61 ARG n 1 62 GLU n 1 63 ASP n 1 64 ILE n 1 65 GLU n 1 66 ARG n 1 67 GLU n 1 68 VAL n 1 69 SER n 1 70 ILE n 1 71 LEU n 1 72 LYS n 1 73 GLU n 1 74 ILE n 1 75 GLN n 1 76 HIS n 1 77 PRO n 1 78 ASN n 1 79 VAL n 1 80 ILE n 1 81 THR n 1 82 LEU n 1 83 HIS n 1 84 GLU n 1 85 VAL n 1 86 TYR n 1 87 GLU n 1 88 ASN n 1 89 LYS n 1 90 THR n 1 91 ASP n 1 92 VAL n 1 93 ILE n 1 94 LEU n 1 95 ILE n 1 96 LEU n 1 97 GLU n 1 98 LEU n 1 99 VAL n 1 100 ALA n 1 101 GLY n 1 102 GLY n 1 103 GLU n 1 104 LEU n 1 105 PHE n 1 106 ASP n 1 107 PHE n 1 108 LEU n 1 109 ALA n 1 110 GLU n 1 111 LYS n 1 112 GLU n 1 113 SER n 1 114 LEU n 1 115 THR n 1 116 GLU n 1 117 GLU n 1 118 GLU n 1 119 ALA n 1 120 THR n 1 121 GLU n 1 122 PHE n 1 123 LEU n 1 124 LYS n 1 125 GLN n 1 126 ILE n 1 127 LEU n 1 128 ASN n 1 129 GLY n 1 130 VAL n 1 131 TYR n 1 132 TYR n 1 133 LEU n 1 134 HIS n 1 135 SER n 1 136 LEU n 1 137 GLN n 1 138 ILE n 1 139 ALA n 1 140 HIS n 1 141 PHE n 1 142 ASP n 1 143 LEU n 1 144 LYS n 1 145 PRO n 1 146 GLU n 1 147 ASN n 1 148 ILE n 1 149 MET n 1 150 LEU n 1 151 LEU n 1 152 ASP n 1 153 ARG n 1 154 ASN n 1 155 VAL n 1 156 PRO n 1 157 LYS n 1 158 PRO n 1 159 ARG n 1 160 ILE n 1 161 LYS n 1 162 ILE n 1 163 ILE n 1 164 ASP n 1 165 PHE n 1 166 GLY n 1 167 LEU n 1 168 ALA n 1 169 HIS n 1 170 LYS n 1 171 ILE n 1 172 ASP n 1 173 PHE n 1 174 GLY n 1 175 ASN n 1 176 GLU n 1 177 PHE n 1 178 LYS n 1 179 ASN n 1 180 ILE n 1 181 PHE n 1 182 GLY n 1 183 THR n 1 184 PRO n 1 185 GLU n 1 186 PHE n 1 187 VAL n 1 188 ALA n 1 189 PRO n 1 190 GLU n 1 191 ILE n 1 192 VAL n 1 193 ASN n 1 194 TYR n 1 195 GLU n 1 196 PRO n 1 197 LEU n 1 198 GLY n 1 199 LEU n 1 200 GLU n 1 201 ALA n 1 202 ASP n 1 203 MET n 1 204 TRP n 1 205 SER n 1 206 ILE n 1 207 GLY n 1 208 VAL n 1 209 ILE n 1 210 THR n 1 211 TYR n 1 212 ILE n 1 213 LEU n 1 214 LEU n 1 215 SER n 1 216 GLY n 1 217 ALA n 1 218 SER n 1 219 PRO n 1 220 PHE n 1 221 LEU n 1 222 GLY n 1 223 ASP n 1 224 THR n 1 225 LYS n 1 226 GLN n 1 227 GLU n 1 228 THR n 1 229 LEU n 1 230 ALA n 1 231 ASN n 1 232 VAL n 1 233 SER n 1 234 ALA n 1 235 VAL n 1 236 ASN n 1 237 TYR n 1 238 GLU n 1 239 PHE n 1 240 GLU n 1 241 ASP n 1 242 GLU n 1 243 TYR n 1 244 PHE n 1 245 SER n 1 246 ASN n 1 247 THR n 1 248 SER n 1 249 ALA n 1 250 LEU n 1 251 ALA n 1 252 LYS n 1 253 ASP n 1 254 PHE n 1 255 ILE n 1 256 ARG n 1 257 ARG n 1 258 LEU n 1 259 LEU n 1 260 VAL n 1 261 LYS n 1 262 ASP n 1 263 PRO n 1 264 LYS n 1 265 LYS n 1 266 ARG n 1 267 MET n 1 268 THR n 1 269 ILE n 1 270 GLN n 1 271 ASP n 1 272 SER n 1 273 LEU n 1 274 GLN n 1 275 HIS n 1 276 PRO n 1 277 TRP n 1 278 ILE n 1 279 LYS n 1 280 PRO n 1 281 LYS n 1 282 ASP n 1 283 THR n 1 284 GLN n 1 285 GLN n 1 286 ALA n 1 287 LEU n 1 288 SER n 1 289 ARG n 1 290 LYS n 1 291 ALA n 1 292 GLU n 1 293 ALA n 1 294 VAL n 1 295 ASN n 1 296 MET n 1 297 GLU n 1 298 LYS n 1 299 PHE n 1 300 LYS n 1 301 LYS n 1 302 PHE n 1 303 ALA n 1 304 ALA n 1 305 ARG n 1 306 LYS n 1 307 LYS n 1 308 TRP n 1 309 LYS n 1 310 GLN n 1 311 GLU n 1 312 VAL n 1 313 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 313 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'DAPK1, DAPK' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code DAPK1_HUMAN _struct_ref.pdbx_db_accession P53355 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;TVFRQENVDDYYDTGEELGSGQFAVVKKCREKSTGLQYAAKFIKKRRTKSSRRGVSREDIEREVSILKEIQHPNVITLHE VYENKTDVILILELVAGGELFDFLAEKESLTEEEATEFLKQILNGVYYLHSLQIAHFDLKPENIMLLDRNVPKPRIKIID FGLAHKIDFGNEFKNIFGTPEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGDTKQETLANVSAVNYEFEDEYF SNTSALAKDFIRRLLVKDPKKRMTIQDSLQHPWIKPKDTQQALSRKASAVNMEKFKKFAARKKWKQSVR ; _struct_ref.pdbx_align_begin 2 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6QN4 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 5 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 313 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P53355 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 310 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 310 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6QN4 GLY A 1 ? UNP P53355 ? ? 'expression tag' -2 1 1 6QN4 PRO A 2 ? UNP P53355 ? ? 'expression tag' -1 2 1 6QN4 MET A 3 ? UNP P53355 ? ? 'expression tag' 0 3 1 6QN4 ALA A 4 ? UNP P53355 ? ? 'expression tag' 1 4 1 6QN4 GLU A 292 ? UNP P53355 SER 289 'engineered mutation' 289 5 1 6QN4 GLU A 311 ? UNP P53355 SER 308 'engineered mutation' 308 6 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ACT non-polymer . 'ACETATE ION' ? 'C2 H3 O2 -1' 59.044 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NA non-polymer . 'SODIUM ION' ? 'Na 1' 22.990 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6QN4 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.54 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 51.64 _exptl_crystal.description 'plate needle' _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 292.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '16% PEG 4000, 0.1 M Tris pH 8.5, 0.2 M sodium acetate' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-08-11 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0332 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PETRA III, EMBL c/o DESY BEAMLINE P14 (MX2)' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0332 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 'P14 (MX2)' _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6QN4 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.5 _reflns.d_resolution_low 99.931 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 26520 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 5.4 _reflns.pdbx_Rmerge_I_obs 0.131 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 7.8 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.161 _reflns.pdbx_Rpim_I_all 0.093 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.997 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.5 _reflns_shell.d_res_low 2.6 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1440 _reflns_shell.percent_possible_all 99.9 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 5.4 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6QN4 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.500 _refine.ls_d_res_low 61.230 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 24450 _refine.ls_number_reflns_R_free 1194 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.66 _refine.ls_percent_reflns_R_free 4.88 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2173 _refine.ls_R_factor_R_free 0.2661 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2149 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.13 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 4B4L _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 30.65 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.44 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2243 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 53 _refine_hist.number_atoms_solvent 34 _refine_hist.number_atoms_total 2330 _refine_hist.d_res_high 2.500 _refine_hist.d_res_low 61.230 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.009 ? 2330 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.947 ? 3133 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 4.152 ? 1396 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.054 ? 344 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.007 ? 406 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.5001 2.6002 . . 117 2569 99.00 . . . 0.3723 . 0.3489 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.6002 2.7185 . . 141 2548 100.00 . . . 0.3393 . 0.3076 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.7185 2.8618 . . 136 2600 100.00 . . . 0.3125 . 0.2786 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.8618 3.0411 . . 144 2584 100.00 . . . 0.3485 . 0.2572 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.0411 3.2759 . . 155 2546 100.00 . . . 0.3103 . 0.2257 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.2759 3.6056 . . 106 2641 100.00 . . . 0.3155 . 0.2068 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.6056 4.1272 . . 135 2582 100.00 . . . 0.2103 . 0.1741 . . . . . . . . . . 'X-RAY DIFFRACTION' 4.1272 5.1994 . . 123 2598 100.00 . . . 0.2156 . 0.1769 . . . . . . . . . . 'X-RAY DIFFRACTION' 5.1994 61.2488 . . 137 2588 100.00 . . . 0.2531 . 0.2160 . . . . . . . . . . # _struct.entry_id 6QN4 _struct.title 'Death-associated Protein Kinase 1 (DAPK1) catalytic and auto-regulatory domains with S289E and S308E mutations' _struct.pdbx_descriptor 'Death-associated protein kinase 1 (E.C.2.7.11.1)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6QN4 _struct_keywords.text 'kinase, apoptosis, autophagy, CaMK, SIGNALING PROTEIN' _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 2 ? F N N 2 ? G N N 2 ? H N N 2 ? I N N 3 ? J N N 3 ? K N N 3 ? L N N 3 ? M N N 4 ? N N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASN A 11 ? ASP A 14 ? ASN A 8 ASP A 11 5 ? 4 HELX_P HELX_P2 AA2 SER A 60 ? ILE A 74 ? SER A 57 ILE A 71 1 ? 15 HELX_P HELX_P3 AA3 GLU A 103 ? GLU A 110 ? GLU A 100 GLU A 107 1 ? 8 HELX_P HELX_P4 AA4 THR A 115 ? LEU A 136 ? THR A 112 LEU A 133 1 ? 22 HELX_P HELX_P5 AA5 LYS A 144 ? GLU A 146 ? LYS A 141 GLU A 143 5 ? 3 HELX_P HELX_P6 AA6 ALA A 188 ? ASN A 193 ? ALA A 185 ASN A 190 1 ? 6 HELX_P HELX_P7 AA7 LEU A 199 ? GLY A 216 ? LEU A 196 GLY A 213 1 ? 18 HELX_P HELX_P8 AA8 THR A 224 ? VAL A 235 ? THR A 221 VAL A 232 1 ? 12 HELX_P HELX_P9 AA9 GLU A 240 ? SER A 245 ? GLU A 237 SER A 242 1 ? 6 HELX_P HELX_P10 AB1 SER A 248 ? LEU A 259 ? SER A 245 LEU A 256 1 ? 12 HELX_P HELX_P11 AB2 ASP A 262 ? ARG A 266 ? ASP A 259 ARG A 263 5 ? 5 HELX_P HELX_P12 AB3 THR A 268 ? HIS A 275 ? THR A 265 HIS A 272 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order metalc1 metalc ? ? M NA . NA ? ? ? 1_555 N HOH . O ? ? A NA 412 A HOH 524 1_555 ? ? ? ? ? ? ? 2.421 ? metalc2 metalc ? ? M NA . NA ? ? ? 1_555 N HOH . O ? ? A NA 412 A HOH 532 4_445 ? ? ? ? ? ? ? 3.161 ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 2 ? AA3 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA3 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 TYR A 16 ? GLY A 25 ? TYR A 13 GLY A 22 AA1 2 ALA A 28 ? GLU A 35 ? ALA A 25 GLU A 32 AA1 3 GLN A 41 ? LYS A 48 ? GLN A 38 LYS A 45 AA1 4 ASP A 91 ? GLU A 97 ? ASP A 88 GLU A 94 AA1 5 LEU A 82 ? GLU A 87 ? LEU A 79 GLU A 84 AA2 1 ILE A 138 ? ALA A 139 ? ILE A 135 ALA A 136 AA2 2 HIS A 169 ? LYS A 170 ? HIS A 166 LYS A 167 AA3 1 ILE A 148 ? LEU A 150 ? ILE A 145 LEU A 147 AA3 2 ILE A 160 ? ILE A 162 ? ILE A 157 ILE A 159 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LEU A 22 ? N LEU A 19 O VAL A 30 ? O VAL A 27 AA1 2 3 N VAL A 29 ? N VAL A 26 O PHE A 46 ? O PHE A 43 AA1 3 4 N ILE A 47 ? N ILE A 44 O VAL A 92 ? O VAL A 89 AA1 4 5 O ILE A 93 ? O ILE A 90 N TYR A 86 ? N TYR A 83 AA2 1 2 N ALA A 139 ? N ALA A 136 O HIS A 169 ? O HIS A 166 AA3 1 2 N MET A 149 ? N MET A 146 O LYS A 161 ? O LYS A 158 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ACT 401 ? 3 'binding site for residue ACT A 401' AC2 Software A ACT 402 ? 4 'binding site for residue ACT A 402' AC3 Software A ACT 403 ? 1 'binding site for residue ACT A 403' AC4 Software A ACT 404 ? 5 'binding site for residue ACT A 404' AC5 Software A ACT 405 ? 4 'binding site for residue ACT A 405' AC6 Software A ACT 406 ? 4 'binding site for residue ACT A 406' AC7 Software A ACT 407 ? 4 'binding site for residue ACT A 407' AC8 Software A GOL 408 ? 4 'binding site for residue GOL A 408' AC9 Software A GOL 409 ? 6 'binding site for residue GOL A 409' AD1 Software A GOL 410 ? 5 'binding site for residue GOL A 410' AD2 Software A GOL 411 ? 7 'binding site for residue GOL A 411' AD3 Software A NA 412 ? 1 'binding site for residue NA A 412' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 3 LYS A 45 ? LYS A 42 . ? 1_555 ? 2 AC1 3 GLU A 67 ? GLU A 64 . ? 1_555 ? 3 AC1 3 ASP A 164 ? ASP A 161 . ? 1_555 ? 4 AC2 4 GLY A 174 ? GLY A 171 . ? 1_555 ? 5 AC2 4 PRO A 196 ? PRO A 193 . ? 1_555 ? 6 AC2 4 GLY A 198 ? GLY A 195 . ? 1_555 ? 7 AC2 4 GLU A 200 ? GLU A 197 . ? 1_555 ? 8 AC3 1 ARG A 50 ? ARG A 47 . ? 1_555 ? 9 AC4 5 HIS A 83 ? HIS A 80 . ? 4_445 ? 10 AC4 5 HIS A 134 ? HIS A 131 . ? 1_555 ? 11 AC4 5 GLN A 137 ? GLN A 134 . ? 1_555 ? 12 AC4 5 LEU A 199 ? LEU A 196 . ? 1_555 ? 13 AC4 5 GOL L . ? GOL A 411 . ? 4_445 ? 14 AC5 4 TYR A 237 ? TYR A 234 . ? 1_555 ? 15 AC5 4 GLU A 238 ? GLU A 235 . ? 1_555 ? 16 AC5 4 PHE A 239 ? PHE A 236 . ? 1_555 ? 17 AC5 4 ARG A 256 ? ARG A 253 . ? 1_555 ? 18 AC6 4 LYS A 45 ? LYS A 42 . ? 1_555 ? 19 AC6 4 ASP A 164 ? ASP A 161 . ? 1_555 ? 20 AC6 4 GOL J . ? GOL A 409 . ? 1_555 ? 21 AC6 4 HOH N . ? HOH A 510 . ? 1_555 ? 22 AC7 4 PHE A 177 ? PHE A 174 . ? 1_555 ? 23 AC7 4 LYS A 178 ? LYS A 175 . ? 1_555 ? 24 AC7 4 ASN A 179 ? ASN A 176 . ? 1_555 ? 25 AC7 4 TYR A 194 ? TYR A 191 . ? 1_555 ? 26 AC8 4 LEU A 82 ? LEU A 79 . ? 1_555 ? 27 AC8 4 HIS A 83 ? HIS A 80 . ? 1_555 ? 28 AC8 4 GLN A 270 ? GLN A 267 . ? 4_545 ? 29 AC8 4 GOL L . ? GOL A 411 . ? 1_555 ? 30 AC9 6 ALA A 43 ? ALA A 40 . ? 1_555 ? 31 AC9 6 GLU A 97 ? GLU A 94 . ? 1_555 ? 32 AC9 6 LEU A 98 ? LEU A 95 . ? 1_555 ? 33 AC9 6 VAL A 99 ? VAL A 96 . ? 1_555 ? 34 AC9 6 MET A 149 ? MET A 146 . ? 1_555 ? 35 AC9 6 ACT G . ? ACT A 406 . ? 1_555 ? 36 AD1 5 GLU A 97 ? GLU A 94 . ? 1_555 ? 37 AD1 5 ARG A 159 ? ARG A 156 . ? 1_555 ? 38 AD1 5 LYS A 161 ? LYS A 158 . ? 1_555 ? 39 AD1 5 LYS A 170 ? LYS A 167 . ? 4_545 ? 40 AD1 5 ASP A 172 ? ASP A 169 . ? 4_545 ? 41 AD2 7 LEU A 71 ? LEU A 68 . ? 1_555 ? 42 AD2 7 LYS A 72 ? LYS A 69 . ? 1_555 ? 43 AD2 7 ILE A 74 ? ILE A 71 . ? 1_555 ? 44 AD2 7 THR A 81 ? THR A 78 . ? 1_555 ? 45 AD2 7 LEU A 82 ? LEU A 79 . ? 1_555 ? 46 AD2 7 ACT E . ? ACT A 404 . ? 4_545 ? 47 AD2 7 GOL I . ? GOL A 408 . ? 1_555 ? 48 AD3 1 HOH N . ? HOH A 524 . ? 1_555 ? # _atom_sites.entry_id 6QN4 _atom_sites.fract_transf_matrix[1][1] 0.021109 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.012907 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.010007 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N NA O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -2 ? ? ? A . n A 1 2 PRO 2 -1 ? ? ? A . n A 1 3 MET 3 0 ? ? ? A . n A 1 4 ALA 4 1 1 ALA ALA A . n A 1 5 THR 5 2 2 THR THR A . n A 1 6 VAL 6 3 3 VAL VAL A . n A 1 7 PHE 7 4 4 PHE PHE A . n A 1 8 ARG 8 5 5 ARG ARG A . n A 1 9 GLN 9 6 6 GLN GLN A . n A 1 10 GLU 10 7 7 GLU GLU A . n A 1 11 ASN 11 8 8 ASN ASN A . n A 1 12 VAL 12 9 9 VAL VAL A . n A 1 13 ASP 13 10 10 ASP ASP A . n A 1 14 ASP 14 11 11 ASP ASP A . n A 1 15 TYR 15 12 12 TYR TYR A . n A 1 16 TYR 16 13 13 TYR TYR A . n A 1 17 ASP 17 14 14 ASP ASP A . n A 1 18 THR 18 15 15 THR THR A . n A 1 19 GLY 19 16 16 GLY GLY A . n A 1 20 GLU 20 17 17 GLU GLU A . n A 1 21 GLU 21 18 18 GLU GLU A . n A 1 22 LEU 22 19 19 LEU LEU A . n A 1 23 GLY 23 20 20 GLY GLY A . n A 1 24 SER 24 21 21 SER SER A . n A 1 25 GLY 25 22 22 GLY GLY A . n A 1 26 GLN 26 23 23 GLN GLN A . n A 1 27 PHE 27 24 24 PHE PHE A . n A 1 28 ALA 28 25 25 ALA ALA A . n A 1 29 VAL 29 26 26 VAL VAL A . n A 1 30 VAL 30 27 27 VAL VAL A . n A 1 31 LYS 31 28 28 LYS LYS A . n A 1 32 LYS 32 29 29 LYS LYS A . n A 1 33 CYS 33 30 30 CYS CYS A . n A 1 34 ARG 34 31 31 ARG ARG A . n A 1 35 GLU 35 32 32 GLU GLU A . n A 1 36 LYS 36 33 33 LYS LYS A . n A 1 37 SER 37 34 34 SER SER A . n A 1 38 THR 38 35 35 THR THR A . n A 1 39 GLY 39 36 36 GLY GLY A . n A 1 40 LEU 40 37 37 LEU LEU A . n A 1 41 GLN 41 38 38 GLN GLN A . n A 1 42 TYR 42 39 39 TYR TYR A . n A 1 43 ALA 43 40 40 ALA ALA A . n A 1 44 ALA 44 41 41 ALA ALA A . n A 1 45 LYS 45 42 42 LYS LYS A . n A 1 46 PHE 46 43 43 PHE PHE A . n A 1 47 ILE 47 44 44 ILE ILE A . n A 1 48 LYS 48 45 45 LYS LYS A . n A 1 49 LYS 49 46 46 LYS LYS A . n A 1 50 ARG 50 47 47 ARG ARG A . n A 1 51 ARG 51 48 48 ARG ARG A . n A 1 52 THR 52 49 49 THR THR A . n A 1 53 LYS 53 50 50 LYS LYS A . n A 1 54 SER 54 51 51 SER SER A . n A 1 55 SER 55 52 52 SER SER A . n A 1 56 ARG 56 53 53 ARG ARG A . n A 1 57 ARG 57 54 54 ARG ARG A . n A 1 58 GLY 58 55 55 GLY GLY A . n A 1 59 VAL 59 56 56 VAL VAL A . n A 1 60 SER 60 57 57 SER SER A . n A 1 61 ARG 61 58 58 ARG ARG A . n A 1 62 GLU 62 59 59 GLU GLU A . n A 1 63 ASP 63 60 60 ASP ASP A . n A 1 64 ILE 64 61 61 ILE ILE A . n A 1 65 GLU 65 62 62 GLU GLU A . n A 1 66 ARG 66 63 63 ARG ARG A . n A 1 67 GLU 67 64 64 GLU GLU A . n A 1 68 VAL 68 65 65 VAL VAL A . n A 1 69 SER 69 66 66 SER SER A . n A 1 70 ILE 70 67 67 ILE ILE A . n A 1 71 LEU 71 68 68 LEU LEU A . n A 1 72 LYS 72 69 69 LYS LYS A . n A 1 73 GLU 73 70 70 GLU GLU A . n A 1 74 ILE 74 71 71 ILE ILE A . n A 1 75 GLN 75 72 72 GLN GLN A . n A 1 76 HIS 76 73 73 HIS HIS A . n A 1 77 PRO 77 74 74 PRO PRO A . n A 1 78 ASN 78 75 75 ASN ASN A . n A 1 79 VAL 79 76 76 VAL VAL A . n A 1 80 ILE 80 77 77 ILE ILE A . n A 1 81 THR 81 78 78 THR THR A . n A 1 82 LEU 82 79 79 LEU LEU A . n A 1 83 HIS 83 80 80 HIS HIS A . n A 1 84 GLU 84 81 81 GLU GLU A . n A 1 85 VAL 85 82 82 VAL VAL A . n A 1 86 TYR 86 83 83 TYR TYR A . n A 1 87 GLU 87 84 84 GLU GLU A . n A 1 88 ASN 88 85 85 ASN ASN A . n A 1 89 LYS 89 86 86 LYS LYS A . n A 1 90 THR 90 87 87 THR THR A . n A 1 91 ASP 91 88 88 ASP ASP A . n A 1 92 VAL 92 89 89 VAL VAL A . n A 1 93 ILE 93 90 90 ILE ILE A . n A 1 94 LEU 94 91 91 LEU LEU A . n A 1 95 ILE 95 92 92 ILE ILE A . n A 1 96 LEU 96 93 93 LEU LEU A . n A 1 97 GLU 97 94 94 GLU GLU A . n A 1 98 LEU 98 95 95 LEU LEU A . n A 1 99 VAL 99 96 96 VAL VAL A . n A 1 100 ALA 100 97 97 ALA ALA A . n A 1 101 GLY 101 98 98 GLY GLY A . n A 1 102 GLY 102 99 99 GLY GLY A . n A 1 103 GLU 103 100 100 GLU GLU A . n A 1 104 LEU 104 101 101 LEU LEU A . n A 1 105 PHE 105 102 102 PHE PHE A . n A 1 106 ASP 106 103 103 ASP ASP A . n A 1 107 PHE 107 104 104 PHE PHE A . n A 1 108 LEU 108 105 105 LEU LEU A . n A 1 109 ALA 109 106 106 ALA ALA A . n A 1 110 GLU 110 107 107 GLU GLU A . n A 1 111 LYS 111 108 108 LYS LYS A . n A 1 112 GLU 112 109 109 GLU GLU A . n A 1 113 SER 113 110 110 SER SER A . n A 1 114 LEU 114 111 111 LEU LEU A . n A 1 115 THR 115 112 112 THR THR A . n A 1 116 GLU 116 113 113 GLU GLU A . n A 1 117 GLU 117 114 114 GLU GLU A . n A 1 118 GLU 118 115 115 GLU GLU A . n A 1 119 ALA 119 116 116 ALA ALA A . n A 1 120 THR 120 117 117 THR THR A . n A 1 121 GLU 121 118 118 GLU GLU A . n A 1 122 PHE 122 119 119 PHE PHE A . n A 1 123 LEU 123 120 120 LEU LEU A . n A 1 124 LYS 124 121 121 LYS LYS A . n A 1 125 GLN 125 122 122 GLN GLN A . n A 1 126 ILE 126 123 123 ILE ILE A . n A 1 127 LEU 127 124 124 LEU LEU A . n A 1 128 ASN 128 125 125 ASN ASN A . n A 1 129 GLY 129 126 126 GLY GLY A . n A 1 130 VAL 130 127 127 VAL VAL A . n A 1 131 TYR 131 128 128 TYR TYR A . n A 1 132 TYR 132 129 129 TYR TYR A . n A 1 133 LEU 133 130 130 LEU LEU A . n A 1 134 HIS 134 131 131 HIS HIS A . n A 1 135 SER 135 132 132 SER SER A . n A 1 136 LEU 136 133 133 LEU LEU A . n A 1 137 GLN 137 134 134 GLN GLN A . n A 1 138 ILE 138 135 135 ILE ILE A . n A 1 139 ALA 139 136 136 ALA ALA A . n A 1 140 HIS 140 137 137 HIS HIS A . n A 1 141 PHE 141 138 138 PHE PHE A . n A 1 142 ASP 142 139 139 ASP ASP A . n A 1 143 LEU 143 140 140 LEU LEU A . n A 1 144 LYS 144 141 141 LYS LYS A . n A 1 145 PRO 145 142 142 PRO PRO A . n A 1 146 GLU 146 143 143 GLU GLU A . n A 1 147 ASN 147 144 144 ASN ASN A . n A 1 148 ILE 148 145 145 ILE ILE A . n A 1 149 MET 149 146 146 MET MET A . n A 1 150 LEU 150 147 147 LEU LEU A . n A 1 151 LEU 151 148 148 LEU LEU A . n A 1 152 ASP 152 149 149 ASP ASP A . n A 1 153 ARG 153 150 150 ARG ARG A . n A 1 154 ASN 154 151 151 ASN ASN A . n A 1 155 VAL 155 152 152 VAL VAL A . n A 1 156 PRO 156 153 153 PRO PRO A . n A 1 157 LYS 157 154 154 LYS LYS A . n A 1 158 PRO 158 155 155 PRO PRO A . n A 1 159 ARG 159 156 156 ARG ARG A . n A 1 160 ILE 160 157 157 ILE ILE A . n A 1 161 LYS 161 158 158 LYS LYS A . n A 1 162 ILE 162 159 159 ILE ILE A . n A 1 163 ILE 163 160 160 ILE ILE A . n A 1 164 ASP 164 161 161 ASP ASP A . n A 1 165 PHE 165 162 162 PHE PHE A . n A 1 166 GLY 166 163 163 GLY GLY A . n A 1 167 LEU 167 164 164 LEU LEU A . n A 1 168 ALA 168 165 165 ALA ALA A . n A 1 169 HIS 169 166 166 HIS HIS A . n A 1 170 LYS 170 167 167 LYS LYS A . n A 1 171 ILE 171 168 168 ILE ILE A . n A 1 172 ASP 172 169 169 ASP ASP A . n A 1 173 PHE 173 170 170 PHE PHE A . n A 1 174 GLY 174 171 171 GLY GLY A . n A 1 175 ASN 175 172 172 ASN ASN A . n A 1 176 GLU 176 173 173 GLU GLU A . n A 1 177 PHE 177 174 174 PHE PHE A . n A 1 178 LYS 178 175 175 LYS LYS A . n A 1 179 ASN 179 176 176 ASN ASN A . n A 1 180 ILE 180 177 177 ILE ILE A . n A 1 181 PHE 181 178 178 PHE PHE A . n A 1 182 GLY 182 179 179 GLY GLY A . n A 1 183 THR 183 180 180 THR THR A . n A 1 184 PRO 184 181 181 PRO PRO A . n A 1 185 GLU 185 182 182 GLU GLU A . n A 1 186 PHE 186 183 183 PHE PHE A . n A 1 187 VAL 187 184 184 VAL VAL A . n A 1 188 ALA 188 185 185 ALA ALA A . n A 1 189 PRO 189 186 186 PRO PRO A . n A 1 190 GLU 190 187 187 GLU GLU A . n A 1 191 ILE 191 188 188 ILE ILE A . n A 1 192 VAL 192 189 189 VAL VAL A . n A 1 193 ASN 193 190 190 ASN ASN A . n A 1 194 TYR 194 191 191 TYR TYR A . n A 1 195 GLU 195 192 192 GLU GLU A . n A 1 196 PRO 196 193 193 PRO PRO A . n A 1 197 LEU 197 194 194 LEU LEU A . n A 1 198 GLY 198 195 195 GLY GLY A . n A 1 199 LEU 199 196 196 LEU LEU A . n A 1 200 GLU 200 197 197 GLU GLU A . n A 1 201 ALA 201 198 198 ALA ALA A . n A 1 202 ASP 202 199 199 ASP ASP A . n A 1 203 MET 203 200 200 MET MET A . n A 1 204 TRP 204 201 201 TRP TRP A . n A 1 205 SER 205 202 202 SER SER A . n A 1 206 ILE 206 203 203 ILE ILE A . n A 1 207 GLY 207 204 204 GLY GLY A . n A 1 208 VAL 208 205 205 VAL VAL A . n A 1 209 ILE 209 206 206 ILE ILE A . n A 1 210 THR 210 207 207 THR THR A . n A 1 211 TYR 211 208 208 TYR TYR A . n A 1 212 ILE 212 209 209 ILE ILE A . n A 1 213 LEU 213 210 210 LEU LEU A . n A 1 214 LEU 214 211 211 LEU LEU A . n A 1 215 SER 215 212 212 SER SER A . n A 1 216 GLY 216 213 213 GLY GLY A . n A 1 217 ALA 217 214 214 ALA ALA A . n A 1 218 SER 218 215 215 SER SER A . n A 1 219 PRO 219 216 216 PRO PRO A . n A 1 220 PHE 220 217 217 PHE PHE A . n A 1 221 LEU 221 218 218 LEU LEU A . n A 1 222 GLY 222 219 219 GLY GLY A . n A 1 223 ASP 223 220 220 ASP ASP A . n A 1 224 THR 224 221 221 THR THR A . n A 1 225 LYS 225 222 222 LYS LYS A . n A 1 226 GLN 226 223 223 GLN GLN A . n A 1 227 GLU 227 224 224 GLU GLU A . n A 1 228 THR 228 225 225 THR THR A . n A 1 229 LEU 229 226 226 LEU LEU A . n A 1 230 ALA 230 227 227 ALA ALA A . n A 1 231 ASN 231 228 228 ASN ASN A . n A 1 232 VAL 232 229 229 VAL VAL A . n A 1 233 SER 233 230 230 SER SER A . n A 1 234 ALA 234 231 231 ALA ALA A . n A 1 235 VAL 235 232 232 VAL VAL A . n A 1 236 ASN 236 233 233 ASN ASN A . n A 1 237 TYR 237 234 234 TYR TYR A . n A 1 238 GLU 238 235 235 GLU GLU A . n A 1 239 PHE 239 236 236 PHE PHE A . n A 1 240 GLU 240 237 237 GLU GLU A . n A 1 241 ASP 241 238 238 ASP ASP A . n A 1 242 GLU 242 239 239 GLU GLU A . n A 1 243 TYR 243 240 240 TYR TYR A . n A 1 244 PHE 244 241 241 PHE PHE A . n A 1 245 SER 245 242 242 SER SER A . n A 1 246 ASN 246 243 243 ASN ASN A . n A 1 247 THR 247 244 244 THR THR A . n A 1 248 SER 248 245 245 SER SER A . n A 1 249 ALA 249 246 246 ALA ALA A . n A 1 250 LEU 250 247 247 LEU LEU A . n A 1 251 ALA 251 248 248 ALA ALA A . n A 1 252 LYS 252 249 249 LYS LYS A . n A 1 253 ASP 253 250 250 ASP ASP A . n A 1 254 PHE 254 251 251 PHE PHE A . n A 1 255 ILE 255 252 252 ILE ILE A . n A 1 256 ARG 256 253 253 ARG ARG A . n A 1 257 ARG 257 254 254 ARG ARG A . n A 1 258 LEU 258 255 255 LEU LEU A . n A 1 259 LEU 259 256 256 LEU LEU A . n A 1 260 VAL 260 257 257 VAL VAL A . n A 1 261 LYS 261 258 258 LYS LYS A . n A 1 262 ASP 262 259 259 ASP ASP A . n A 1 263 PRO 263 260 260 PRO PRO A . n A 1 264 LYS 264 261 261 LYS LYS A . n A 1 265 LYS 265 262 262 LYS LYS A . n A 1 266 ARG 266 263 263 ARG ARG A . n A 1 267 MET 267 264 264 MET MET A . n A 1 268 THR 268 265 265 THR THR A . n A 1 269 ILE 269 266 266 ILE ILE A . n A 1 270 GLN 270 267 267 GLN GLN A . n A 1 271 ASP 271 268 268 ASP ASP A . n A 1 272 SER 272 269 269 SER SER A . n A 1 273 LEU 273 270 270 LEU LEU A . n A 1 274 GLN 274 271 271 GLN GLN A . n A 1 275 HIS 275 272 272 HIS HIS A . n A 1 276 PRO 276 273 273 PRO PRO A . n A 1 277 TRP 277 274 274 TRP TRP A . n A 1 278 ILE 278 275 275 ILE ILE A . n A 1 279 LYS 279 276 276 LYS LYS A . n A 1 280 PRO 280 277 277 PRO PRO A . n A 1 281 LYS 281 278 ? ? ? A . n A 1 282 ASP 282 279 ? ? ? A . n A 1 283 THR 283 280 ? ? ? A . n A 1 284 GLN 284 281 ? ? ? A . n A 1 285 GLN 285 282 ? ? ? A . n A 1 286 ALA 286 283 ? ? ? A . n A 1 287 LEU 287 284 ? ? ? A . n A 1 288 SER 288 285 ? ? ? A . n A 1 289 ARG 289 286 ? ? ? A . n A 1 290 LYS 290 287 ? ? ? A . n A 1 291 ALA 291 288 ? ? ? A . n A 1 292 GLU 292 289 ? ? ? A . n A 1 293 ALA 293 290 ? ? ? A . n A 1 294 VAL 294 291 ? ? ? A . n A 1 295 ASN 295 292 ? ? ? A . n A 1 296 MET 296 293 ? ? ? A . n A 1 297 GLU 297 294 ? ? ? A . n A 1 298 LYS 298 295 ? ? ? A . n A 1 299 PHE 299 296 ? ? ? A . n A 1 300 LYS 300 297 ? ? ? A . n A 1 301 LYS 301 298 ? ? ? A . n A 1 302 PHE 302 299 ? ? ? A . n A 1 303 ALA 303 300 ? ? ? A . n A 1 304 ALA 304 301 ? ? ? A . n A 1 305 ARG 305 302 ? ? ? A . n A 1 306 LYS 306 303 ? ? ? A . n A 1 307 LYS 307 304 ? ? ? A . n A 1 308 TRP 308 305 ? ? ? A . n A 1 309 LYS 309 306 ? ? ? A . n A 1 310 GLN 310 307 ? ? ? A . n A 1 311 GLU 311 308 ? ? ? A . n A 1 312 VAL 312 309 ? ? ? A . n A 1 313 ARG 313 310 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ACT 1 401 1 ACT ACT A . C 2 ACT 1 402 3 ACT ACT A . D 2 ACT 1 403 4 ACT ACT A . E 2 ACT 1 404 6 ACT ACT A . F 2 ACT 1 405 7 ACT ACT A . G 2 ACT 1 406 8 ACT ACT A . H 2 ACT 1 407 9 ACT ACT A . I 3 GOL 1 408 1 GOL GOL A . J 3 GOL 1 409 2 GOL GOL A . K 3 GOL 1 410 5 GOL GOL A . L 3 GOL 1 411 6 GOL GOL A . M 4 NA 1 412 1 NA NA A . N 5 HOH 1 501 52 HOH HOH A . N 5 HOH 2 502 20 HOH HOH A . N 5 HOH 3 503 59 HOH HOH A . N 5 HOH 4 504 32 HOH HOH A . N 5 HOH 5 505 19 HOH HOH A . N 5 HOH 6 506 10 HOH HOH A . N 5 HOH 7 507 33 HOH HOH A . N 5 HOH 8 508 4 HOH HOH A . N 5 HOH 9 509 2 HOH HOH A . N 5 HOH 10 510 8 HOH HOH A . N 5 HOH 11 511 1 HOH HOH A . N 5 HOH 12 512 17 HOH HOH A . N 5 HOH 13 513 34 HOH HOH A . N 5 HOH 14 514 22 HOH HOH A . N 5 HOH 15 515 13 HOH HOH A . N 5 HOH 16 516 3 HOH HOH A . N 5 HOH 17 517 43 HOH HOH A . N 5 HOH 18 518 18 HOH HOH A . N 5 HOH 19 519 11 HOH HOH A . N 5 HOH 20 520 23 HOH HOH A . N 5 HOH 21 521 45 HOH HOH A . N 5 HOH 22 522 36 HOH HOH A . N 5 HOH 23 523 38 HOH HOH A . N 5 HOH 24 524 57 HOH HOH A . N 5 HOH 25 525 50 HOH HOH A . N 5 HOH 26 526 40 HOH HOH A . N 5 HOH 27 527 51 HOH HOH A . N 5 HOH 28 528 55 HOH HOH A . N 5 HOH 29 529 48 HOH HOH A . N 5 HOH 30 530 56 HOH HOH A . N 5 HOH 31 531 54 HOH HOH A . N 5 HOH 32 532 12 HOH HOH A . N 5 HOH 33 533 44 HOH HOH A . N 5 HOH 34 534 53 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H,I,J,K,L,M,N # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2490 ? 1 MORE -13 ? 1 'SSA (A^2)' 13770 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_struct_conn_angle.id 1 _pdbx_struct_conn_angle.ptnr1_label_atom_id O _pdbx_struct_conn_angle.ptnr1_label_alt_id ? _pdbx_struct_conn_angle.ptnr1_label_asym_id N _pdbx_struct_conn_angle.ptnr1_label_comp_id HOH _pdbx_struct_conn_angle.ptnr1_label_seq_id . _pdbx_struct_conn_angle.ptnr1_auth_atom_id ? _pdbx_struct_conn_angle.ptnr1_auth_asym_id A _pdbx_struct_conn_angle.ptnr1_auth_comp_id HOH _pdbx_struct_conn_angle.ptnr1_auth_seq_id 524 _pdbx_struct_conn_angle.ptnr1_PDB_ins_code ? _pdbx_struct_conn_angle.ptnr1_symmetry 1_555 _pdbx_struct_conn_angle.ptnr2_label_atom_id NA _pdbx_struct_conn_angle.ptnr2_label_alt_id ? _pdbx_struct_conn_angle.ptnr2_label_asym_id M _pdbx_struct_conn_angle.ptnr2_label_comp_id NA _pdbx_struct_conn_angle.ptnr2_label_seq_id . _pdbx_struct_conn_angle.ptnr2_auth_atom_id ? _pdbx_struct_conn_angle.ptnr2_auth_asym_id A _pdbx_struct_conn_angle.ptnr2_auth_comp_id NA _pdbx_struct_conn_angle.ptnr2_auth_seq_id 412 _pdbx_struct_conn_angle.ptnr2_PDB_ins_code ? _pdbx_struct_conn_angle.ptnr2_symmetry 1_555 _pdbx_struct_conn_angle.ptnr3_label_atom_id O _pdbx_struct_conn_angle.ptnr3_label_alt_id ? _pdbx_struct_conn_angle.ptnr3_label_asym_id N _pdbx_struct_conn_angle.ptnr3_label_comp_id HOH _pdbx_struct_conn_angle.ptnr3_label_seq_id . _pdbx_struct_conn_angle.ptnr3_auth_atom_id ? _pdbx_struct_conn_angle.ptnr3_auth_asym_id A _pdbx_struct_conn_angle.ptnr3_auth_comp_id HOH _pdbx_struct_conn_angle.ptnr3_auth_seq_id 532 _pdbx_struct_conn_angle.ptnr3_PDB_ins_code ? _pdbx_struct_conn_angle.ptnr3_symmetry 4_445 _pdbx_struct_conn_angle.value 114.2 _pdbx_struct_conn_angle.value_esd ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2019-08-28 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data collection' ? ? ? ? ? ? ? ? ? ? ? MxCuBE ? ? ? . 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot ? ? ? 0.8.6 4 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.9-1692 5 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? 'Phenix 1.9-1692' 6 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 C _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 LYS _pdbx_validate_rmsd_angle.auth_seq_id_1 276 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 N _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 PRO _pdbx_validate_rmsd_angle.auth_seq_id_2 277 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 CA _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 PRO _pdbx_validate_rmsd_angle.auth_seq_id_3 277 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 129.37 _pdbx_validate_rmsd_angle.angle_target_value 119.30 _pdbx_validate_rmsd_angle.angle_deviation 10.07 _pdbx_validate_rmsd_angle.angle_standard_deviation 1.50 _pdbx_validate_rmsd_angle.linker_flag Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 48 ? ? 69.11 -39.01 2 1 GLN A 72 ? ? -167.13 97.53 3 1 PHE A 138 ? ? 74.89 -19.09 4 1 ASP A 161 ? ? 64.43 84.05 5 1 PHE A 162 ? ? -94.35 30.45 6 1 PRO A 181 ? ? -39.76 -39.86 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -2 ? A GLY 1 2 1 Y 1 A PRO -1 ? A PRO 2 3 1 Y 1 A MET 0 ? A MET 3 4 1 Y 1 A LYS 278 ? A LYS 281 5 1 Y 1 A ASP 279 ? A ASP 282 6 1 Y 1 A THR 280 ? A THR 283 7 1 Y 1 A GLN 281 ? A GLN 284 8 1 Y 1 A GLN 282 ? A GLN 285 9 1 Y 1 A ALA 283 ? A ALA 286 10 1 Y 1 A LEU 284 ? A LEU 287 11 1 Y 1 A SER 285 ? A SER 288 12 1 Y 1 A ARG 286 ? A ARG 289 13 1 Y 1 A LYS 287 ? A LYS 290 14 1 Y 1 A ALA 288 ? A ALA 291 15 1 Y 1 A GLU 289 ? A GLU 292 16 1 Y 1 A ALA 290 ? A ALA 293 17 1 Y 1 A VAL 291 ? A VAL 294 18 1 Y 1 A ASN 292 ? A ASN 295 19 1 Y 1 A MET 293 ? A MET 296 20 1 Y 1 A GLU 294 ? A GLU 297 21 1 Y 1 A LYS 295 ? A LYS 298 22 1 Y 1 A PHE 296 ? A PHE 299 23 1 Y 1 A LYS 297 ? A LYS 300 24 1 Y 1 A LYS 298 ? A LYS 301 25 1 Y 1 A PHE 299 ? A PHE 302 26 1 Y 1 A ALA 300 ? A ALA 303 27 1 Y 1 A ALA 301 ? A ALA 304 28 1 Y 1 A ARG 302 ? A ARG 305 29 1 Y 1 A LYS 303 ? A LYS 306 30 1 Y 1 A LYS 304 ? A LYS 307 31 1 Y 1 A TRP 305 ? A TRP 308 32 1 Y 1 A LYS 306 ? A LYS 309 33 1 Y 1 A GLN 307 ? A GLN 310 34 1 Y 1 A GLU 308 ? A GLU 311 35 1 Y 1 A VAL 309 ? A VAL 312 36 1 Y 1 A ARG 310 ? A ARG 313 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ACETATE ION' ACT 3 GLYCEROL GOL 4 'SODIUM ION' NA 5 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'mass spectrometry' _pdbx_struct_assembly_auth_evidence.details ? #