data_6R8D # _entry.id 6R8D # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.336 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 6R8D WWPDB D_1292101513 BMRB 34385 # _pdbx_database_PDB_obs_spr.id OBSLTE _pdbx_database_PDB_obs_spr.date 2020-12-16 _pdbx_database_PDB_obs_spr.pdb_id 7AFQ _pdbx_database_PDB_obs_spr.replace_pdb_id 6R8D _pdbx_database_PDB_obs_spr.details ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Solution Structure of ribosome-binding factor A (RbfA) under physiological conditions' _pdbx_database_related.db_id 34385 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code OBS _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr OBS _pdbx_database_status.entry_id 6R8D _pdbx_database_status.recvd_initial_deposition_date 2019-04-01 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs OBS _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Schedlbauer, A.' 1 ? 'Ochoa Lizarralde, B.' 2 ? 'Capuni, R.' 3 ? 'Iturrioz, I.' 4 ? 'Fucini, P.' 5 ? 'Connell, S.' 6 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'A conserved rRNA switch is central to decoding site maturation on the small ribosomal subunit' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Schedlbauer, A.' 1 ? primary 'Ochoa Lizarralde, B.' 2 ? primary 'Capuni, R.' 3 ? primary 'Iturrioz, I.' 4 ? primary 'Fucini, P.' 5 ? primary 'Connell, S.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Ribosome-binding factor A' _entity.formula_weight 15933.329 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SAKEFGRPQRVAQEMQKEIALILQREIKDPRLGMMTTVSGVEMSRDLAYAKVYVTFLNDKDEDAVKAGIKALQEASGFIR SLLGKAMRLRIVPELTFFYDNSLVEGMRMSNLVTSVVKHDEERRVNPDDSKEDALEVLFQ ; _entity_poly.pdbx_seq_one_letter_code_can ;SAKEFGRPQRVAQEMQKEIALILQREIKDPRLGMMTTVSGVEMSRDLAYAKVYVTFLNDKDEDAVKAGIKALQEASGFIR SLLGKAMRLRIVPELTFFYDNSLVEGMRMSNLVTSVVKHDEERRVNPDDSKEDALEVLFQ ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 ALA n 1 3 LYS n 1 4 GLU n 1 5 PHE n 1 6 GLY n 1 7 ARG n 1 8 PRO n 1 9 GLN n 1 10 ARG n 1 11 VAL n 1 12 ALA n 1 13 GLN n 1 14 GLU n 1 15 MET n 1 16 GLN n 1 17 LYS n 1 18 GLU n 1 19 ILE n 1 20 ALA n 1 21 LEU n 1 22 ILE n 1 23 LEU n 1 24 GLN n 1 25 ARG n 1 26 GLU n 1 27 ILE n 1 28 LYS n 1 29 ASP n 1 30 PRO n 1 31 ARG n 1 32 LEU n 1 33 GLY n 1 34 MET n 1 35 MET n 1 36 THR n 1 37 THR n 1 38 VAL n 1 39 SER n 1 40 GLY n 1 41 VAL n 1 42 GLU n 1 43 MET n 1 44 SER n 1 45 ARG n 1 46 ASP n 1 47 LEU n 1 48 ALA n 1 49 TYR n 1 50 ALA n 1 51 LYS n 1 52 VAL n 1 53 TYR n 1 54 VAL n 1 55 THR n 1 56 PHE n 1 57 LEU n 1 58 ASN n 1 59 ASP n 1 60 LYS n 1 61 ASP n 1 62 GLU n 1 63 ASP n 1 64 ALA n 1 65 VAL n 1 66 LYS n 1 67 ALA n 1 68 GLY n 1 69 ILE n 1 70 LYS n 1 71 ALA n 1 72 LEU n 1 73 GLN n 1 74 GLU n 1 75 ALA n 1 76 SER n 1 77 GLY n 1 78 PHE n 1 79 ILE n 1 80 ARG n 1 81 SER n 1 82 LEU n 1 83 LEU n 1 84 GLY n 1 85 LYS n 1 86 ALA n 1 87 MET n 1 88 ARG n 1 89 LEU n 1 90 ARG n 1 91 ILE n 1 92 VAL n 1 93 PRO n 1 94 GLU n 1 95 LEU n 1 96 THR n 1 97 PHE n 1 98 PHE n 1 99 TYR n 1 100 ASP n 1 101 ASN n 1 102 SER n 1 103 LEU n 1 104 VAL n 1 105 GLU n 1 106 GLY n 1 107 MET n 1 108 ARG n 1 109 MET n 1 110 SER n 1 111 ASN n 1 112 LEU n 1 113 VAL n 1 114 THR n 1 115 SER n 1 116 VAL n 1 117 VAL n 1 118 LYS n 1 119 HIS n 1 120 ASP n 1 121 GLU n 1 122 GLU n 1 123 ARG n 1 124 ARG n 1 125 VAL n 1 126 ASN n 1 127 PRO n 1 128 ASP n 1 129 ASP n 1 130 SER n 1 131 LYS n 1 132 GLU n 1 133 ASP n 1 134 ALA n 1 135 LEU n 1 136 GLU n 1 137 VAL n 1 138 LEU n 1 139 PHE n 1 140 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 140 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'rbfA, DBP23_09200' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Enterobacter sp. EC-NT1' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 2163603 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A3D8XK86_9ENTR _struct_ref.pdbx_db_accession A0A3D8XK86 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;AKEFGRPQRVAQEMQKEIALILQREIKDPRLGMMTTVSGVEMSRDLAYAKVYVTFLNDKDEDAVKAGIKALQEASGFIRS LLGKAMRLRIVPELTFFYDNSLVEGMRMSNLVTSVVKHDEERRVNPDDSKED ; _struct_ref.pdbx_align_begin 2 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6R8D _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 133 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A3D8XK86 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 133 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 133 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6R8D SER A 1 ? UNP A0A3D8XK86 ? ? 'expression tag' 1 1 1 6R8D ALA A 134 ? UNP A0A3D8XK86 ? ? 'expression tag' 134 2 1 6R8D LEU A 135 ? UNP A0A3D8XK86 ? ? 'expression tag' 135 3 1 6R8D GLU A 136 ? UNP A0A3D8XK86 ? ? 'expression tag' 136 4 1 6R8D VAL A 137 ? UNP A0A3D8XK86 ? ? 'expression tag' 137 5 1 6R8D LEU A 138 ? UNP A0A3D8XK86 ? ? 'expression tag' 138 6 1 6R8D PHE A 139 ? UNP A0A3D8XK86 ? ? 'expression tag' 139 7 1 6R8D GLN A 140 ? UNP A0A3D8XK86 ? ? 'expression tag' 140 8 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 2 isotropic 2 1 1 '3D HNCO' 1 isotropic 3 1 1 '3D HNCA' 1 isotropic 4 1 1 '3D HNCACB' 1 isotropic 5 1 1 '3D CBCA(CO)NH' 1 isotropic 6 1 1 '3D HN(CO)CA' 1 isotropic 9 1 1 '3D HN(CA)CO' 1 isotropic 8 1 1 '3D HCCH-TOCSY' 1 isotropic 7 1 1 '3D HNCAHA' 1 isotropic 12 1 1 '3D HN(CO)CAHA' 1 isotropic 11 1 1 '3D CNH NOESY' 2 isotropic 10 1 1 '3D HNH NOESY' 2 isotropic 13 1 1 '3D HCH NOESY' 2 isotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7.6 _pdbx_nmr_exptl_sample_conditions.ionic_strength 40 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label condition1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '400 uM [U-98% 13C; U-98% 15N] RbfA, 10 mM HEPES, 6 mM MgCl2, 30 mM NH4Cl, 75 uM TCEP, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' _pdbx_nmr_sample_details.label sample1 _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 'AVANCE III' ? Bruker 600 ? 2 'AVANCE III' ? Bruker 800 ? # _pdbx_nmr_refine.entry_id 6R8D _pdbx_nmr_refine.method 'molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 6R8D _pdbx_nmr_ensemble.conformers_calculated_total_number 1000 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 6R8D _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 'structure calculation' Xplor-NIH ? 'Schwieters, Kuszewski, Tjandra and Clore' 2 'chemical shift assignment' Sparky ? Goddard 3 processing NMRPipe ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6R8D _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 6R8D _struct.title 'Solution Structure of ribosome-binding factor A (RbfA) under physiological conditions' _struct.pdbx_descriptor 'Ribosome-binding factor A' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6R8D _struct_keywords.text 'Ribosome Assembly Factor, RIBOSOMAL PROTEIN' _struct_keywords.pdbx_keywords 'RIBOSOMAL PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 PRO A 8 ? GLU A 26 ? PRO A 8 GLU A 26 1 ? 19 HELX_P HELX_P2 AA2 LYS A 28 ? GLY A 33 ? LYS A 28 GLY A 33 1 ? 6 HELX_P HELX_P3 AA3 PHE A 56 ? LYS A 60 ? PHE A 56 LYS A 60 5 ? 5 HELX_P HELX_P4 AA4 ASP A 61 ? ALA A 75 ? ASP A 61 ALA A 75 1 ? 15 HELX_P HELX_P5 AA5 ALA A 75 ? ARG A 88 ? ALA A 75 ARG A 88 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 THR A 37 ? MET A 43 ? THR A 37 MET A 43 AA1 2 TYR A 49 ? THR A 55 ? TYR A 49 THR A 55 AA1 3 GLU A 94 ? TYR A 99 ? GLU A 94 TYR A 99 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLU A 42 ? N GLU A 42 O LYS A 51 ? O LYS A 51 AA1 2 3 N VAL A 52 ? N VAL A 52 O THR A 96 ? O THR A 96 # _atom_sites.entry_id 6R8D _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1 ? ? ? A . n A 1 2 ALA 2 2 ? ? ? A . n A 1 3 LYS 3 3 ? ? ? A . n A 1 4 GLU 4 4 ? ? ? A . n A 1 5 PHE 5 5 ? ? ? A . n A 1 6 GLY 6 6 ? ? ? A . n A 1 7 ARG 7 7 ? ? ? A . n A 1 8 PRO 8 8 8 PRO PRO A . n A 1 9 GLN 9 9 9 GLN GLN A . n A 1 10 ARG 10 10 10 ARG ARG A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 GLN 13 13 13 GLN GLN A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 MET 15 15 15 MET MET A . n A 1 16 GLN 16 16 16 GLN GLN A . n A 1 17 LYS 17 17 17 LYS LYS A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 ILE 19 19 19 ILE ILE A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 ILE 22 22 22 ILE ILE A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 GLN 24 24 24 GLN GLN A . n A 1 25 ARG 25 25 25 ARG ARG A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 ILE 27 27 27 ILE ILE A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 ASP 29 29 29 ASP ASP A . n A 1 30 PRO 30 30 30 PRO PRO A . n A 1 31 ARG 31 31 31 ARG ARG A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 MET 34 34 34 MET MET A . n A 1 35 MET 35 35 35 MET MET A . n A 1 36 THR 36 36 36 THR THR A . n A 1 37 THR 37 37 37 THR THR A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 SER 39 39 39 SER SER A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 MET 43 43 43 MET MET A . n A 1 44 SER 44 44 44 SER SER A . n A 1 45 ARG 45 45 45 ARG ARG A . n A 1 46 ASP 46 46 46 ASP ASP A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 TYR 49 49 49 TYR TYR A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 TYR 53 53 53 TYR TYR A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 THR 55 55 55 THR THR A . n A 1 56 PHE 56 56 56 PHE PHE A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 ASN 58 58 58 ASN ASN A . n A 1 59 ASP 59 59 59 ASP ASP A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 ASP 61 61 61 ASP ASP A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 ASP 63 63 63 ASP ASP A . n A 1 64 ALA 64 64 64 ALA ALA A . n A 1 65 VAL 65 65 65 VAL VAL A . n A 1 66 LYS 66 66 66 LYS LYS A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 ILE 69 69 69 ILE ILE A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 ALA 71 71 71 ALA ALA A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 GLN 73 73 73 GLN GLN A . n A 1 74 GLU 74 74 74 GLU GLU A . n A 1 75 ALA 75 75 75 ALA ALA A . n A 1 76 SER 76 76 76 SER SER A . n A 1 77 GLY 77 77 77 GLY GLY A . n A 1 78 PHE 78 78 78 PHE PHE A . n A 1 79 ILE 79 79 79 ILE ILE A . n A 1 80 ARG 80 80 80 ARG ARG A . n A 1 81 SER 81 81 81 SER SER A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 LEU 83 83 83 LEU LEU A . n A 1 84 GLY 84 84 84 GLY GLY A . n A 1 85 LYS 85 85 85 LYS LYS A . n A 1 86 ALA 86 86 86 ALA ALA A . n A 1 87 MET 87 87 87 MET MET A . n A 1 88 ARG 88 88 88 ARG ARG A . n A 1 89 LEU 89 89 89 LEU LEU A . n A 1 90 ARG 90 90 90 ARG ARG A . n A 1 91 ILE 91 91 91 ILE ILE A . n A 1 92 VAL 92 92 92 VAL VAL A . n A 1 93 PRO 93 93 93 PRO PRO A . n A 1 94 GLU 94 94 94 GLU GLU A . n A 1 95 LEU 95 95 95 LEU LEU A . n A 1 96 THR 96 96 96 THR THR A . n A 1 97 PHE 97 97 97 PHE PHE A . n A 1 98 PHE 98 98 98 PHE PHE A . n A 1 99 TYR 99 99 99 TYR TYR A . n A 1 100 ASP 100 100 100 ASP ASP A . n A 1 101 ASN 101 101 ? ? ? A . n A 1 102 SER 102 102 ? ? ? A . n A 1 103 LEU 103 103 ? ? ? A . n A 1 104 VAL 104 104 ? ? ? A . n A 1 105 GLU 105 105 ? ? ? A . n A 1 106 GLY 106 106 ? ? ? A . n A 1 107 MET 107 107 ? ? ? A . n A 1 108 ARG 108 108 ? ? ? A . n A 1 109 MET 109 109 ? ? ? A . n A 1 110 SER 110 110 ? ? ? A . n A 1 111 ASN 111 111 ? ? ? A . n A 1 112 LEU 112 112 ? ? ? A . n A 1 113 VAL 113 113 ? ? ? A . n A 1 114 THR 114 114 ? ? ? A . n A 1 115 SER 115 115 ? ? ? A . n A 1 116 VAL 116 116 ? ? ? A . n A 1 117 VAL 117 117 ? ? ? A . n A 1 118 LYS 118 118 ? ? ? A . n A 1 119 HIS 119 119 ? ? ? A . n A 1 120 ASP 120 120 ? ? ? A . n A 1 121 GLU 121 121 ? ? ? A . n A 1 122 GLU 122 122 ? ? ? A . n A 1 123 ARG 123 123 ? ? ? A . n A 1 124 ARG 124 124 ? ? ? A . n A 1 125 VAL 125 125 ? ? ? A . n A 1 126 ASN 126 126 ? ? ? A . n A 1 127 PRO 127 127 ? ? ? A . n A 1 128 ASP 128 128 ? ? ? A . n A 1 129 ASP 129 129 ? ? ? A . n A 1 130 SER 130 130 ? ? ? A . n A 1 131 LYS 131 131 ? ? ? A . n A 1 132 GLU 132 132 ? ? ? A . n A 1 133 ASP 133 133 ? ? ? A . n A 1 134 ALA 134 134 ? ? ? A . n A 1 135 LEU 135 135 ? ? ? A . n A 1 136 GLU 136 136 ? ? ? A . n A 1 137 VAL 137 137 ? ? ? A . n A 1 138 LEU 138 138 ? ? ? A . n A 1 139 PHE 139 139 ? ? ? A . n A 1 140 GLN 140 140 ? ? ? A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 6990 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-06-03 2 'Structure model' 1 1 2020-12-16 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 2 'Structure model' repository Obsolete ? ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' Advisory 2 2 'Structure model' 'Database references' 3 2 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' pdbx_database_PDB_obs_spr 3 2 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.title' 2 2 'Structure model' '_pdbx_database_status.status_code' 3 2 'Structure model' '_pdbx_database_status.status_code_cs' 4 2 'Structure model' '_pdbx_database_status.status_code_mr' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 RbfA 400 ? uM '[U-98% 13C; U-98% 15N]' 1 HEPES 10 ? mM 'natural abundance' 1 MgCl2 6 ? mM 'natural abundance' 1 NH4Cl 30 ? mM 'natural abundance' 1 TCEP 75 ? uM 'natural abundance' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 4 ILE A 91 ? ? -97.70 34.75 2 5 ILE A 91 ? ? -76.22 33.20 3 6 ILE A 91 ? ? -75.79 40.50 4 7 ILE A 91 ? ? -96.70 43.79 5 8 ILE A 91 ? ? -59.07 -2.37 6 9 ILE A 91 ? ? -89.75 45.03 7 10 ILE A 91 ? ? -94.53 30.44 8 11 ILE A 91 ? ? -73.55 26.84 9 12 MET A 34 ? ? 56.17 -126.21 10 15 MET A 35 ? ? -150.60 72.80 11 15 ILE A 91 ? ? -78.28 34.02 12 17 LEU A 47 ? ? 58.87 11.07 13 17 ILE A 91 ? ? -71.43 29.25 14 19 LEU A 47 ? ? 59.17 15.26 15 20 ILE A 91 ? ? -77.76 21.63 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 1 ? A SER 1 2 1 Y 1 A ALA 2 ? A ALA 2 3 1 Y 1 A LYS 3 ? A LYS 3 4 1 Y 1 A GLU 4 ? A GLU 4 5 1 Y 1 A PHE 5 ? A PHE 5 6 1 Y 1 A GLY 6 ? A GLY 6 7 1 Y 1 A ARG 7 ? A ARG 7 8 1 Y 1 A ASN 101 ? A ASN 101 9 1 Y 1 A SER 102 ? A SER 102 10 1 Y 1 A LEU 103 ? A LEU 103 11 1 Y 1 A VAL 104 ? A VAL 104 12 1 Y 1 A GLU 105 ? A GLU 105 13 1 Y 1 A GLY 106 ? A GLY 106 14 1 Y 1 A MET 107 ? A MET 107 15 1 Y 1 A ARG 108 ? A ARG 108 16 1 Y 1 A MET 109 ? A MET 109 17 1 Y 1 A SER 110 ? A SER 110 18 1 Y 1 A ASN 111 ? A ASN 111 19 1 Y 1 A LEU 112 ? A LEU 112 20 1 Y 1 A VAL 113 ? A VAL 113 21 1 Y 1 A THR 114 ? A THR 114 22 1 Y 1 A SER 115 ? A SER 115 23 1 Y 1 A VAL 116 ? A VAL 116 24 1 Y 1 A VAL 117 ? A VAL 117 25 1 Y 1 A LYS 118 ? A LYS 118 26 1 Y 1 A HIS 119 ? A HIS 119 27 1 Y 1 A ASP 120 ? A ASP 120 28 1 Y 1 A GLU 121 ? A GLU 121 29 1 Y 1 A GLU 122 ? A GLU 122 30 1 Y 1 A ARG 123 ? A ARG 123 31 1 Y 1 A ARG 124 ? A ARG 124 32 1 Y 1 A VAL 125 ? A VAL 125 33 1 Y 1 A ASN 126 ? A ASN 126 34 1 Y 1 A PRO 127 ? A PRO 127 35 1 Y 1 A ASP 128 ? A ASP 128 36 1 Y 1 A ASP 129 ? A ASP 129 37 1 Y 1 A SER 130 ? A SER 130 38 1 Y 1 A LYS 131 ? A LYS 131 39 1 Y 1 A GLU 132 ? A GLU 132 40 1 Y 1 A ASP 133 ? A ASP 133 41 1 Y 1 A ALA 134 ? A ALA 134 42 1 Y 1 A LEU 135 ? A LEU 135 43 1 Y 1 A GLU 136 ? A GLU 136 44 1 Y 1 A VAL 137 ? A VAL 137 45 1 Y 1 A LEU 138 ? A LEU 138 46 1 Y 1 A PHE 139 ? A PHE 139 47 1 Y 1 A GLN 140 ? A GLN 140 48 2 Y 1 A SER 1 ? A SER 1 49 2 Y 1 A ALA 2 ? A ALA 2 50 2 Y 1 A LYS 3 ? A LYS 3 51 2 Y 1 A GLU 4 ? A GLU 4 52 2 Y 1 A PHE 5 ? A PHE 5 53 2 Y 1 A GLY 6 ? A GLY 6 54 2 Y 1 A ARG 7 ? A ARG 7 55 2 Y 1 A ASN 101 ? A ASN 101 56 2 Y 1 A SER 102 ? A SER 102 57 2 Y 1 A LEU 103 ? A LEU 103 58 2 Y 1 A VAL 104 ? A VAL 104 59 2 Y 1 A GLU 105 ? A GLU 105 60 2 Y 1 A GLY 106 ? A GLY 106 61 2 Y 1 A MET 107 ? A MET 107 62 2 Y 1 A ARG 108 ? A ARG 108 63 2 Y 1 A MET 109 ? A MET 109 64 2 Y 1 A SER 110 ? A SER 110 65 2 Y 1 A ASN 111 ? A ASN 111 66 2 Y 1 A LEU 112 ? A LEU 112 67 2 Y 1 A VAL 113 ? A VAL 113 68 2 Y 1 A THR 114 ? A THR 114 69 2 Y 1 A SER 115 ? A SER 115 70 2 Y 1 A VAL 116 ? A VAL 116 71 2 Y 1 A VAL 117 ? A VAL 117 72 2 Y 1 A LYS 118 ? A LYS 118 73 2 Y 1 A HIS 119 ? A HIS 119 74 2 Y 1 A ASP 120 ? A ASP 120 75 2 Y 1 A GLU 121 ? A GLU 121 76 2 Y 1 A GLU 122 ? A GLU 122 77 2 Y 1 A ARG 123 ? A ARG 123 78 2 Y 1 A ARG 124 ? A ARG 124 79 2 Y 1 A VAL 125 ? A VAL 125 80 2 Y 1 A ASN 126 ? A ASN 126 81 2 Y 1 A PRO 127 ? A PRO 127 82 2 Y 1 A ASP 128 ? A ASP 128 83 2 Y 1 A ASP 129 ? A ASP 129 84 2 Y 1 A SER 130 ? A SER 130 85 2 Y 1 A LYS 131 ? A LYS 131 86 2 Y 1 A GLU 132 ? A GLU 132 87 2 Y 1 A ASP 133 ? A ASP 133 88 2 Y 1 A ALA 134 ? A ALA 134 89 2 Y 1 A LEU 135 ? A LEU 135 90 2 Y 1 A GLU 136 ? A GLU 136 91 2 Y 1 A VAL 137 ? A VAL 137 92 2 Y 1 A LEU 138 ? A LEU 138 93 2 Y 1 A PHE 139 ? A PHE 139 94 2 Y 1 A GLN 140 ? A GLN 140 95 3 Y 1 A SER 1 ? A SER 1 96 3 Y 1 A ALA 2 ? A ALA 2 97 3 Y 1 A LYS 3 ? A LYS 3 98 3 Y 1 A GLU 4 ? A GLU 4 99 3 Y 1 A PHE 5 ? A PHE 5 100 3 Y 1 A GLY 6 ? A GLY 6 101 3 Y 1 A ARG 7 ? A ARG 7 102 3 Y 1 A ASN 101 ? A ASN 101 103 3 Y 1 A SER 102 ? A SER 102 104 3 Y 1 A LEU 103 ? A LEU 103 105 3 Y 1 A VAL 104 ? A VAL 104 106 3 Y 1 A GLU 105 ? A GLU 105 107 3 Y 1 A GLY 106 ? A GLY 106 108 3 Y 1 A MET 107 ? A MET 107 109 3 Y 1 A ARG 108 ? A ARG 108 110 3 Y 1 A MET 109 ? A MET 109 111 3 Y 1 A SER 110 ? A SER 110 112 3 Y 1 A ASN 111 ? A ASN 111 113 3 Y 1 A LEU 112 ? A LEU 112 114 3 Y 1 A VAL 113 ? A VAL 113 115 3 Y 1 A THR 114 ? A THR 114 116 3 Y 1 A SER 115 ? A SER 115 117 3 Y 1 A VAL 116 ? A VAL 116 118 3 Y 1 A VAL 117 ? A VAL 117 119 3 Y 1 A LYS 118 ? A LYS 118 120 3 Y 1 A HIS 119 ? A HIS 119 121 3 Y 1 A ASP 120 ? A ASP 120 122 3 Y 1 A GLU 121 ? A GLU 121 123 3 Y 1 A GLU 122 ? A GLU 122 124 3 Y 1 A ARG 123 ? A ARG 123 125 3 Y 1 A ARG 124 ? A ARG 124 126 3 Y 1 A VAL 125 ? A VAL 125 127 3 Y 1 A ASN 126 ? A ASN 126 128 3 Y 1 A PRO 127 ? A PRO 127 129 3 Y 1 A ASP 128 ? A ASP 128 130 3 Y 1 A ASP 129 ? A ASP 129 131 3 Y 1 A SER 130 ? A SER 130 132 3 Y 1 A LYS 131 ? A LYS 131 133 3 Y 1 A GLU 132 ? A GLU 132 134 3 Y 1 A ASP 133 ? A ASP 133 135 3 Y 1 A ALA 134 ? A ALA 134 136 3 Y 1 A LEU 135 ? A LEU 135 137 3 Y 1 A GLU 136 ? A GLU 136 138 3 Y 1 A VAL 137 ? A VAL 137 139 3 Y 1 A LEU 138 ? A LEU 138 140 3 Y 1 A PHE 139 ? A PHE 139 141 3 Y 1 A GLN 140 ? A GLN 140 142 4 Y 1 A SER 1 ? A SER 1 143 4 Y 1 A ALA 2 ? A ALA 2 144 4 Y 1 A LYS 3 ? A LYS 3 145 4 Y 1 A GLU 4 ? A GLU 4 146 4 Y 1 A PHE 5 ? A PHE 5 147 4 Y 1 A GLY 6 ? A GLY 6 148 4 Y 1 A ARG 7 ? A ARG 7 149 4 Y 1 A ASN 101 ? A ASN 101 150 4 Y 1 A SER 102 ? A SER 102 151 4 Y 1 A LEU 103 ? A LEU 103 152 4 Y 1 A VAL 104 ? A VAL 104 153 4 Y 1 A GLU 105 ? A GLU 105 154 4 Y 1 A GLY 106 ? A GLY 106 155 4 Y 1 A MET 107 ? A MET 107 156 4 Y 1 A ARG 108 ? A ARG 108 157 4 Y 1 A MET 109 ? A MET 109 158 4 Y 1 A SER 110 ? A SER 110 159 4 Y 1 A ASN 111 ? A ASN 111 160 4 Y 1 A LEU 112 ? A LEU 112 161 4 Y 1 A VAL 113 ? A VAL 113 162 4 Y 1 A THR 114 ? A THR 114 163 4 Y 1 A SER 115 ? A SER 115 164 4 Y 1 A VAL 116 ? A VAL 116 165 4 Y 1 A VAL 117 ? A VAL 117 166 4 Y 1 A LYS 118 ? A LYS 118 167 4 Y 1 A HIS 119 ? A HIS 119 168 4 Y 1 A ASP 120 ? A ASP 120 169 4 Y 1 A GLU 121 ? A GLU 121 170 4 Y 1 A GLU 122 ? A GLU 122 171 4 Y 1 A ARG 123 ? A ARG 123 172 4 Y 1 A ARG 124 ? A ARG 124 173 4 Y 1 A VAL 125 ? A VAL 125 174 4 Y 1 A ASN 126 ? A ASN 126 175 4 Y 1 A PRO 127 ? A PRO 127 176 4 Y 1 A ASP 128 ? A ASP 128 177 4 Y 1 A ASP 129 ? A ASP 129 178 4 Y 1 A SER 130 ? A SER 130 179 4 Y 1 A LYS 131 ? A LYS 131 180 4 Y 1 A GLU 132 ? A GLU 132 181 4 Y 1 A ASP 133 ? A ASP 133 182 4 Y 1 A ALA 134 ? A ALA 134 183 4 Y 1 A LEU 135 ? A LEU 135 184 4 Y 1 A GLU 136 ? A GLU 136 185 4 Y 1 A VAL 137 ? A VAL 137 186 4 Y 1 A LEU 138 ? A LEU 138 187 4 Y 1 A PHE 139 ? A PHE 139 188 4 Y 1 A GLN 140 ? A GLN 140 189 5 Y 1 A SER 1 ? A SER 1 190 5 Y 1 A ALA 2 ? A ALA 2 191 5 Y 1 A LYS 3 ? A LYS 3 192 5 Y 1 A GLU 4 ? A GLU 4 193 5 Y 1 A PHE 5 ? A PHE 5 194 5 Y 1 A GLY 6 ? A GLY 6 195 5 Y 1 A ARG 7 ? A ARG 7 196 5 Y 1 A ASN 101 ? A ASN 101 197 5 Y 1 A SER 102 ? A SER 102 198 5 Y 1 A LEU 103 ? A LEU 103 199 5 Y 1 A VAL 104 ? A VAL 104 200 5 Y 1 A GLU 105 ? A GLU 105 201 5 Y 1 A GLY 106 ? A GLY 106 202 5 Y 1 A MET 107 ? A MET 107 203 5 Y 1 A ARG 108 ? A ARG 108 204 5 Y 1 A MET 109 ? A MET 109 205 5 Y 1 A SER 110 ? A SER 110 206 5 Y 1 A ASN 111 ? A ASN 111 207 5 Y 1 A LEU 112 ? A LEU 112 208 5 Y 1 A VAL 113 ? A VAL 113 209 5 Y 1 A THR 114 ? A THR 114 210 5 Y 1 A SER 115 ? A SER 115 211 5 Y 1 A VAL 116 ? A VAL 116 212 5 Y 1 A VAL 117 ? A VAL 117 213 5 Y 1 A LYS 118 ? A LYS 118 214 5 Y 1 A HIS 119 ? A HIS 119 215 5 Y 1 A ASP 120 ? A ASP 120 216 5 Y 1 A GLU 121 ? A GLU 121 217 5 Y 1 A GLU 122 ? A GLU 122 218 5 Y 1 A ARG 123 ? A ARG 123 219 5 Y 1 A ARG 124 ? A ARG 124 220 5 Y 1 A VAL 125 ? A VAL 125 221 5 Y 1 A ASN 126 ? A ASN 126 222 5 Y 1 A PRO 127 ? A PRO 127 223 5 Y 1 A ASP 128 ? A ASP 128 224 5 Y 1 A ASP 129 ? A ASP 129 225 5 Y 1 A SER 130 ? A SER 130 226 5 Y 1 A LYS 131 ? A LYS 131 227 5 Y 1 A GLU 132 ? A GLU 132 228 5 Y 1 A ASP 133 ? A ASP 133 229 5 Y 1 A ALA 134 ? A ALA 134 230 5 Y 1 A LEU 135 ? A LEU 135 231 5 Y 1 A GLU 136 ? A GLU 136 232 5 Y 1 A VAL 137 ? A VAL 137 233 5 Y 1 A LEU 138 ? A LEU 138 234 5 Y 1 A PHE 139 ? A PHE 139 235 5 Y 1 A GLN 140 ? A GLN 140 236 6 Y 1 A SER 1 ? A SER 1 237 6 Y 1 A ALA 2 ? A ALA 2 238 6 Y 1 A LYS 3 ? A LYS 3 239 6 Y 1 A GLU 4 ? A GLU 4 240 6 Y 1 A PHE 5 ? A PHE 5 241 6 Y 1 A GLY 6 ? A GLY 6 242 6 Y 1 A ARG 7 ? A ARG 7 243 6 Y 1 A ASN 101 ? A ASN 101 244 6 Y 1 A SER 102 ? A SER 102 245 6 Y 1 A LEU 103 ? A LEU 103 246 6 Y 1 A VAL 104 ? A VAL 104 247 6 Y 1 A GLU 105 ? A GLU 105 248 6 Y 1 A GLY 106 ? A GLY 106 249 6 Y 1 A MET 107 ? A MET 107 250 6 Y 1 A ARG 108 ? A ARG 108 251 6 Y 1 A MET 109 ? A MET 109 252 6 Y 1 A SER 110 ? A SER 110 253 6 Y 1 A ASN 111 ? A ASN 111 254 6 Y 1 A LEU 112 ? A LEU 112 255 6 Y 1 A VAL 113 ? A VAL 113 256 6 Y 1 A THR 114 ? A THR 114 257 6 Y 1 A SER 115 ? A SER 115 258 6 Y 1 A VAL 116 ? A VAL 116 259 6 Y 1 A VAL 117 ? A VAL 117 260 6 Y 1 A LYS 118 ? A LYS 118 261 6 Y 1 A HIS 119 ? A HIS 119 262 6 Y 1 A ASP 120 ? A ASP 120 263 6 Y 1 A GLU 121 ? A GLU 121 264 6 Y 1 A GLU 122 ? A GLU 122 265 6 Y 1 A ARG 123 ? A ARG 123 266 6 Y 1 A ARG 124 ? A ARG 124 267 6 Y 1 A VAL 125 ? A VAL 125 268 6 Y 1 A ASN 126 ? A ASN 126 269 6 Y 1 A PRO 127 ? A PRO 127 270 6 Y 1 A ASP 128 ? A ASP 128 271 6 Y 1 A ASP 129 ? A ASP 129 272 6 Y 1 A SER 130 ? A SER 130 273 6 Y 1 A LYS 131 ? A LYS 131 274 6 Y 1 A GLU 132 ? A GLU 132 275 6 Y 1 A ASP 133 ? A ASP 133 276 6 Y 1 A ALA 134 ? A ALA 134 277 6 Y 1 A LEU 135 ? A LEU 135 278 6 Y 1 A GLU 136 ? A GLU 136 279 6 Y 1 A VAL 137 ? A VAL 137 280 6 Y 1 A LEU 138 ? A LEU 138 281 6 Y 1 A PHE 139 ? A PHE 139 282 6 Y 1 A GLN 140 ? A GLN 140 283 7 Y 1 A SER 1 ? A SER 1 284 7 Y 1 A ALA 2 ? A ALA 2 285 7 Y 1 A LYS 3 ? A LYS 3 286 7 Y 1 A GLU 4 ? A GLU 4 287 7 Y 1 A PHE 5 ? A PHE 5 288 7 Y 1 A GLY 6 ? A GLY 6 289 7 Y 1 A ARG 7 ? A ARG 7 290 7 Y 1 A ASN 101 ? A ASN 101 291 7 Y 1 A SER 102 ? A SER 102 292 7 Y 1 A LEU 103 ? A LEU 103 293 7 Y 1 A VAL 104 ? A VAL 104 294 7 Y 1 A GLU 105 ? A GLU 105 295 7 Y 1 A GLY 106 ? A GLY 106 296 7 Y 1 A MET 107 ? A MET 107 297 7 Y 1 A ARG 108 ? A ARG 108 298 7 Y 1 A MET 109 ? A MET 109 299 7 Y 1 A SER 110 ? A SER 110 300 7 Y 1 A ASN 111 ? A ASN 111 301 7 Y 1 A LEU 112 ? A LEU 112 302 7 Y 1 A VAL 113 ? A VAL 113 303 7 Y 1 A THR 114 ? A THR 114 304 7 Y 1 A SER 115 ? A SER 115 305 7 Y 1 A VAL 116 ? A VAL 116 306 7 Y 1 A VAL 117 ? A VAL 117 307 7 Y 1 A LYS 118 ? A LYS 118 308 7 Y 1 A HIS 119 ? A HIS 119 309 7 Y 1 A ASP 120 ? A ASP 120 310 7 Y 1 A GLU 121 ? A GLU 121 311 7 Y 1 A GLU 122 ? A GLU 122 312 7 Y 1 A ARG 123 ? A ARG 123 313 7 Y 1 A ARG 124 ? A ARG 124 314 7 Y 1 A VAL 125 ? A VAL 125 315 7 Y 1 A ASN 126 ? A ASN 126 316 7 Y 1 A PRO 127 ? A PRO 127 317 7 Y 1 A ASP 128 ? A ASP 128 318 7 Y 1 A ASP 129 ? A ASP 129 319 7 Y 1 A SER 130 ? A SER 130 320 7 Y 1 A LYS 131 ? A LYS 131 321 7 Y 1 A GLU 132 ? A GLU 132 322 7 Y 1 A ASP 133 ? A ASP 133 323 7 Y 1 A ALA 134 ? A ALA 134 324 7 Y 1 A LEU 135 ? A LEU 135 325 7 Y 1 A GLU 136 ? A GLU 136 326 7 Y 1 A VAL 137 ? A VAL 137 327 7 Y 1 A LEU 138 ? A LEU 138 328 7 Y 1 A PHE 139 ? A PHE 139 329 7 Y 1 A GLN 140 ? A GLN 140 330 8 Y 1 A SER 1 ? A SER 1 331 8 Y 1 A ALA 2 ? A ALA 2 332 8 Y 1 A LYS 3 ? A LYS 3 333 8 Y 1 A GLU 4 ? A GLU 4 334 8 Y 1 A PHE 5 ? A PHE 5 335 8 Y 1 A GLY 6 ? A GLY 6 336 8 Y 1 A ARG 7 ? A ARG 7 337 8 Y 1 A ASN 101 ? A ASN 101 338 8 Y 1 A SER 102 ? A SER 102 339 8 Y 1 A LEU 103 ? A LEU 103 340 8 Y 1 A VAL 104 ? A VAL 104 341 8 Y 1 A GLU 105 ? A GLU 105 342 8 Y 1 A GLY 106 ? A GLY 106 343 8 Y 1 A MET 107 ? A MET 107 344 8 Y 1 A ARG 108 ? A ARG 108 345 8 Y 1 A MET 109 ? A MET 109 346 8 Y 1 A SER 110 ? A SER 110 347 8 Y 1 A ASN 111 ? A ASN 111 348 8 Y 1 A LEU 112 ? A LEU 112 349 8 Y 1 A VAL 113 ? A VAL 113 350 8 Y 1 A THR 114 ? A THR 114 351 8 Y 1 A SER 115 ? A SER 115 352 8 Y 1 A VAL 116 ? A VAL 116 353 8 Y 1 A VAL 117 ? A VAL 117 354 8 Y 1 A LYS 118 ? A LYS 118 355 8 Y 1 A HIS 119 ? A HIS 119 356 8 Y 1 A ASP 120 ? A ASP 120 357 8 Y 1 A GLU 121 ? A GLU 121 358 8 Y 1 A GLU 122 ? A GLU 122 359 8 Y 1 A ARG 123 ? A ARG 123 360 8 Y 1 A ARG 124 ? A ARG 124 361 8 Y 1 A VAL 125 ? A VAL 125 362 8 Y 1 A ASN 126 ? A ASN 126 363 8 Y 1 A PRO 127 ? A PRO 127 364 8 Y 1 A ASP 128 ? A ASP 128 365 8 Y 1 A ASP 129 ? A ASP 129 366 8 Y 1 A SER 130 ? A SER 130 367 8 Y 1 A LYS 131 ? A LYS 131 368 8 Y 1 A GLU 132 ? A GLU 132 369 8 Y 1 A ASP 133 ? A ASP 133 370 8 Y 1 A ALA 134 ? A ALA 134 371 8 Y 1 A LEU 135 ? A LEU 135 372 8 Y 1 A GLU 136 ? A GLU 136 373 8 Y 1 A VAL 137 ? A VAL 137 374 8 Y 1 A LEU 138 ? A LEU 138 375 8 Y 1 A PHE 139 ? A PHE 139 376 8 Y 1 A GLN 140 ? A GLN 140 377 9 Y 1 A SER 1 ? A SER 1 378 9 Y 1 A ALA 2 ? A ALA 2 379 9 Y 1 A LYS 3 ? A LYS 3 380 9 Y 1 A GLU 4 ? A GLU 4 381 9 Y 1 A PHE 5 ? A PHE 5 382 9 Y 1 A GLY 6 ? A GLY 6 383 9 Y 1 A ARG 7 ? A ARG 7 384 9 Y 1 A ASN 101 ? A ASN 101 385 9 Y 1 A SER 102 ? A SER 102 386 9 Y 1 A LEU 103 ? A LEU 103 387 9 Y 1 A VAL 104 ? A VAL 104 388 9 Y 1 A GLU 105 ? A GLU 105 389 9 Y 1 A GLY 106 ? A GLY 106 390 9 Y 1 A MET 107 ? A MET 107 391 9 Y 1 A ARG 108 ? A ARG 108 392 9 Y 1 A MET 109 ? A MET 109 393 9 Y 1 A SER 110 ? A SER 110 394 9 Y 1 A ASN 111 ? A ASN 111 395 9 Y 1 A LEU 112 ? A LEU 112 396 9 Y 1 A VAL 113 ? A VAL 113 397 9 Y 1 A THR 114 ? A THR 114 398 9 Y 1 A SER 115 ? A SER 115 399 9 Y 1 A VAL 116 ? A VAL 116 400 9 Y 1 A VAL 117 ? A VAL 117 401 9 Y 1 A LYS 118 ? A LYS 118 402 9 Y 1 A HIS 119 ? A HIS 119 403 9 Y 1 A ASP 120 ? A ASP 120 404 9 Y 1 A GLU 121 ? A GLU 121 405 9 Y 1 A GLU 122 ? A GLU 122 406 9 Y 1 A ARG 123 ? A ARG 123 407 9 Y 1 A ARG 124 ? A ARG 124 408 9 Y 1 A VAL 125 ? A VAL 125 409 9 Y 1 A ASN 126 ? A ASN 126 410 9 Y 1 A PRO 127 ? A PRO 127 411 9 Y 1 A ASP 128 ? A ASP 128 412 9 Y 1 A ASP 129 ? A ASP 129 413 9 Y 1 A SER 130 ? A SER 130 414 9 Y 1 A LYS 131 ? A LYS 131 415 9 Y 1 A GLU 132 ? A GLU 132 416 9 Y 1 A ASP 133 ? A ASP 133 417 9 Y 1 A ALA 134 ? A ALA 134 418 9 Y 1 A LEU 135 ? A LEU 135 419 9 Y 1 A GLU 136 ? A GLU 136 420 9 Y 1 A VAL 137 ? A VAL 137 421 9 Y 1 A LEU 138 ? A LEU 138 422 9 Y 1 A PHE 139 ? A PHE 139 423 9 Y 1 A GLN 140 ? A GLN 140 424 10 Y 1 A SER 1 ? A SER 1 425 10 Y 1 A ALA 2 ? A ALA 2 426 10 Y 1 A LYS 3 ? A LYS 3 427 10 Y 1 A GLU 4 ? A GLU 4 428 10 Y 1 A PHE 5 ? A PHE 5 429 10 Y 1 A GLY 6 ? A GLY 6 430 10 Y 1 A ARG 7 ? A ARG 7 431 10 Y 1 A ASN 101 ? A ASN 101 432 10 Y 1 A SER 102 ? A SER 102 433 10 Y 1 A LEU 103 ? A LEU 103 434 10 Y 1 A VAL 104 ? A VAL 104 435 10 Y 1 A GLU 105 ? A GLU 105 436 10 Y 1 A GLY 106 ? A GLY 106 437 10 Y 1 A MET 107 ? A MET 107 438 10 Y 1 A ARG 108 ? A ARG 108 439 10 Y 1 A MET 109 ? A MET 109 440 10 Y 1 A SER 110 ? A SER 110 441 10 Y 1 A ASN 111 ? A ASN 111 442 10 Y 1 A LEU 112 ? A LEU 112 443 10 Y 1 A VAL 113 ? A VAL 113 444 10 Y 1 A THR 114 ? A THR 114 445 10 Y 1 A SER 115 ? A SER 115 446 10 Y 1 A VAL 116 ? A VAL 116 447 10 Y 1 A VAL 117 ? A VAL 117 448 10 Y 1 A LYS 118 ? A LYS 118 449 10 Y 1 A HIS 119 ? A HIS 119 450 10 Y 1 A ASP 120 ? A ASP 120 451 10 Y 1 A GLU 121 ? A GLU 121 452 10 Y 1 A GLU 122 ? A GLU 122 453 10 Y 1 A ARG 123 ? A ARG 123 454 10 Y 1 A ARG 124 ? A ARG 124 455 10 Y 1 A VAL 125 ? A VAL 125 456 10 Y 1 A ASN 126 ? A ASN 126 457 10 Y 1 A PRO 127 ? A PRO 127 458 10 Y 1 A ASP 128 ? A ASP 128 459 10 Y 1 A ASP 129 ? A ASP 129 460 10 Y 1 A SER 130 ? A SER 130 461 10 Y 1 A LYS 131 ? A LYS 131 462 10 Y 1 A GLU 132 ? A GLU 132 463 10 Y 1 A ASP 133 ? A ASP 133 464 10 Y 1 A ALA 134 ? A ALA 134 465 10 Y 1 A LEU 135 ? A LEU 135 466 10 Y 1 A GLU 136 ? A GLU 136 467 10 Y 1 A VAL 137 ? A VAL 137 468 10 Y 1 A LEU 138 ? A LEU 138 469 10 Y 1 A PHE 139 ? A PHE 139 470 10 Y 1 A GLN 140 ? A GLN 140 471 11 Y 1 A SER 1 ? A SER 1 472 11 Y 1 A ALA 2 ? A ALA 2 473 11 Y 1 A LYS 3 ? A LYS 3 474 11 Y 1 A GLU 4 ? A GLU 4 475 11 Y 1 A PHE 5 ? A PHE 5 476 11 Y 1 A GLY 6 ? A GLY 6 477 11 Y 1 A ARG 7 ? A ARG 7 478 11 Y 1 A ASN 101 ? A ASN 101 479 11 Y 1 A SER 102 ? A SER 102 480 11 Y 1 A LEU 103 ? A LEU 103 481 11 Y 1 A VAL 104 ? A VAL 104 482 11 Y 1 A GLU 105 ? A GLU 105 483 11 Y 1 A GLY 106 ? A GLY 106 484 11 Y 1 A MET 107 ? A MET 107 485 11 Y 1 A ARG 108 ? A ARG 108 486 11 Y 1 A MET 109 ? A MET 109 487 11 Y 1 A SER 110 ? A SER 110 488 11 Y 1 A ASN 111 ? A ASN 111 489 11 Y 1 A LEU 112 ? A LEU 112 490 11 Y 1 A VAL 113 ? A VAL 113 491 11 Y 1 A THR 114 ? A THR 114 492 11 Y 1 A SER 115 ? A SER 115 493 11 Y 1 A VAL 116 ? A VAL 116 494 11 Y 1 A VAL 117 ? A VAL 117 495 11 Y 1 A LYS 118 ? A LYS 118 496 11 Y 1 A HIS 119 ? A HIS 119 497 11 Y 1 A ASP 120 ? A ASP 120 498 11 Y 1 A GLU 121 ? A GLU 121 499 11 Y 1 A GLU 122 ? A GLU 122 500 11 Y 1 A ARG 123 ? A ARG 123 501 11 Y 1 A ARG 124 ? A ARG 124 502 11 Y 1 A VAL 125 ? A VAL 125 503 11 Y 1 A ASN 126 ? A ASN 126 504 11 Y 1 A PRO 127 ? A PRO 127 505 11 Y 1 A ASP 128 ? A ASP 128 506 11 Y 1 A ASP 129 ? A ASP 129 507 11 Y 1 A SER 130 ? A SER 130 508 11 Y 1 A LYS 131 ? A LYS 131 509 11 Y 1 A GLU 132 ? A GLU 132 510 11 Y 1 A ASP 133 ? A ASP 133 511 11 Y 1 A ALA 134 ? A ALA 134 512 11 Y 1 A LEU 135 ? A LEU 135 513 11 Y 1 A GLU 136 ? A GLU 136 514 11 Y 1 A VAL 137 ? A VAL 137 515 11 Y 1 A LEU 138 ? A LEU 138 516 11 Y 1 A PHE 139 ? A PHE 139 517 11 Y 1 A GLN 140 ? A GLN 140 518 12 Y 1 A SER 1 ? A SER 1 519 12 Y 1 A ALA 2 ? A ALA 2 520 12 Y 1 A LYS 3 ? A LYS 3 521 12 Y 1 A GLU 4 ? A GLU 4 522 12 Y 1 A PHE 5 ? A PHE 5 523 12 Y 1 A GLY 6 ? A GLY 6 524 12 Y 1 A ARG 7 ? A ARG 7 525 12 Y 1 A ASN 101 ? A ASN 101 526 12 Y 1 A SER 102 ? A SER 102 527 12 Y 1 A LEU 103 ? A LEU 103 528 12 Y 1 A VAL 104 ? A VAL 104 529 12 Y 1 A GLU 105 ? A GLU 105 530 12 Y 1 A GLY 106 ? A GLY 106 531 12 Y 1 A MET 107 ? A MET 107 532 12 Y 1 A ARG 108 ? A ARG 108 533 12 Y 1 A MET 109 ? A MET 109 534 12 Y 1 A SER 110 ? A SER 110 535 12 Y 1 A ASN 111 ? A ASN 111 536 12 Y 1 A LEU 112 ? A LEU 112 537 12 Y 1 A VAL 113 ? A VAL 113 538 12 Y 1 A THR 114 ? A THR 114 539 12 Y 1 A SER 115 ? A SER 115 540 12 Y 1 A VAL 116 ? A VAL 116 541 12 Y 1 A VAL 117 ? A VAL 117 542 12 Y 1 A LYS 118 ? A LYS 118 543 12 Y 1 A HIS 119 ? A HIS 119 544 12 Y 1 A ASP 120 ? A ASP 120 545 12 Y 1 A GLU 121 ? A GLU 121 546 12 Y 1 A GLU 122 ? A GLU 122 547 12 Y 1 A ARG 123 ? A ARG 123 548 12 Y 1 A ARG 124 ? A ARG 124 549 12 Y 1 A VAL 125 ? A VAL 125 550 12 Y 1 A ASN 126 ? A ASN 126 551 12 Y 1 A PRO 127 ? A PRO 127 552 12 Y 1 A ASP 128 ? A ASP 128 553 12 Y 1 A ASP 129 ? A ASP 129 554 12 Y 1 A SER 130 ? A SER 130 555 12 Y 1 A LYS 131 ? A LYS 131 556 12 Y 1 A GLU 132 ? A GLU 132 557 12 Y 1 A ASP 133 ? A ASP 133 558 12 Y 1 A ALA 134 ? A ALA 134 559 12 Y 1 A LEU 135 ? A LEU 135 560 12 Y 1 A GLU 136 ? A GLU 136 561 12 Y 1 A VAL 137 ? A VAL 137 562 12 Y 1 A LEU 138 ? A LEU 138 563 12 Y 1 A PHE 139 ? A PHE 139 564 12 Y 1 A GLN 140 ? A GLN 140 565 13 Y 1 A SER 1 ? A SER 1 566 13 Y 1 A ALA 2 ? A ALA 2 567 13 Y 1 A LYS 3 ? A LYS 3 568 13 Y 1 A GLU 4 ? A GLU 4 569 13 Y 1 A PHE 5 ? A PHE 5 570 13 Y 1 A GLY 6 ? A GLY 6 571 13 Y 1 A ARG 7 ? A ARG 7 572 13 Y 1 A ASN 101 ? A ASN 101 573 13 Y 1 A SER 102 ? A SER 102 574 13 Y 1 A LEU 103 ? A LEU 103 575 13 Y 1 A VAL 104 ? A VAL 104 576 13 Y 1 A GLU 105 ? A GLU 105 577 13 Y 1 A GLY 106 ? A GLY 106 578 13 Y 1 A MET 107 ? A MET 107 579 13 Y 1 A ARG 108 ? A ARG 108 580 13 Y 1 A MET 109 ? A MET 109 581 13 Y 1 A SER 110 ? A SER 110 582 13 Y 1 A ASN 111 ? A ASN 111 583 13 Y 1 A LEU 112 ? A LEU 112 584 13 Y 1 A VAL 113 ? A VAL 113 585 13 Y 1 A THR 114 ? A THR 114 586 13 Y 1 A SER 115 ? A SER 115 587 13 Y 1 A VAL 116 ? A VAL 116 588 13 Y 1 A VAL 117 ? A VAL 117 589 13 Y 1 A LYS 118 ? A LYS 118 590 13 Y 1 A HIS 119 ? A HIS 119 591 13 Y 1 A ASP 120 ? A ASP 120 592 13 Y 1 A GLU 121 ? A GLU 121 593 13 Y 1 A GLU 122 ? A GLU 122 594 13 Y 1 A ARG 123 ? A ARG 123 595 13 Y 1 A ARG 124 ? A ARG 124 596 13 Y 1 A VAL 125 ? A VAL 125 597 13 Y 1 A ASN 126 ? A ASN 126 598 13 Y 1 A PRO 127 ? A PRO 127 599 13 Y 1 A ASP 128 ? A ASP 128 600 13 Y 1 A ASP 129 ? A ASP 129 601 13 Y 1 A SER 130 ? A SER 130 602 13 Y 1 A LYS 131 ? A LYS 131 603 13 Y 1 A GLU 132 ? A GLU 132 604 13 Y 1 A ASP 133 ? A ASP 133 605 13 Y 1 A ALA 134 ? A ALA 134 606 13 Y 1 A LEU 135 ? A LEU 135 607 13 Y 1 A GLU 136 ? A GLU 136 608 13 Y 1 A VAL 137 ? A VAL 137 609 13 Y 1 A LEU 138 ? A LEU 138 610 13 Y 1 A PHE 139 ? A PHE 139 611 13 Y 1 A GLN 140 ? A GLN 140 612 14 Y 1 A SER 1 ? A SER 1 613 14 Y 1 A ALA 2 ? A ALA 2 614 14 Y 1 A LYS 3 ? A LYS 3 615 14 Y 1 A GLU 4 ? A GLU 4 616 14 Y 1 A PHE 5 ? A PHE 5 617 14 Y 1 A GLY 6 ? A GLY 6 618 14 Y 1 A ARG 7 ? A ARG 7 619 14 Y 1 A ASN 101 ? A ASN 101 620 14 Y 1 A SER 102 ? A SER 102 621 14 Y 1 A LEU 103 ? A LEU 103 622 14 Y 1 A VAL 104 ? A VAL 104 623 14 Y 1 A GLU 105 ? A GLU 105 624 14 Y 1 A GLY 106 ? A GLY 106 625 14 Y 1 A MET 107 ? A MET 107 626 14 Y 1 A ARG 108 ? A ARG 108 627 14 Y 1 A MET 109 ? A MET 109 628 14 Y 1 A SER 110 ? A SER 110 629 14 Y 1 A ASN 111 ? A ASN 111 630 14 Y 1 A LEU 112 ? A LEU 112 631 14 Y 1 A VAL 113 ? A VAL 113 632 14 Y 1 A THR 114 ? A THR 114 633 14 Y 1 A SER 115 ? A SER 115 634 14 Y 1 A VAL 116 ? A VAL 116 635 14 Y 1 A VAL 117 ? A VAL 117 636 14 Y 1 A LYS 118 ? A LYS 118 637 14 Y 1 A HIS 119 ? A HIS 119 638 14 Y 1 A ASP 120 ? A ASP 120 639 14 Y 1 A GLU 121 ? A GLU 121 640 14 Y 1 A GLU 122 ? A GLU 122 641 14 Y 1 A ARG 123 ? A ARG 123 642 14 Y 1 A ARG 124 ? A ARG 124 643 14 Y 1 A VAL 125 ? A VAL 125 644 14 Y 1 A ASN 126 ? A ASN 126 645 14 Y 1 A PRO 127 ? A PRO 127 646 14 Y 1 A ASP 128 ? A ASP 128 647 14 Y 1 A ASP 129 ? A ASP 129 648 14 Y 1 A SER 130 ? A SER 130 649 14 Y 1 A LYS 131 ? A LYS 131 650 14 Y 1 A GLU 132 ? A GLU 132 651 14 Y 1 A ASP 133 ? A ASP 133 652 14 Y 1 A ALA 134 ? A ALA 134 653 14 Y 1 A LEU 135 ? A LEU 135 654 14 Y 1 A GLU 136 ? A GLU 136 655 14 Y 1 A VAL 137 ? A VAL 137 656 14 Y 1 A LEU 138 ? A LEU 138 657 14 Y 1 A PHE 139 ? A PHE 139 658 14 Y 1 A GLN 140 ? A GLN 140 659 15 Y 1 A SER 1 ? A SER 1 660 15 Y 1 A ALA 2 ? A ALA 2 661 15 Y 1 A LYS 3 ? A LYS 3 662 15 Y 1 A GLU 4 ? A GLU 4 663 15 Y 1 A PHE 5 ? A PHE 5 664 15 Y 1 A GLY 6 ? A GLY 6 665 15 Y 1 A ARG 7 ? A ARG 7 666 15 Y 1 A ASN 101 ? A ASN 101 667 15 Y 1 A SER 102 ? A SER 102 668 15 Y 1 A LEU 103 ? A LEU 103 669 15 Y 1 A VAL 104 ? A VAL 104 670 15 Y 1 A GLU 105 ? A GLU 105 671 15 Y 1 A GLY 106 ? A GLY 106 672 15 Y 1 A MET 107 ? A MET 107 673 15 Y 1 A ARG 108 ? A ARG 108 674 15 Y 1 A MET 109 ? A MET 109 675 15 Y 1 A SER 110 ? A SER 110 676 15 Y 1 A ASN 111 ? A ASN 111 677 15 Y 1 A LEU 112 ? A LEU 112 678 15 Y 1 A VAL 113 ? A VAL 113 679 15 Y 1 A THR 114 ? A THR 114 680 15 Y 1 A SER 115 ? A SER 115 681 15 Y 1 A VAL 116 ? A VAL 116 682 15 Y 1 A VAL 117 ? A VAL 117 683 15 Y 1 A LYS 118 ? A LYS 118 684 15 Y 1 A HIS 119 ? A HIS 119 685 15 Y 1 A ASP 120 ? A ASP 120 686 15 Y 1 A GLU 121 ? A GLU 121 687 15 Y 1 A GLU 122 ? A GLU 122 688 15 Y 1 A ARG 123 ? A ARG 123 689 15 Y 1 A ARG 124 ? A ARG 124 690 15 Y 1 A VAL 125 ? A VAL 125 691 15 Y 1 A ASN 126 ? A ASN 126 692 15 Y 1 A PRO 127 ? A PRO 127 693 15 Y 1 A ASP 128 ? A ASP 128 694 15 Y 1 A ASP 129 ? A ASP 129 695 15 Y 1 A SER 130 ? A SER 130 696 15 Y 1 A LYS 131 ? A LYS 131 697 15 Y 1 A GLU 132 ? A GLU 132 698 15 Y 1 A ASP 133 ? A ASP 133 699 15 Y 1 A ALA 134 ? A ALA 134 700 15 Y 1 A LEU 135 ? A LEU 135 701 15 Y 1 A GLU 136 ? A GLU 136 702 15 Y 1 A VAL 137 ? A VAL 137 703 15 Y 1 A LEU 138 ? A LEU 138 704 15 Y 1 A PHE 139 ? A PHE 139 705 15 Y 1 A GLN 140 ? A GLN 140 706 16 Y 1 A SER 1 ? A SER 1 707 16 Y 1 A ALA 2 ? A ALA 2 708 16 Y 1 A LYS 3 ? A LYS 3 709 16 Y 1 A GLU 4 ? A GLU 4 710 16 Y 1 A PHE 5 ? A PHE 5 711 16 Y 1 A GLY 6 ? A GLY 6 712 16 Y 1 A ARG 7 ? A ARG 7 713 16 Y 1 A ASN 101 ? A ASN 101 714 16 Y 1 A SER 102 ? A SER 102 715 16 Y 1 A LEU 103 ? A LEU 103 716 16 Y 1 A VAL 104 ? A VAL 104 717 16 Y 1 A GLU 105 ? A GLU 105 718 16 Y 1 A GLY 106 ? A GLY 106 719 16 Y 1 A MET 107 ? A MET 107 720 16 Y 1 A ARG 108 ? A ARG 108 721 16 Y 1 A MET 109 ? A MET 109 722 16 Y 1 A SER 110 ? A SER 110 723 16 Y 1 A ASN 111 ? A ASN 111 724 16 Y 1 A LEU 112 ? A LEU 112 725 16 Y 1 A VAL 113 ? A VAL 113 726 16 Y 1 A THR 114 ? A THR 114 727 16 Y 1 A SER 115 ? A SER 115 728 16 Y 1 A VAL 116 ? A VAL 116 729 16 Y 1 A VAL 117 ? A VAL 117 730 16 Y 1 A LYS 118 ? A LYS 118 731 16 Y 1 A HIS 119 ? A HIS 119 732 16 Y 1 A ASP 120 ? A ASP 120 733 16 Y 1 A GLU 121 ? A GLU 121 734 16 Y 1 A GLU 122 ? A GLU 122 735 16 Y 1 A ARG 123 ? A ARG 123 736 16 Y 1 A ARG 124 ? A ARG 124 737 16 Y 1 A VAL 125 ? A VAL 125 738 16 Y 1 A ASN 126 ? A ASN 126 739 16 Y 1 A PRO 127 ? A PRO 127 740 16 Y 1 A ASP 128 ? A ASP 128 741 16 Y 1 A ASP 129 ? A ASP 129 742 16 Y 1 A SER 130 ? A SER 130 743 16 Y 1 A LYS 131 ? A LYS 131 744 16 Y 1 A GLU 132 ? A GLU 132 745 16 Y 1 A ASP 133 ? A ASP 133 746 16 Y 1 A ALA 134 ? A ALA 134 747 16 Y 1 A LEU 135 ? A LEU 135 748 16 Y 1 A GLU 136 ? A GLU 136 749 16 Y 1 A VAL 137 ? A VAL 137 750 16 Y 1 A LEU 138 ? A LEU 138 751 16 Y 1 A PHE 139 ? A PHE 139 752 16 Y 1 A GLN 140 ? A GLN 140 753 17 Y 1 A SER 1 ? A SER 1 754 17 Y 1 A ALA 2 ? A ALA 2 755 17 Y 1 A LYS 3 ? A LYS 3 756 17 Y 1 A GLU 4 ? A GLU 4 757 17 Y 1 A PHE 5 ? A PHE 5 758 17 Y 1 A GLY 6 ? A GLY 6 759 17 Y 1 A ARG 7 ? A ARG 7 760 17 Y 1 A ASN 101 ? A ASN 101 761 17 Y 1 A SER 102 ? A SER 102 762 17 Y 1 A LEU 103 ? A LEU 103 763 17 Y 1 A VAL 104 ? A VAL 104 764 17 Y 1 A GLU 105 ? A GLU 105 765 17 Y 1 A GLY 106 ? A GLY 106 766 17 Y 1 A MET 107 ? A MET 107 767 17 Y 1 A ARG 108 ? A ARG 108 768 17 Y 1 A MET 109 ? A MET 109 769 17 Y 1 A SER 110 ? A SER 110 770 17 Y 1 A ASN 111 ? A ASN 111 771 17 Y 1 A LEU 112 ? A LEU 112 772 17 Y 1 A VAL 113 ? A VAL 113 773 17 Y 1 A THR 114 ? A THR 114 774 17 Y 1 A SER 115 ? A SER 115 775 17 Y 1 A VAL 116 ? A VAL 116 776 17 Y 1 A VAL 117 ? A VAL 117 777 17 Y 1 A LYS 118 ? A LYS 118 778 17 Y 1 A HIS 119 ? A HIS 119 779 17 Y 1 A ASP 120 ? A ASP 120 780 17 Y 1 A GLU 121 ? A GLU 121 781 17 Y 1 A GLU 122 ? A GLU 122 782 17 Y 1 A ARG 123 ? A ARG 123 783 17 Y 1 A ARG 124 ? A ARG 124 784 17 Y 1 A VAL 125 ? A VAL 125 785 17 Y 1 A ASN 126 ? A ASN 126 786 17 Y 1 A PRO 127 ? A PRO 127 787 17 Y 1 A ASP 128 ? A ASP 128 788 17 Y 1 A ASP 129 ? A ASP 129 789 17 Y 1 A SER 130 ? A SER 130 790 17 Y 1 A LYS 131 ? A LYS 131 791 17 Y 1 A GLU 132 ? A GLU 132 792 17 Y 1 A ASP 133 ? A ASP 133 793 17 Y 1 A ALA 134 ? A ALA 134 794 17 Y 1 A LEU 135 ? A LEU 135 795 17 Y 1 A GLU 136 ? A GLU 136 796 17 Y 1 A VAL 137 ? A VAL 137 797 17 Y 1 A LEU 138 ? A LEU 138 798 17 Y 1 A PHE 139 ? A PHE 139 799 17 Y 1 A GLN 140 ? A GLN 140 800 18 Y 1 A SER 1 ? A SER 1 801 18 Y 1 A ALA 2 ? A ALA 2 802 18 Y 1 A LYS 3 ? A LYS 3 803 18 Y 1 A GLU 4 ? A GLU 4 804 18 Y 1 A PHE 5 ? A PHE 5 805 18 Y 1 A GLY 6 ? A GLY 6 806 18 Y 1 A ARG 7 ? A ARG 7 807 18 Y 1 A ASN 101 ? A ASN 101 808 18 Y 1 A SER 102 ? A SER 102 809 18 Y 1 A LEU 103 ? A LEU 103 810 18 Y 1 A VAL 104 ? A VAL 104 811 18 Y 1 A GLU 105 ? A GLU 105 812 18 Y 1 A GLY 106 ? A GLY 106 813 18 Y 1 A MET 107 ? A MET 107 814 18 Y 1 A ARG 108 ? A ARG 108 815 18 Y 1 A MET 109 ? A MET 109 816 18 Y 1 A SER 110 ? A SER 110 817 18 Y 1 A ASN 111 ? A ASN 111 818 18 Y 1 A LEU 112 ? A LEU 112 819 18 Y 1 A VAL 113 ? A VAL 113 820 18 Y 1 A THR 114 ? A THR 114 821 18 Y 1 A SER 115 ? A SER 115 822 18 Y 1 A VAL 116 ? A VAL 116 823 18 Y 1 A VAL 117 ? A VAL 117 824 18 Y 1 A LYS 118 ? A LYS 118 825 18 Y 1 A HIS 119 ? A HIS 119 826 18 Y 1 A ASP 120 ? A ASP 120 827 18 Y 1 A GLU 121 ? A GLU 121 828 18 Y 1 A GLU 122 ? A GLU 122 829 18 Y 1 A ARG 123 ? A ARG 123 830 18 Y 1 A ARG 124 ? A ARG 124 831 18 Y 1 A VAL 125 ? A VAL 125 832 18 Y 1 A ASN 126 ? A ASN 126 833 18 Y 1 A PRO 127 ? A PRO 127 834 18 Y 1 A ASP 128 ? A ASP 128 835 18 Y 1 A ASP 129 ? A ASP 129 836 18 Y 1 A SER 130 ? A SER 130 837 18 Y 1 A LYS 131 ? A LYS 131 838 18 Y 1 A GLU 132 ? A GLU 132 839 18 Y 1 A ASP 133 ? A ASP 133 840 18 Y 1 A ALA 134 ? A ALA 134 841 18 Y 1 A LEU 135 ? A LEU 135 842 18 Y 1 A GLU 136 ? A GLU 136 843 18 Y 1 A VAL 137 ? A VAL 137 844 18 Y 1 A LEU 138 ? A LEU 138 845 18 Y 1 A PHE 139 ? A PHE 139 846 18 Y 1 A GLN 140 ? A GLN 140 847 19 Y 1 A SER 1 ? A SER 1 848 19 Y 1 A ALA 2 ? A ALA 2 849 19 Y 1 A LYS 3 ? A LYS 3 850 19 Y 1 A GLU 4 ? A GLU 4 851 19 Y 1 A PHE 5 ? A PHE 5 852 19 Y 1 A GLY 6 ? A GLY 6 853 19 Y 1 A ARG 7 ? A ARG 7 854 19 Y 1 A ASN 101 ? A ASN 101 855 19 Y 1 A SER 102 ? A SER 102 856 19 Y 1 A LEU 103 ? A LEU 103 857 19 Y 1 A VAL 104 ? A VAL 104 858 19 Y 1 A GLU 105 ? A GLU 105 859 19 Y 1 A GLY 106 ? A GLY 106 860 19 Y 1 A MET 107 ? A MET 107 861 19 Y 1 A ARG 108 ? A ARG 108 862 19 Y 1 A MET 109 ? A MET 109 863 19 Y 1 A SER 110 ? A SER 110 864 19 Y 1 A ASN 111 ? A ASN 111 865 19 Y 1 A LEU 112 ? A LEU 112 866 19 Y 1 A VAL 113 ? A VAL 113 867 19 Y 1 A THR 114 ? A THR 114 868 19 Y 1 A SER 115 ? A SER 115 869 19 Y 1 A VAL 116 ? A VAL 116 870 19 Y 1 A VAL 117 ? A VAL 117 871 19 Y 1 A LYS 118 ? A LYS 118 872 19 Y 1 A HIS 119 ? A HIS 119 873 19 Y 1 A ASP 120 ? A ASP 120 874 19 Y 1 A GLU 121 ? A GLU 121 875 19 Y 1 A GLU 122 ? A GLU 122 876 19 Y 1 A ARG 123 ? A ARG 123 877 19 Y 1 A ARG 124 ? A ARG 124 878 19 Y 1 A VAL 125 ? A VAL 125 879 19 Y 1 A ASN 126 ? A ASN 126 880 19 Y 1 A PRO 127 ? A PRO 127 881 19 Y 1 A ASP 128 ? A ASP 128 882 19 Y 1 A ASP 129 ? A ASP 129 883 19 Y 1 A SER 130 ? A SER 130 884 19 Y 1 A LYS 131 ? A LYS 131 885 19 Y 1 A GLU 132 ? A GLU 132 886 19 Y 1 A ASP 133 ? A ASP 133 887 19 Y 1 A ALA 134 ? A ALA 134 888 19 Y 1 A LEU 135 ? A LEU 135 889 19 Y 1 A GLU 136 ? A GLU 136 890 19 Y 1 A VAL 137 ? A VAL 137 891 19 Y 1 A LEU 138 ? A LEU 138 892 19 Y 1 A PHE 139 ? A PHE 139 893 19 Y 1 A GLN 140 ? A GLN 140 894 20 Y 1 A SER 1 ? A SER 1 895 20 Y 1 A ALA 2 ? A ALA 2 896 20 Y 1 A LYS 3 ? A LYS 3 897 20 Y 1 A GLU 4 ? A GLU 4 898 20 Y 1 A PHE 5 ? A PHE 5 899 20 Y 1 A GLY 6 ? A GLY 6 900 20 Y 1 A ARG 7 ? A ARG 7 901 20 Y 1 A ASN 101 ? A ASN 101 902 20 Y 1 A SER 102 ? A SER 102 903 20 Y 1 A LEU 103 ? A LEU 103 904 20 Y 1 A VAL 104 ? A VAL 104 905 20 Y 1 A GLU 105 ? A GLU 105 906 20 Y 1 A GLY 106 ? A GLY 106 907 20 Y 1 A MET 107 ? A MET 107 908 20 Y 1 A ARG 108 ? A ARG 108 909 20 Y 1 A MET 109 ? A MET 109 910 20 Y 1 A SER 110 ? A SER 110 911 20 Y 1 A ASN 111 ? A ASN 111 912 20 Y 1 A LEU 112 ? A LEU 112 913 20 Y 1 A VAL 113 ? A VAL 113 914 20 Y 1 A THR 114 ? A THR 114 915 20 Y 1 A SER 115 ? A SER 115 916 20 Y 1 A VAL 116 ? A VAL 116 917 20 Y 1 A VAL 117 ? A VAL 117 918 20 Y 1 A LYS 118 ? A LYS 118 919 20 Y 1 A HIS 119 ? A HIS 119 920 20 Y 1 A ASP 120 ? A ASP 120 921 20 Y 1 A GLU 121 ? A GLU 121 922 20 Y 1 A GLU 122 ? A GLU 122 923 20 Y 1 A ARG 123 ? A ARG 123 924 20 Y 1 A ARG 124 ? A ARG 124 925 20 Y 1 A VAL 125 ? A VAL 125 926 20 Y 1 A ASN 126 ? A ASN 126 927 20 Y 1 A PRO 127 ? A PRO 127 928 20 Y 1 A ASP 128 ? A ASP 128 929 20 Y 1 A ASP 129 ? A ASP 129 930 20 Y 1 A SER 130 ? A SER 130 931 20 Y 1 A LYS 131 ? A LYS 131 932 20 Y 1 A GLU 132 ? A GLU 132 933 20 Y 1 A ASP 133 ? A ASP 133 934 20 Y 1 A ALA 134 ? A ALA 134 935 20 Y 1 A LEU 135 ? A LEU 135 936 20 Y 1 A GLU 136 ? A GLU 136 937 20 Y 1 A VAL 137 ? A VAL 137 938 20 Y 1 A LEU 138 ? A LEU 138 939 20 Y 1 A PHE 139 ? A PHE 139 940 20 Y 1 A GLN 140 ? A GLN 140 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Spanish Ministry of Economy and Competitiveness' Spain CTQ2017-82222-R 1 'Spanish Ministry of Economy and Competitiveness' Spain CTQ2014-55907-R 2 # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #