data_6RBZ # _entry.id 6RBZ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.322 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 6RBZ WWPDB D_1292101723 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6RBZ _pdbx_database_status.recvd_initial_deposition_date 2019-04-11 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Gelin, M.' 1 ? 'Labesse, G.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Acs Infect Dis.' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2373-8227 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 6 _citation.language ? _citation.page_first 422 _citation.page_last 435 _citation.title 'From Substrate to Fragments to Inhibitor ActiveIn VivoagainstStaphylococcus aureus.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acsinfecdis.9b00368 _citation.pdbx_database_id_PubMed 32017533 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Gelin, M.' 1 ? primary 'Paoletti, J.' 2 ? primary 'Nahori, M.A.' 3 ? primary 'Huteau, V.' 4 ? primary 'Leseigneur, C.' 5 ? primary 'Jouvion, G.' 6 ? primary 'Dugue, L.' 7 ? primary 'Clement, D.' 8 ? primary 'Pons, J.L.' 9 ? primary 'Assairi, L.' 10 ? primary 'Pochet, S.' 11 ? primary 'Labesse, G.' 12 ? primary 'Dussurget, O.' 13 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6RBZ _cell.details ? _cell.formula_units_Z ? _cell.length_a 62.120 _cell.length_a_esd ? _cell.length_b 76.680 _cell.length_b_esd ? _cell.length_c 118.510 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6RBZ _symmetry.cell_setting ? _symmetry.Int_Tables_number 23 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'I 2 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'NAD kinase 1' 31045.279 1 2.7.1.23 ? ? ? 2 non-polymer syn 'CITRIC ACID' 192.124 1 ? ? ? ? 3 non-polymer syn '9-(3-azanylpropyl)-8-bromanyl-purin-6-amine' 271.117 1 ? ? ? ? 4 water nat water 18.015 30 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'ATP-dependent NAD kinase' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MKYMITSKGDEKSDLLRLNMIAGFGEYDMEYDDVEPEIVISIGGDGTFLSAFHQYEERLDEIAFIGIHTGHLGFYADWRP AEADKLVKLLAKGEYQKVSYPLLKTTVKYGIGKKEATYLALNESTVKSSGGPFVVDVVINDIHFERFRGDGLCMSTPSGT TAYNKSLGGALMHPSIEAMQLTEMASINNRVYRTIGSPLVFPKHHVVSLQPVNDKDFQISVDHLSILHRDVQEIRYEVSA KKIHFARFRSFPFWRRVHDSFIEDLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MKYMITSKGDEKSDLLRLNMIAGFGEYDMEYDDVEPEIVISIGGDGTFLSAFHQYEERLDEIAFIGIHTGHLGFYADWRP AEADKLVKLLAKGEYQKVSYPLLKTTVKYGIGKKEATYLALNESTVKSSGGPFVVDVVINDIHFERFRGDGLCMSTPSGT TAYNKSLGGALMHPSIEAMQLTEMASINNRVYRTIGSPLVFPKHHVVSLQPVNDKDFQISVDHLSILHRDVQEIRYEVSA KKIHFARFRSFPFWRRVHDSFIEDLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LYS n 1 3 TYR n 1 4 MET n 1 5 ILE n 1 6 THR n 1 7 SER n 1 8 LYS n 1 9 GLY n 1 10 ASP n 1 11 GLU n 1 12 LYS n 1 13 SER n 1 14 ASP n 1 15 LEU n 1 16 LEU n 1 17 ARG n 1 18 LEU n 1 19 ASN n 1 20 MET n 1 21 ILE n 1 22 ALA n 1 23 GLY n 1 24 PHE n 1 25 GLY n 1 26 GLU n 1 27 TYR n 1 28 ASP n 1 29 MET n 1 30 GLU n 1 31 TYR n 1 32 ASP n 1 33 ASP n 1 34 VAL n 1 35 GLU n 1 36 PRO n 1 37 GLU n 1 38 ILE n 1 39 VAL n 1 40 ILE n 1 41 SER n 1 42 ILE n 1 43 GLY n 1 44 GLY n 1 45 ASP n 1 46 GLY n 1 47 THR n 1 48 PHE n 1 49 LEU n 1 50 SER n 1 51 ALA n 1 52 PHE n 1 53 HIS n 1 54 GLN n 1 55 TYR n 1 56 GLU n 1 57 GLU n 1 58 ARG n 1 59 LEU n 1 60 ASP n 1 61 GLU n 1 62 ILE n 1 63 ALA n 1 64 PHE n 1 65 ILE n 1 66 GLY n 1 67 ILE n 1 68 HIS n 1 69 THR n 1 70 GLY n 1 71 HIS n 1 72 LEU n 1 73 GLY n 1 74 PHE n 1 75 TYR n 1 76 ALA n 1 77 ASP n 1 78 TRP n 1 79 ARG n 1 80 PRO n 1 81 ALA n 1 82 GLU n 1 83 ALA n 1 84 ASP n 1 85 LYS n 1 86 LEU n 1 87 VAL n 1 88 LYS n 1 89 LEU n 1 90 LEU n 1 91 ALA n 1 92 LYS n 1 93 GLY n 1 94 GLU n 1 95 TYR n 1 96 GLN n 1 97 LYS n 1 98 VAL n 1 99 SER n 1 100 TYR n 1 101 PRO n 1 102 LEU n 1 103 LEU n 1 104 LYS n 1 105 THR n 1 106 THR n 1 107 VAL n 1 108 LYS n 1 109 TYR n 1 110 GLY n 1 111 ILE n 1 112 GLY n 1 113 LYS n 1 114 LYS n 1 115 GLU n 1 116 ALA n 1 117 THR n 1 118 TYR n 1 119 LEU n 1 120 ALA n 1 121 LEU n 1 122 ASN n 1 123 GLU n 1 124 SER n 1 125 THR n 1 126 VAL n 1 127 LYS n 1 128 SER n 1 129 SER n 1 130 GLY n 1 131 GLY n 1 132 PRO n 1 133 PHE n 1 134 VAL n 1 135 VAL n 1 136 ASP n 1 137 VAL n 1 138 VAL n 1 139 ILE n 1 140 ASN n 1 141 ASP n 1 142 ILE n 1 143 HIS n 1 144 PHE n 1 145 GLU n 1 146 ARG n 1 147 PHE n 1 148 ARG n 1 149 GLY n 1 150 ASP n 1 151 GLY n 1 152 LEU n 1 153 CYS n 1 154 MET n 1 155 SER n 1 156 THR n 1 157 PRO n 1 158 SER n 1 159 GLY n 1 160 THR n 1 161 THR n 1 162 ALA n 1 163 TYR n 1 164 ASN n 1 165 LYS n 1 166 SER n 1 167 LEU n 1 168 GLY n 1 169 GLY n 1 170 ALA n 1 171 LEU n 1 172 MET n 1 173 HIS n 1 174 PRO n 1 175 SER n 1 176 ILE n 1 177 GLU n 1 178 ALA n 1 179 MET n 1 180 GLN n 1 181 LEU n 1 182 THR n 1 183 GLU n 1 184 MET n 1 185 ALA n 1 186 SER n 1 187 ILE n 1 188 ASN n 1 189 ASN n 1 190 ARG n 1 191 VAL n 1 192 TYR n 1 193 ARG n 1 194 THR n 1 195 ILE n 1 196 GLY n 1 197 SER n 1 198 PRO n 1 199 LEU n 1 200 VAL n 1 201 PHE n 1 202 PRO n 1 203 LYS n 1 204 HIS n 1 205 HIS n 1 206 VAL n 1 207 VAL n 1 208 SER n 1 209 LEU n 1 210 GLN n 1 211 PRO n 1 212 VAL n 1 213 ASN n 1 214 ASP n 1 215 LYS n 1 216 ASP n 1 217 PHE n 1 218 GLN n 1 219 ILE n 1 220 SER n 1 221 VAL n 1 222 ASP n 1 223 HIS n 1 224 LEU n 1 225 SER n 1 226 ILE n 1 227 LEU n 1 228 HIS n 1 229 ARG n 1 230 ASP n 1 231 VAL n 1 232 GLN n 1 233 GLU n 1 234 ILE n 1 235 ARG n 1 236 TYR n 1 237 GLU n 1 238 VAL n 1 239 SER n 1 240 ALA n 1 241 LYS n 1 242 LYS n 1 243 ILE n 1 244 HIS n 1 245 PHE n 1 246 ALA n 1 247 ARG n 1 248 PHE n 1 249 ARG n 1 250 SER n 1 251 PHE n 1 252 PRO n 1 253 PHE n 1 254 TRP n 1 255 ARG n 1 256 ARG n 1 257 VAL n 1 258 HIS n 1 259 ASP n 1 260 SER n 1 261 PHE n 1 262 ILE n 1 263 GLU n 1 264 ASP n 1 265 LEU n 1 266 GLU n 1 267 HIS n 1 268 HIS n 1 269 HIS n 1 270 HIS n 1 271 HIS n 1 272 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 272 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'nadK1, lmo0968' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 169963 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code NADK1_LISMO _struct_ref.pdbx_db_accession Q8Y8D7 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MKYMITSKGDEKSDLLRLNMIAGFGEYDMEYDDVEPEIVISIGGDGTFLSAFHQYEERLDEIAFIGIHTGHLGFYADWRP AEADKLVKLLAKGEYQKVSYPLLKTTVKYGIGKKEATYLALNESTVKSSGGPFVVDVVINDIHFERFRGDGLCMSTPSGT TAYNKSLGGALMHPSIEAMQLTEMASINNRVYRTIGSPLVFPKHHVVSLQPVNDKDFQISVDHLSILHRDVQEIRYEVSA KKIHFARFRSFPFWRRVHDSFIED ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6RBZ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 264 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8Y8D7 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 264 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 264 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6RBZ LEU A 265 ? UNP Q8Y8D7 ? ? 'expression tag' 265 1 1 6RBZ GLU A 266 ? UNP Q8Y8D7 ? ? 'expression tag' 266 2 1 6RBZ HIS A 267 ? UNP Q8Y8D7 ? ? 'expression tag' 267 3 1 6RBZ HIS A 268 ? UNP Q8Y8D7 ? ? 'expression tag' 268 4 1 6RBZ HIS A 269 ? UNP Q8Y8D7 ? ? 'expression tag' 269 5 1 6RBZ HIS A 270 ? UNP Q8Y8D7 ? ? 'expression tag' 270 6 1 6RBZ HIS A 271 ? UNP Q8Y8D7 ? ? 'expression tag' 271 7 1 6RBZ HIS A 272 ? UNP Q8Y8D7 ? ? 'expression tag' 272 8 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CIT non-polymer . 'CITRIC ACID' ? 'C6 H8 O7' 192.124 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 JXK non-polymer . '9-(3-azanylpropyl)-8-bromanyl-purin-6-amine' ? 'C8 H11 Br N6' 271.117 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6RBZ _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.27 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 45.88 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method EVAPORATION _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 5.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '30 mM NaBr, 220 mM Kcitrate, glycerol 6%, 15-16% w/v PEG400' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 S 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-03-09 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.978 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE ID30B' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.978 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ID30B _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate 48.280 _reflns.entry_id 6RBZ _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.318 _reflns.d_resolution_low 55.020 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 12508 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.800 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 4.700 _reflns.pdbx_Rmerge_I_obs 0.057 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 14.200 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.064 _reflns.pdbx_Rpim_I_all 0.029 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 58780 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 2.318 2.358 ? ? 3035 ? ? ? 620 99.500 ? ? ? ? 0.680 ? ? ? ? ? ? ? ? 4.900 ? ? ? 2.500 0.760 0.332 ? 1 1 0.932 ? 6.288 55.020 ? ? 2874 ? ? ? 686 97.700 ? ? ? ? 0.025 ? ? ? ? ? ? ? ? 4.200 ? ? ? 36.400 0.028 0.014 ? 2 1 0.999 ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 129.610 _refine.B_iso_mean 62.8060 _refine.B_iso_min 35.210 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6RBZ _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.3180 _refine.ls_d_res_low 55.0200 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 12465 _refine.ls_number_reflns_R_free 617 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.4200 _refine.ls_percent_reflns_R_free 4.9500 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2147 _refine.ls_R_factor_R_free 0.2371 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2136 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.340 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 31.4500 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id ? _refine.overall_SU_B ? _refine.overall_SU_ML 0.3000 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.3180 _refine_hist.d_res_low 55.0200 _refine_hist.number_atoms_solvent 30 _refine_hist.number_atoms_total 2138 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 262 _refine_hist.pdbx_B_iso_mean_ligand 97.34 _refine_hist.pdbx_B_iso_mean_solvent 55.69 _refine_hist.pdbx_number_atoms_protein 2069 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 39 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.3177 2.5509 3073 . 142 2931 99.0000 . . . 0.3272 0.0000 0.2710 . . . . . . 4 . . . 'X-RAY DIFFRACTION' 2.5509 2.9200 3089 . 172 2917 99.0000 . . . 0.3518 0.0000 0.2713 . . . . . . 4 . . . 'X-RAY DIFFRACTION' 2.9200 3.6788 3110 . 145 2965 99.0000 . . . 0.2916 0.0000 0.2325 . . . . . . 4 . . . 'X-RAY DIFFRACTION' 3.6788 55.0351 3193 . 158 3035 97.0000 . . . 0.1798 0.0000 0.1846 . . . . . . 4 . . . # _struct.entry_id 6RBZ _struct.title 'Crystal structure of NAD kinase 1 from Listeria monocytogenes in complexe with an adenine derivative' _struct.pdbx_descriptor 'NAD kinase 1 (E.C.2.7.1.23)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6RBZ _struct_keywords.text 'tetrameric NAD kinase, transferase' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 10 ? GLU A 26 ? ASP A 10 GLU A 26 1 ? 17 HELX_P HELX_P2 AA2 GLY A 44 ? TYR A 55 ? GLY A 44 TYR A 55 1 ? 12 HELX_P HELX_P3 AA3 GLU A 56 ? ILE A 62 ? GLU A 56 ILE A 62 5 ? 7 HELX_P HELX_P4 AA4 ARG A 79 ? ALA A 81 ? ARG A 79 ALA A 81 5 ? 3 HELX_P HELX_P5 AA5 GLU A 82 ? LYS A 92 ? GLU A 82 LYS A 92 1 ? 11 HELX_P HELX_P6 AA6 PRO A 157 ? THR A 161 ? PRO A 157 THR A 161 5 ? 5 HELX_P HELX_P7 AA7 ALA A 162 ? LEU A 167 ? ALA A 162 LEU A 167 1 ? 6 HELX_P HELX_P8 AA8 PRO A 252 ? ILE A 262 ? PRO A 252 ILE A 262 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 8 ? AA3 ? 9 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA2 5 6 ? anti-parallel AA2 6 7 ? anti-parallel AA2 7 8 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel AA3 4 5 ? anti-parallel AA3 5 6 ? anti-parallel AA3 6 7 ? anti-parallel AA3 7 8 ? anti-parallel AA3 8 9 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLU A 30 ? TYR A 31 ? GLU A 30 TYR A 31 AA1 2 LYS A 2 ? SER A 7 ? LYS A 2 SER A 7 AA1 3 ILE A 38 ? GLY A 43 ? ILE A 38 GLY A 43 AA1 4 ALA A 63 ? HIS A 68 ? ALA A 63 HIS A 68 AA2 1 GLU A 115 ? ALA A 120 ? GLU A 115 ALA A 120 AA2 2 GLN A 96 ? TYR A 109 ? GLN A 96 TYR A 109 AA2 3 VAL A 231 ? ARG A 247 ? VAL A 231 ARG A 247 AA2 4 VAL A 207 ? PRO A 211 ? VAL A 207 PRO A 211 AA2 5 PHE A 133 ? ILE A 139 ? PHE A 133 ILE A 139 AA2 6 ILE A 142 ? SER A 155 ? ILE A 142 SER A 155 AA2 7 ALA A 178 ? SER A 186 ? ALA A 178 SER A 186 AA2 8 LEU A 199 ? PRO A 202 ? LEU A 199 PRO A 202 AA3 1 GLU A 115 ? ALA A 120 ? GLU A 115 ALA A 120 AA3 2 GLN A 96 ? TYR A 109 ? GLN A 96 TYR A 109 AA3 3 VAL A 231 ? ARG A 247 ? VAL A 231 ARG A 247 AA3 4 VAL A 207 ? PRO A 211 ? VAL A 207 PRO A 211 AA3 5 PHE A 133 ? ILE A 139 ? PHE A 133 ILE A 139 AA3 6 ILE A 142 ? SER A 155 ? ILE A 142 SER A 155 AA3 7 GLU A 123 ? SER A 128 ? GLU A 123 SER A 128 AA3 8 PHE A 217 ? VAL A 221 ? PHE A 217 VAL A 221 AA3 9 LEU A 224 ? HIS A 228 ? LEU A 224 HIS A 228 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O GLU A 30 ? O GLU A 30 N TYR A 3 ? N TYR A 3 AA1 2 3 N MET A 4 ? N MET A 4 O ILE A 40 ? O ILE A 40 AA1 3 4 N SER A 41 ? N SER A 41 O ILE A 65 ? O ILE A 65 AA2 1 2 O ALA A 116 ? O ALA A 116 N VAL A 107 ? N VAL A 107 AA2 2 3 N VAL A 98 ? N VAL A 98 O PHE A 245 ? O PHE A 245 AA2 3 4 O ILE A 234 ? O ILE A 234 N LEU A 209 ? N LEU A 209 AA2 4 5 O SER A 208 ? O SER A 208 N VAL A 138 ? N VAL A 138 AA2 5 6 N VAL A 137 ? N VAL A 137 O GLU A 145 ? O GLU A 145 AA2 6 7 N SER A 155 ? N SER A 155 O GLN A 180 ? O GLN A 180 AA2 7 8 N MET A 179 ? N MET A 179 O PHE A 201 ? O PHE A 201 AA3 1 2 O ALA A 116 ? O ALA A 116 N VAL A 107 ? N VAL A 107 AA3 2 3 N VAL A 98 ? N VAL A 98 O PHE A 245 ? O PHE A 245 AA3 3 4 O ILE A 234 ? O ILE A 234 N LEU A 209 ? N LEU A 209 AA3 4 5 O SER A 208 ? O SER A 208 N VAL A 138 ? N VAL A 138 AA3 5 6 N VAL A 137 ? N VAL A 137 O GLU A 145 ? O GLU A 145 AA3 6 7 O MET A 154 ? O MET A 154 N SER A 124 ? N SER A 124 AA3 7 8 N THR A 125 ? N THR A 125 O SER A 220 ? O SER A 220 AA3 8 9 N ILE A 219 ? N ILE A 219 O ILE A 226 ? O ILE A 226 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A CIT 301 ? 8 'binding site for residue CIT A 301' AC2 Software A JXK 302 ? 8 'binding site for residue JXK A 302' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 8 TYR A 100 ? TYR A 100 . ? 1_555 ? 2 AC1 8 HIS A 173 ? HIS A 173 . ? 1_555 ? 3 AC1 8 ARG A 247 ? ARG A 247 . ? 1_555 ? 4 AC1 8 PHE A 251 ? PHE A 251 . ? 1_555 ? 5 AC1 8 PRO A 252 ? PRO A 252 . ? 1_555 ? 6 AC1 8 PHE A 253 ? PHE A 253 . ? 1_555 ? 7 AC1 8 ARG A 256 ? ARG A 256 . ? 1_555 ? 8 AC1 8 HOH D . ? HOH A 405 . ? 1_555 ? 9 AC2 8 ASP A 45 ? ASP A 45 . ? 1_555 ? 10 AC2 8 LEU A 49 ? LEU A 49 . ? 1_555 ? 11 AC2 8 PHE A 74 ? PHE A 74 . ? 1_555 ? 12 AC2 8 TYR A 75 ? TYR A 75 . ? 1_555 ? 13 AC2 8 ASN A 122 ? ASN A 122 . ? 1_555 ? 14 AC2 8 SER A 158 ? SER A 158 . ? 1_555 ? 15 AC2 8 THR A 161 ? THR A 161 . ? 1_555 ? 16 AC2 8 ALA A 162 ? ALA A 162 . ? 1_555 ? # _atom_sites.entry_id 6RBZ _atom_sites.fract_transf_matrix[1][1] 0.016098 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013041 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008438 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol BR C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 LYS 2 2 2 LYS LYS A . n A 1 3 TYR 3 3 3 TYR TYR A . n A 1 4 MET 4 4 4 MET MET A . n A 1 5 ILE 5 5 5 ILE ILE A . n A 1 6 THR 6 6 6 THR THR A . n A 1 7 SER 7 7 7 SER SER A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 ARG 17 17 17 ARG ARG A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 ASN 19 19 19 ASN ASN A . n A 1 20 MET 20 20 20 MET MET A . n A 1 21 ILE 21 21 21 ILE ILE A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 PHE 24 24 24 PHE PHE A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 TYR 27 27 27 TYR TYR A . n A 1 28 ASP 28 28 28 ASP ASP A . n A 1 29 MET 29 29 29 MET MET A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 TYR 31 31 31 TYR TYR A . n A 1 32 ASP 32 32 32 ASP ASP A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 PRO 36 36 36 PRO PRO A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 ILE 38 38 38 ILE ILE A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 ILE 40 40 40 ILE ILE A . n A 1 41 SER 41 41 41 SER SER A . n A 1 42 ILE 42 42 42 ILE ILE A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 ASP 45 45 45 ASP ASP A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 THR 47 47 47 THR THR A . n A 1 48 PHE 48 48 48 PHE PHE A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 SER 50 50 50 SER SER A . n A 1 51 ALA 51 51 51 ALA ALA A . n A 1 52 PHE 52 52 52 PHE PHE A . n A 1 53 HIS 53 53 53 HIS HIS A . n A 1 54 GLN 54 54 54 GLN GLN A . n A 1 55 TYR 55 55 55 TYR TYR A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 ARG 58 58 58 ARG ARG A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 ILE 62 62 62 ILE ILE A . n A 1 63 ALA 63 63 63 ALA ALA A . n A 1 64 PHE 64 64 64 PHE PHE A . n A 1 65 ILE 65 65 65 ILE ILE A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 ILE 67 67 67 ILE ILE A . n A 1 68 HIS 68 68 68 HIS HIS A . n A 1 69 THR 69 69 69 THR THR A . n A 1 70 GLY 70 70 70 GLY GLY A . n A 1 71 HIS 71 71 71 HIS HIS A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 GLY 73 73 73 GLY GLY A . n A 1 74 PHE 74 74 74 PHE PHE A . n A 1 75 TYR 75 75 75 TYR TYR A . n A 1 76 ALA 76 76 76 ALA ALA A . n A 1 77 ASP 77 77 77 ASP ASP A . n A 1 78 TRP 78 78 78 TRP TRP A . n A 1 79 ARG 79 79 79 ARG ARG A . n A 1 80 PRO 80 80 80 PRO PRO A . n A 1 81 ALA 81 81 81 ALA ALA A . n A 1 82 GLU 82 82 82 GLU GLU A . n A 1 83 ALA 83 83 83 ALA ALA A . n A 1 84 ASP 84 84 84 ASP ASP A . n A 1 85 LYS 85 85 85 LYS LYS A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 VAL 87 87 87 VAL VAL A . n A 1 88 LYS 88 88 88 LYS LYS A . n A 1 89 LEU 89 89 89 LEU LEU A . n A 1 90 LEU 90 90 90 LEU LEU A . n A 1 91 ALA 91 91 91 ALA ALA A . n A 1 92 LYS 92 92 92 LYS LYS A . n A 1 93 GLY 93 93 93 GLY GLY A . n A 1 94 GLU 94 94 94 GLU GLU A . n A 1 95 TYR 95 95 95 TYR TYR A . n A 1 96 GLN 96 96 96 GLN GLN A . n A 1 97 LYS 97 97 97 LYS LYS A . n A 1 98 VAL 98 98 98 VAL VAL A . n A 1 99 SER 99 99 99 SER SER A . n A 1 100 TYR 100 100 100 TYR TYR A . n A 1 101 PRO 101 101 101 PRO PRO A . n A 1 102 LEU 102 102 102 LEU LEU A . n A 1 103 LEU 103 103 103 LEU LEU A . n A 1 104 LYS 104 104 104 LYS LYS A . n A 1 105 THR 105 105 105 THR THR A . n A 1 106 THR 106 106 106 THR THR A . n A 1 107 VAL 107 107 107 VAL VAL A . n A 1 108 LYS 108 108 108 LYS LYS A . n A 1 109 TYR 109 109 109 TYR TYR A . n A 1 110 GLY 110 110 110 GLY GLY A . n A 1 111 ILE 111 111 ? ? ? A . n A 1 112 GLY 112 112 ? ? ? A . n A 1 113 LYS 113 113 113 LYS LYS A . n A 1 114 LYS 114 114 114 LYS LYS A . n A 1 115 GLU 115 115 115 GLU GLU A . n A 1 116 ALA 116 116 116 ALA ALA A . n A 1 117 THR 117 117 117 THR THR A . n A 1 118 TYR 118 118 118 TYR TYR A . n A 1 119 LEU 119 119 119 LEU LEU A . n A 1 120 ALA 120 120 120 ALA ALA A . n A 1 121 LEU 121 121 121 LEU LEU A . n A 1 122 ASN 122 122 122 ASN ASN A . n A 1 123 GLU 123 123 123 GLU GLU A . n A 1 124 SER 124 124 124 SER SER A . n A 1 125 THR 125 125 125 THR THR A . n A 1 126 VAL 126 126 126 VAL VAL A . n A 1 127 LYS 127 127 127 LYS LYS A . n A 1 128 SER 128 128 128 SER SER A . n A 1 129 SER 129 129 129 SER SER A . n A 1 130 GLY 130 130 130 GLY GLY A . n A 1 131 GLY 131 131 131 GLY GLY A . n A 1 132 PRO 132 132 132 PRO PRO A . n A 1 133 PHE 133 133 133 PHE PHE A . n A 1 134 VAL 134 134 134 VAL VAL A . n A 1 135 VAL 135 135 135 VAL VAL A . n A 1 136 ASP 136 136 136 ASP ASP A . n A 1 137 VAL 137 137 137 VAL VAL A . n A 1 138 VAL 138 138 138 VAL VAL A . n A 1 139 ILE 139 139 139 ILE ILE A . n A 1 140 ASN 140 140 140 ASN ASN A . n A 1 141 ASP 141 141 141 ASP ASP A . n A 1 142 ILE 142 142 142 ILE ILE A . n A 1 143 HIS 143 143 143 HIS HIS A . n A 1 144 PHE 144 144 144 PHE PHE A . n A 1 145 GLU 145 145 145 GLU GLU A . n A 1 146 ARG 146 146 146 ARG ARG A . n A 1 147 PHE 147 147 147 PHE PHE A . n A 1 148 ARG 148 148 148 ARG ARG A . n A 1 149 GLY 149 149 149 GLY GLY A . n A 1 150 ASP 150 150 150 ASP ASP A . n A 1 151 GLY 151 151 151 GLY GLY A . n A 1 152 LEU 152 152 152 LEU LEU A . n A 1 153 CYS 153 153 153 CYS CYS A . n A 1 154 MET 154 154 154 MET MET A . n A 1 155 SER 155 155 155 SER SER A . n A 1 156 THR 156 156 156 THR THR A . n A 1 157 PRO 157 157 157 PRO PRO A . n A 1 158 SER 158 158 158 SER SER A . n A 1 159 GLY 159 159 159 GLY GLY A . n A 1 160 THR 160 160 160 THR THR A . n A 1 161 THR 161 161 161 THR THR A . n A 1 162 ALA 162 162 162 ALA ALA A . n A 1 163 TYR 163 163 163 TYR TYR A . n A 1 164 ASN 164 164 164 ASN ASN A . n A 1 165 LYS 165 165 165 LYS LYS A . n A 1 166 SER 166 166 166 SER SER A . n A 1 167 LEU 167 167 167 LEU LEU A . n A 1 168 GLY 168 168 168 GLY GLY A . n A 1 169 GLY 169 169 169 GLY GLY A . n A 1 170 ALA 170 170 170 ALA ALA A . n A 1 171 LEU 171 171 171 LEU LEU A . n A 1 172 MET 172 172 172 MET MET A . n A 1 173 HIS 173 173 173 HIS HIS A . n A 1 174 PRO 174 174 174 PRO PRO A . n A 1 175 SER 175 175 175 SER SER A . n A 1 176 ILE 176 176 176 ILE ILE A . n A 1 177 GLU 177 177 177 GLU GLU A . n A 1 178 ALA 178 178 178 ALA ALA A . n A 1 179 MET 179 179 179 MET MET A . n A 1 180 GLN 180 180 180 GLN GLN A . n A 1 181 LEU 181 181 181 LEU LEU A . n A 1 182 THR 182 182 182 THR THR A . n A 1 183 GLU 183 183 183 GLU GLU A . n A 1 184 MET 184 184 184 MET MET A . n A 1 185 ALA 185 185 185 ALA ALA A . n A 1 186 SER 186 186 186 SER SER A . n A 1 187 ILE 187 187 187 ILE ILE A . n A 1 188 ASN 188 188 188 ASN ASN A . n A 1 189 ASN 189 189 189 ASN ASN A . n A 1 190 ARG 190 190 190 ARG ARG A . n A 1 191 VAL 191 191 191 VAL VAL A . n A 1 192 TYR 192 192 192 TYR TYR A . n A 1 193 ARG 193 193 193 ARG ARG A . n A 1 194 THR 194 194 194 THR THR A . n A 1 195 ILE 195 195 195 ILE ILE A . n A 1 196 GLY 196 196 196 GLY GLY A . n A 1 197 SER 197 197 197 SER SER A . n A 1 198 PRO 198 198 198 PRO PRO A . n A 1 199 LEU 199 199 199 LEU LEU A . n A 1 200 VAL 200 200 200 VAL VAL A . n A 1 201 PHE 201 201 201 PHE PHE A . n A 1 202 PRO 202 202 202 PRO PRO A . n A 1 203 LYS 203 203 203 LYS LYS A . n A 1 204 HIS 204 204 204 HIS HIS A . n A 1 205 HIS 205 205 205 HIS HIS A . n A 1 206 VAL 206 206 206 VAL VAL A . n A 1 207 VAL 207 207 207 VAL VAL A . n A 1 208 SER 208 208 208 SER SER A . n A 1 209 LEU 209 209 209 LEU LEU A . n A 1 210 GLN 210 210 210 GLN GLN A . n A 1 211 PRO 211 211 211 PRO PRO A . n A 1 212 VAL 212 212 212 VAL VAL A . n A 1 213 ASN 213 213 213 ASN ASN A . n A 1 214 ASP 214 214 214 ASP ASP A . n A 1 215 LYS 215 215 215 LYS LYS A . n A 1 216 ASP 216 216 216 ASP ASP A . n A 1 217 PHE 217 217 217 PHE PHE A . n A 1 218 GLN 218 218 218 GLN GLN A . n A 1 219 ILE 219 219 219 ILE ILE A . n A 1 220 SER 220 220 220 SER SER A . n A 1 221 VAL 221 221 221 VAL VAL A . n A 1 222 ASP 222 222 222 ASP ASP A . n A 1 223 HIS 223 223 223 HIS HIS A . n A 1 224 LEU 224 224 224 LEU LEU A . n A 1 225 SER 225 225 225 SER SER A . n A 1 226 ILE 226 226 226 ILE ILE A . n A 1 227 LEU 227 227 227 LEU LEU A . n A 1 228 HIS 228 228 228 HIS HIS A . n A 1 229 ARG 229 229 229 ARG ARG A . n A 1 230 ASP 230 230 230 ASP ASP A . n A 1 231 VAL 231 231 231 VAL VAL A . n A 1 232 GLN 232 232 232 GLN GLN A . n A 1 233 GLU 233 233 233 GLU GLU A . n A 1 234 ILE 234 234 234 ILE ILE A . n A 1 235 ARG 235 235 235 ARG ARG A . n A 1 236 TYR 236 236 236 TYR TYR A . n A 1 237 GLU 237 237 237 GLU GLU A . n A 1 238 VAL 238 238 238 VAL VAL A . n A 1 239 SER 239 239 239 SER SER A . n A 1 240 ALA 240 240 240 ALA ALA A . n A 1 241 LYS 241 241 241 LYS LYS A . n A 1 242 LYS 242 242 242 LYS LYS A . n A 1 243 ILE 243 243 243 ILE ILE A . n A 1 244 HIS 244 244 244 HIS HIS A . n A 1 245 PHE 245 245 245 PHE PHE A . n A 1 246 ALA 246 246 246 ALA ALA A . n A 1 247 ARG 247 247 247 ARG ARG A . n A 1 248 PHE 248 248 248 PHE PHE A . n A 1 249 ARG 249 249 249 ARG ARG A . n A 1 250 SER 250 250 250 SER SER A . n A 1 251 PHE 251 251 251 PHE PHE A . n A 1 252 PRO 252 252 252 PRO PRO A . n A 1 253 PHE 253 253 253 PHE PHE A . n A 1 254 TRP 254 254 254 TRP TRP A . n A 1 255 ARG 255 255 255 ARG ARG A . n A 1 256 ARG 256 256 256 ARG ARG A . n A 1 257 VAL 257 257 257 VAL VAL A . n A 1 258 HIS 258 258 258 HIS HIS A . n A 1 259 ASP 259 259 259 ASP ASP A . n A 1 260 SER 260 260 260 SER SER A . n A 1 261 PHE 261 261 261 PHE PHE A . n A 1 262 ILE 262 262 262 ILE ILE A . n A 1 263 GLU 263 263 263 GLU GLU A . n A 1 264 ASP 264 264 264 ASP ASP A . n A 1 265 LEU 265 265 ? ? ? A . n A 1 266 GLU 266 266 ? ? ? A . n A 1 267 HIS 267 267 ? ? ? A . n A 1 268 HIS 268 268 ? ? ? A . n A 1 269 HIS 269 269 ? ? ? A . n A 1 270 HIS 270 270 ? ? ? A . n A 1 271 HIS 271 271 ? ? ? A . n A 1 272 HIS 272 272 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CIT 1 301 1 CIT CIT A . C 3 JXK 1 302 1 JXK B3N A . D 4 HOH 1 401 3 HOH HOH A . D 4 HOH 2 402 5 HOH HOH A . D 4 HOH 3 403 8 HOH HOH A . D 4 HOH 4 404 12 HOH HOH A . D 4 HOH 5 405 2 HOH HOH A . D 4 HOH 6 406 1 HOH HOH A . D 4 HOH 7 407 6 HOH HOH A . D 4 HOH 8 408 9 HOH HOH A . D 4 HOH 9 409 10 HOH HOH A . D 4 HOH 10 410 7 HOH HOH A . D 4 HOH 11 411 4 HOH HOH A . D 4 HOH 12 412 38 HOH HOH A . D 4 HOH 13 413 15 HOH HOH A . D 4 HOH 14 414 11 HOH HOH A . D 4 HOH 15 415 17 HOH HOH A . D 4 HOH 16 416 26 HOH HOH A . D 4 HOH 17 417 37 HOH HOH A . D 4 HOH 18 418 31 HOH HOH A . D 4 HOH 19 419 43 HOH HOH A . D 4 HOH 20 420 36 HOH HOH A . D 4 HOH 21 421 13 HOH HOH A . D 4 HOH 22 422 19 HOH HOH A . D 4 HOH 23 423 41 HOH HOH A . D 4 HOH 24 424 39 HOH HOH A . D 4 HOH 25 425 20 HOH HOH A . D 4 HOH 26 426 25 HOH HOH A . D 4 HOH 27 427 42 HOH HOH A . D 4 HOH 28 428 33 HOH HOH A . D 4 HOH 29 429 40 HOH HOH A . D 4 HOH 30 430 30 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B,C,D 1 2 A,B,C,D 1 3 A,B,C,D 1 4 A,B,C,D # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_655 -x+1,-y,z -1.0000000000 0.0000000000 0.0000000000 62.1200000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_655 -x+1,y,-z -1.0000000000 0.0000000000 0.0000000000 62.1200000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 4 'crystal symmetry operation' 4_555 x,-y,-z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-02-19 2 'Structure model' 1 1 2020-03-25 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # _pdbx_audit_revision_category.ordinal 1 _pdbx_audit_revision_category.revision_ordinal 2 _pdbx_audit_revision_category.data_content_type 'Structure model' _pdbx_audit_revision_category.category citation # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation.title' # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined 8.5193 22.9141 28.6397 0.5906 ? 0.0495 ? 0.0158 ? 0.8528 ? -0.0698 ? 0.5477 ? 3.1594 ? -0.8685 ? -0.7052 ? 2.0780 ? 0.9700 ? 3.5515 ? -0.0470 ? -0.9885 ? 0.1786 ? 0.0548 ? -0.1593 ? 0.1436 ? -0.2614 ? 0.1871 ? -0.0576 ? 2 'X-RAY DIFFRACTION' ? refined 14.5707 25.6162 19.7756 0.5592 ? 0.0106 ? 0.0661 ? 0.7384 ? -0.1185 ? 0.6010 ? 3.3164 ? -0.9246 ? -1.5941 ? 1.5382 ? 1.0262 ? 3.5348 ? 0.1145 ? -0.5880 ? 0.5956 ? 0.1082 ? 0.1104 ? -0.1326 ? -0.2163 ? -0.0633 ? -0.1775 ? 3 'X-RAY DIFFRACTION' ? refined 7.2564 20.3595 -5.5192 0.6484 ? 0.0556 ? 0.0131 ? 0.8674 ? 0.0695 ? 0.6665 ? 3.5870 ? -1.9554 ? -1.4807 ? 1.3320 ? 0.7886 ? 0.6638 ? -0.0545 ? 0.2688 ? 0.7888 ? -0.4289 ? -0.0842 ? 0.8931 ? -0.4701 ? -0.4137 ? 0.0354 ? 4 'X-RAY DIFFRACTION' ? refined 20.4239 11.3645 -3.8126 0.4289 ? 0.0203 ? 0.0372 ? 0.4599 ? 0.0342 ? 0.4275 ? 1.5263 ? 0.1224 ? -0.1550 ? 0.9960 ? 0.9775 ? 2.6499 ? 0.0937 ? 0.2143 ? 0.0482 ? -0.0579 ? 0.0168 ? 0.0786 ? -0.0904 ? -0.1458 ? 0.0027 ? 5 'X-RAY DIFFRACTION' ? refined 25.2457 1.4073 -12.6022 0.7745 ? 0.0207 ? -0.0024 ? 0.7459 ? 0.0793 ? 0.4636 ? 5.0827 ? 1.8765 ? 0.9917 ? 7.3270 ? 2.3525 ? 6.0074 ? -0.1510 ? 0.6875 ? -0.1412 ? -0.6280 ? 0.5450 ? 0.0018 ? 0.5960 ? 0.0216 ? -0.1120 ? 6 'X-RAY DIFFRACTION' ? refined 17.0638 15.4222 -10.5869 0.4581 ? 0.0542 ? 0.0210 ? 0.5945 ? 0.0255 ? 0.4303 ? 2.9358 ? -0.3724 ? 0.2783 ? 1.2873 ? -0.4005 ? 2.7876 ? 0.2616 ? 0.7726 ? 0.3787 ? 0.0084 ? -0.2051 ? 0.2515 ? -0.0270 ? -0.4855 ? 0.0488 ? 7 'X-RAY DIFFRACTION' ? refined 5.9629 10.7108 -1.5225 0.4528 ? -0.0791 ? 0.0256 ? 0.7521 ? 0.0251 ? 0.6139 ? 5.4936 ? 0.2832 ? 1.1094 ? 4.2646 ? 0.1547 ? 3.6742 ? -0.0995 ? -0.3820 ? -0.1978 ? 0.3366 ? 0.0258 ? 0.3548 ? 0.8421 ? -1.2078 ? 0.0228 ? 8 'X-RAY DIFFRACTION' ? refined 23.6302 19.7494 10.5463 0.4741 ? -0.0191 ? 0.0824 ? 0.5146 ? -0.0237 ? 0.5059 ? 3.0506 ? -0.6605 ? 0.8478 ? 2.0898 ? 0.6631 ? 2.7168 ? 0.0311 ? -0.3821 ? 0.4055 ? 0.1151 ? -0.0347 ? -0.0734 ? -0.1372 ? -0.0693 ? 0.0688 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? A 1 ? ? A 26 ? ;chain 'A' and (resid 1 through 26 ) ; 2 'X-RAY DIFFRACTION' 2 ? ? A 27 ? ? A 102 ? ;chain 'A' and (resid 27 through 102 ) ; 3 'X-RAY DIFFRACTION' 3 ? ? A 103 ? ? A 120 ? ;chain 'A' and (resid 103 through 120 ) ; 4 'X-RAY DIFFRACTION' 4 ? ? A 121 ? ? A 184 ? ;chain 'A' and (resid 121 through 184 ) ; 5 'X-RAY DIFFRACTION' 5 ? ? A 185 ? ? A 198 ? ;chain 'A' and (resid 185 through 198 ) ; 6 'X-RAY DIFFRACTION' 6 ? ? A 199 ? ? A 216 ? ;chain 'A' and (resid 199 through 216 ) ; 7 'X-RAY DIFFRACTION' 7 ? ? A 217 ? ? A 230 ? ;chain 'A' and (resid 217 through 230 ) ; 8 'X-RAY DIFFRACTION' 8 ? ? A 231 ? ? A 264 ? ;chain 'A' and (resid 231 through 264 ) ; # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.13_2998 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.24 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 5 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 35 ? ? -119.51 54.07 2 1 LYS A 114 ? ? 66.79 -128.63 3 1 ASN A 122 ? ? -100.39 -69.30 4 1 ALA A 162 ? ? -93.33 -126.36 5 1 ALA A 185 ? ? 38.26 64.05 6 1 HIS A 204 ? ? 74.60 -4.03 7 1 ASN A 213 ? ? -116.37 -79.46 8 1 ASP A 222 ? ? 55.61 -109.91 9 1 GLU A 263 ? ? 166.02 145.44 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 85 ? CG ? A LYS 85 CG 2 1 Y 1 A LYS 85 ? CD ? A LYS 85 CD 3 1 Y 1 A LYS 85 ? CE ? A LYS 85 CE 4 1 Y 1 A LYS 85 ? NZ ? A LYS 85 NZ 5 1 Y 1 A LYS 88 ? CG ? A LYS 88 CG 6 1 Y 1 A LYS 88 ? CD ? A LYS 88 CD 7 1 Y 1 A LYS 88 ? CE ? A LYS 88 CE 8 1 Y 1 A LYS 88 ? NZ ? A LYS 88 NZ 9 1 Y 1 A LYS 92 ? CG ? A LYS 92 CG 10 1 Y 1 A LYS 92 ? CD ? A LYS 92 CD 11 1 Y 1 A LYS 92 ? CE ? A LYS 92 CE 12 1 Y 1 A LYS 92 ? NZ ? A LYS 92 NZ 13 1 Y 1 A GLU 94 ? CG ? A GLU 94 CG 14 1 Y 1 A GLU 94 ? CD ? A GLU 94 CD 15 1 Y 1 A GLU 94 ? OE1 ? A GLU 94 OE1 16 1 Y 1 A GLU 94 ? OE2 ? A GLU 94 OE2 17 1 Y 1 A LYS 113 ? CG ? A LYS 113 CG 18 1 Y 1 A LYS 113 ? CD ? A LYS 113 CD 19 1 Y 1 A LYS 113 ? CE ? A LYS 113 CE 20 1 Y 1 A LYS 113 ? NZ ? A LYS 113 NZ 21 1 Y 1 A ARG 190 ? CG ? A ARG 190 CG 22 1 Y 1 A ARG 190 ? CD ? A ARG 190 CD 23 1 Y 1 A ARG 190 ? NE ? A ARG 190 NE 24 1 Y 1 A ARG 190 ? CZ ? A ARG 190 CZ 25 1 Y 1 A ARG 190 ? NH1 ? A ARG 190 NH1 26 1 Y 1 A ARG 190 ? NH2 ? A ARG 190 NH2 27 1 Y 1 A GLN 232 ? CG ? A GLN 232 CG 28 1 Y 1 A GLN 232 ? CD ? A GLN 232 CD 29 1 Y 1 A GLN 232 ? OE1 ? A GLN 232 OE1 30 1 Y 1 A GLN 232 ? NE2 ? A GLN 232 NE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ILE 111 ? A ILE 111 2 1 Y 1 A GLY 112 ? A GLY 112 3 1 Y 1 A LEU 265 ? A LEU 265 4 1 Y 1 A GLU 266 ? A GLU 266 5 1 Y 1 A HIS 267 ? A HIS 267 6 1 Y 1 A HIS 268 ? A HIS 268 7 1 Y 1 A HIS 269 ? A HIS 269 8 1 Y 1 A HIS 270 ? A HIS 270 9 1 Y 1 A HIS 271 ? A HIS 271 10 1 Y 1 A HIS 272 ? A HIS 272 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CITRIC ACID' CIT 3 '9-(3-azanylpropyl)-8-bromanyl-purin-6-amine' JXK 4 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support SAXS _pdbx_struct_assembly_auth_evidence.details ? #