data_6RG6 # _entry.id 6RG6 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6RG6 pdb_00006rg6 10.2210/pdb6rg6/pdb WWPDB D_1292101860 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-02-19 2 'Structure model' 1 1 2020-03-25 3 'Structure model' 1 2 2024-05-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' chem_comp_atom 3 3 'Structure model' chem_comp_bond 4 3 'Structure model' database_2 5 3 'Structure model' refine # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation.title' 5 3 'Structure model' '_database_2.pdbx_DOI' 6 3 'Structure model' '_database_2.pdbx_database_accession' 7 3 'Structure model' '_refine.pdbx_diffrn_id' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6RG6 _pdbx_database_status.recvd_initial_deposition_date 2019-04-16 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Gelin, M.' 1 ? 'Labesse, G.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Acs Infect Dis.' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2373-8227 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 6 _citation.language ? _citation.page_first 422 _citation.page_last 435 _citation.title 'From Substrate to Fragments to Inhibitor ActiveIn VivoagainstStaphylococcus aureus.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acsinfecdis.9b00368 _citation.pdbx_database_id_PubMed 32017533 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Gelin, M.' 1 ? primary 'Paoletti, J.' 2 ? primary 'Nahori, M.A.' 3 ? primary 'Huteau, V.' 4 ? primary 'Leseigneur, C.' 5 ? primary 'Jouvion, G.' 6 ? primary 'Dugue, L.' 7 ? primary 'Clement, D.' 8 ? primary 'Pons, J.L.' 9 ? primary 'Assairi, L.' 10 ? primary 'Pochet, S.' 11 ? primary 'Labesse, G.' 12 ? primary 'Dussurget, O.' 13 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'NAD kinase 1' 31045.279 1 2.7.1.23 ? ? ? 2 non-polymer syn 'CITRIC ACID' 192.124 1 ? ? ? ? 3 non-polymer syn '(2~{R},3~{R},4~{S},5~{R})-2-(6-aminopurin-9-yl)-5-[3-(6-azanyl-9~{H}-purin-8-yl)prop-2-ynoxymethyl]oxolane-3,4-diol' 438.400 1 ? ? ? ? 4 water nat water 18.015 48 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'ATP-dependent NAD kinase' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MKYMITSKGDEKSDLLRLNMIAGFGEYDMEYDDVEPEIVISIGGDGTFLSAFHQYEERLDEIAFIGIHTGHLGFYADWRP AEADKLVKLLAKGEYQKVSYPLLKTTVKYGIGKKEATYLALNESTVKSSGGPFVVDVVINDIHFERFRGDGLCMSTPSGT TAYNKSLGGALMHPSIEAMQLTEMASINNRVYRTIGSPLVFPKHHVVSLQPVNDKDFQISVDHLSILHRDVQEIRYEVSA KKIHFARFRSFPFWRRVHDSFIEDLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MKYMITSKGDEKSDLLRLNMIAGFGEYDMEYDDVEPEIVISIGGDGTFLSAFHQYEERLDEIAFIGIHTGHLGFYADWRP AEADKLVKLLAKGEYQKVSYPLLKTTVKYGIGKKEATYLALNESTVKSSGGPFVVDVVINDIHFERFRGDGLCMSTPSGT TAYNKSLGGALMHPSIEAMQLTEMASINNRVYRTIGSPLVFPKHHVVSLQPVNDKDFQISVDHLSILHRDVQEIRYEVSA KKIHFARFRSFPFWRRVHDSFIEDLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CITRIC ACID' CIT 3 '(2~{R},3~{R},4~{S},5~{R})-2-(6-aminopurin-9-yl)-5-[3-(6-azanyl-9~{H}-purin-8-yl)prop-2-ynoxymethyl]oxolane-3,4-diol' K3B 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LYS n 1 3 TYR n 1 4 MET n 1 5 ILE n 1 6 THR n 1 7 SER n 1 8 LYS n 1 9 GLY n 1 10 ASP n 1 11 GLU n 1 12 LYS n 1 13 SER n 1 14 ASP n 1 15 LEU n 1 16 LEU n 1 17 ARG n 1 18 LEU n 1 19 ASN n 1 20 MET n 1 21 ILE n 1 22 ALA n 1 23 GLY n 1 24 PHE n 1 25 GLY n 1 26 GLU n 1 27 TYR n 1 28 ASP n 1 29 MET n 1 30 GLU n 1 31 TYR n 1 32 ASP n 1 33 ASP n 1 34 VAL n 1 35 GLU n 1 36 PRO n 1 37 GLU n 1 38 ILE n 1 39 VAL n 1 40 ILE n 1 41 SER n 1 42 ILE n 1 43 GLY n 1 44 GLY n 1 45 ASP n 1 46 GLY n 1 47 THR n 1 48 PHE n 1 49 LEU n 1 50 SER n 1 51 ALA n 1 52 PHE n 1 53 HIS n 1 54 GLN n 1 55 TYR n 1 56 GLU n 1 57 GLU n 1 58 ARG n 1 59 LEU n 1 60 ASP n 1 61 GLU n 1 62 ILE n 1 63 ALA n 1 64 PHE n 1 65 ILE n 1 66 GLY n 1 67 ILE n 1 68 HIS n 1 69 THR n 1 70 GLY n 1 71 HIS n 1 72 LEU n 1 73 GLY n 1 74 PHE n 1 75 TYR n 1 76 ALA n 1 77 ASP n 1 78 TRP n 1 79 ARG n 1 80 PRO n 1 81 ALA n 1 82 GLU n 1 83 ALA n 1 84 ASP n 1 85 LYS n 1 86 LEU n 1 87 VAL n 1 88 LYS n 1 89 LEU n 1 90 LEU n 1 91 ALA n 1 92 LYS n 1 93 GLY n 1 94 GLU n 1 95 TYR n 1 96 GLN n 1 97 LYS n 1 98 VAL n 1 99 SER n 1 100 TYR n 1 101 PRO n 1 102 LEU n 1 103 LEU n 1 104 LYS n 1 105 THR n 1 106 THR n 1 107 VAL n 1 108 LYS n 1 109 TYR n 1 110 GLY n 1 111 ILE n 1 112 GLY n 1 113 LYS n 1 114 LYS n 1 115 GLU n 1 116 ALA n 1 117 THR n 1 118 TYR n 1 119 LEU n 1 120 ALA n 1 121 LEU n 1 122 ASN n 1 123 GLU n 1 124 SER n 1 125 THR n 1 126 VAL n 1 127 LYS n 1 128 SER n 1 129 SER n 1 130 GLY n 1 131 GLY n 1 132 PRO n 1 133 PHE n 1 134 VAL n 1 135 VAL n 1 136 ASP n 1 137 VAL n 1 138 VAL n 1 139 ILE n 1 140 ASN n 1 141 ASP n 1 142 ILE n 1 143 HIS n 1 144 PHE n 1 145 GLU n 1 146 ARG n 1 147 PHE n 1 148 ARG n 1 149 GLY n 1 150 ASP n 1 151 GLY n 1 152 LEU n 1 153 CYS n 1 154 MET n 1 155 SER n 1 156 THR n 1 157 PRO n 1 158 SER n 1 159 GLY n 1 160 THR n 1 161 THR n 1 162 ALA n 1 163 TYR n 1 164 ASN n 1 165 LYS n 1 166 SER n 1 167 LEU n 1 168 GLY n 1 169 GLY n 1 170 ALA n 1 171 LEU n 1 172 MET n 1 173 HIS n 1 174 PRO n 1 175 SER n 1 176 ILE n 1 177 GLU n 1 178 ALA n 1 179 MET n 1 180 GLN n 1 181 LEU n 1 182 THR n 1 183 GLU n 1 184 MET n 1 185 ALA n 1 186 SER n 1 187 ILE n 1 188 ASN n 1 189 ASN n 1 190 ARG n 1 191 VAL n 1 192 TYR n 1 193 ARG n 1 194 THR n 1 195 ILE n 1 196 GLY n 1 197 SER n 1 198 PRO n 1 199 LEU n 1 200 VAL n 1 201 PHE n 1 202 PRO n 1 203 LYS n 1 204 HIS n 1 205 HIS n 1 206 VAL n 1 207 VAL n 1 208 SER n 1 209 LEU n 1 210 GLN n 1 211 PRO n 1 212 VAL n 1 213 ASN n 1 214 ASP n 1 215 LYS n 1 216 ASP n 1 217 PHE n 1 218 GLN n 1 219 ILE n 1 220 SER n 1 221 VAL n 1 222 ASP n 1 223 HIS n 1 224 LEU n 1 225 SER n 1 226 ILE n 1 227 LEU n 1 228 HIS n 1 229 ARG n 1 230 ASP n 1 231 VAL n 1 232 GLN n 1 233 GLU n 1 234 ILE n 1 235 ARG n 1 236 TYR n 1 237 GLU n 1 238 VAL n 1 239 SER n 1 240 ALA n 1 241 LYS n 1 242 LYS n 1 243 ILE n 1 244 HIS n 1 245 PHE n 1 246 ALA n 1 247 ARG n 1 248 PHE n 1 249 ARG n 1 250 SER n 1 251 PHE n 1 252 PRO n 1 253 PHE n 1 254 TRP n 1 255 ARG n 1 256 ARG n 1 257 VAL n 1 258 HIS n 1 259 ASP n 1 260 SER n 1 261 PHE n 1 262 ILE n 1 263 GLU n 1 264 ASP n 1 265 LEU n 1 266 GLU n 1 267 HIS n 1 268 HIS n 1 269 HIS n 1 270 HIS n 1 271 HIS n 1 272 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 272 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'nadK1, lmo0968' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Listeria monocytogenes EGD-e' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 169963 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CIT non-polymer . 'CITRIC ACID' ? 'C6 H8 O7' 192.124 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 K3B non-polymer . '(2~{R},3~{R},4~{S},5~{R})-2-(6-aminopurin-9-yl)-5-[3-(6-azanyl-9~{H}-purin-8-yl)prop-2-ynoxymethyl]oxolane-3,4-diol' ? 'C18 H18 N10 O4' 438.400 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 LYS 2 2 2 LYS LYS A . n A 1 3 TYR 3 3 3 TYR TYR A . n A 1 4 MET 4 4 4 MET MET A . n A 1 5 ILE 5 5 5 ILE ILE A . n A 1 6 THR 6 6 6 THR THR A . n A 1 7 SER 7 7 7 SER SER A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 ARG 17 17 17 ARG ARG A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 ASN 19 19 19 ASN ASN A . n A 1 20 MET 20 20 20 MET MET A . n A 1 21 ILE 21 21 21 ILE ILE A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 PHE 24 24 24 PHE PHE A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 TYR 27 27 27 TYR TYR A . n A 1 28 ASP 28 28 28 ASP ASP A . n A 1 29 MET 29 29 29 MET MET A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 TYR 31 31 31 TYR TYR A . n A 1 32 ASP 32 32 32 ASP ASP A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 PRO 36 36 36 PRO PRO A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 ILE 38 38 38 ILE ILE A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 ILE 40 40 40 ILE ILE A . n A 1 41 SER 41 41 41 SER SER A . n A 1 42 ILE 42 42 42 ILE ILE A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 ASP 45 45 45 ASP ASP A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 THR 47 47 47 THR THR A . n A 1 48 PHE 48 48 48 PHE PHE A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 SER 50 50 50 SER SER A . n A 1 51 ALA 51 51 51 ALA ALA A . n A 1 52 PHE 52 52 52 PHE PHE A . n A 1 53 HIS 53 53 53 HIS HIS A . n A 1 54 GLN 54 54 54 GLN GLN A . n A 1 55 TYR 55 55 55 TYR TYR A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 ARG 58 58 58 ARG ARG A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 ILE 62 62 62 ILE ILE A . n A 1 63 ALA 63 63 63 ALA ALA A . n A 1 64 PHE 64 64 64 PHE PHE A . n A 1 65 ILE 65 65 65 ILE ILE A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 ILE 67 67 67 ILE ILE A . n A 1 68 HIS 68 68 68 HIS HIS A . n A 1 69 THR 69 69 69 THR THR A . n A 1 70 GLY 70 70 70 GLY GLY A . n A 1 71 HIS 71 71 71 HIS HIS A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 GLY 73 73 73 GLY GLY A . n A 1 74 PHE 74 74 74 PHE PHE A . n A 1 75 TYR 75 75 75 TYR TYR A . n A 1 76 ALA 76 76 76 ALA ALA A . n A 1 77 ASP 77 77 77 ASP ASP A . n A 1 78 TRP 78 78 78 TRP TRP A . n A 1 79 ARG 79 79 79 ARG ARG A . n A 1 80 PRO 80 80 80 PRO PRO A . n A 1 81 ALA 81 81 81 ALA ALA A . n A 1 82 GLU 82 82 82 GLU GLU A . n A 1 83 ALA 83 83 83 ALA ALA A . n A 1 84 ASP 84 84 84 ASP ASP A . n A 1 85 LYS 85 85 85 LYS LYS A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 VAL 87 87 87 VAL VAL A . n A 1 88 LYS 88 88 88 LYS LYS A . n A 1 89 LEU 89 89 89 LEU LEU A . n A 1 90 LEU 90 90 90 LEU LEU A . n A 1 91 ALA 91 91 91 ALA ALA A . n A 1 92 LYS 92 92 ? ? ? A . n A 1 93 GLY 93 93 ? ? ? A . n A 1 94 GLU 94 94 ? ? ? A . n A 1 95 TYR 95 95 95 TYR TYR A . n A 1 96 GLN 96 96 96 GLN GLN A . n A 1 97 LYS 97 97 97 LYS LYS A . n A 1 98 VAL 98 98 98 VAL VAL A . n A 1 99 SER 99 99 99 SER SER A . n A 1 100 TYR 100 100 100 TYR TYR A . n A 1 101 PRO 101 101 101 PRO PRO A . n A 1 102 LEU 102 102 102 LEU LEU A . n A 1 103 LEU 103 103 103 LEU LEU A . n A 1 104 LYS 104 104 104 LYS LYS A . n A 1 105 THR 105 105 105 THR THR A . n A 1 106 THR 106 106 106 THR THR A . n A 1 107 VAL 107 107 107 VAL VAL A . n A 1 108 LYS 108 108 108 LYS LYS A . n A 1 109 TYR 109 109 109 TYR TYR A . n A 1 110 GLY 110 110 110 GLY GLY A . n A 1 111 ILE 111 111 ? ? ? A . n A 1 112 GLY 112 112 ? ? ? A . n A 1 113 LYS 113 113 ? ? ? A . n A 1 114 LYS 114 114 114 LYS LYS A . n A 1 115 GLU 115 115 115 GLU GLU A . n A 1 116 ALA 116 116 116 ALA ALA A . n A 1 117 THR 117 117 117 THR THR A . n A 1 118 TYR 118 118 118 TYR TYR A . n A 1 119 LEU 119 119 119 LEU LEU A . n A 1 120 ALA 120 120 120 ALA ALA A . n A 1 121 LEU 121 121 121 LEU LEU A . n A 1 122 ASN 122 122 122 ASN ASN A . n A 1 123 GLU 123 123 123 GLU GLU A . n A 1 124 SER 124 124 124 SER SER A . n A 1 125 THR 125 125 125 THR THR A . n A 1 126 VAL 126 126 126 VAL VAL A . n A 1 127 LYS 127 127 127 LYS LYS A . n A 1 128 SER 128 128 128 SER SER A . n A 1 129 SER 129 129 129 SER SER A . n A 1 130 GLY 130 130 130 GLY GLY A . n A 1 131 GLY 131 131 131 GLY GLY A . n A 1 132 PRO 132 132 132 PRO PRO A . n A 1 133 PHE 133 133 133 PHE PHE A . n A 1 134 VAL 134 134 134 VAL VAL A . n A 1 135 VAL 135 135 135 VAL VAL A . n A 1 136 ASP 136 136 136 ASP ASP A . n A 1 137 VAL 137 137 137 VAL VAL A . n A 1 138 VAL 138 138 138 VAL VAL A . n A 1 139 ILE 139 139 139 ILE ILE A . n A 1 140 ASN 140 140 140 ASN ASN A . n A 1 141 ASP 141 141 141 ASP ASP A . n A 1 142 ILE 142 142 142 ILE ILE A . n A 1 143 HIS 143 143 143 HIS HIS A . n A 1 144 PHE 144 144 144 PHE PHE A . n A 1 145 GLU 145 145 145 GLU GLU A . n A 1 146 ARG 146 146 146 ARG ARG A . n A 1 147 PHE 147 147 147 PHE PHE A . n A 1 148 ARG 148 148 148 ARG ARG A . n A 1 149 GLY 149 149 149 GLY GLY A . n A 1 150 ASP 150 150 150 ASP ASP A . n A 1 151 GLY 151 151 151 GLY GLY A . n A 1 152 LEU 152 152 152 LEU LEU A . n A 1 153 CYS 153 153 153 CYS CYS A . n A 1 154 MET 154 154 154 MET MET A . n A 1 155 SER 155 155 155 SER SER A . n A 1 156 THR 156 156 156 THR THR A . n A 1 157 PRO 157 157 157 PRO PRO A . n A 1 158 SER 158 158 158 SER SER A . n A 1 159 GLY 159 159 159 GLY GLY A . n A 1 160 THR 160 160 160 THR THR A . n A 1 161 THR 161 161 161 THR THR A . n A 1 162 ALA 162 162 162 ALA ALA A . n A 1 163 TYR 163 163 163 TYR TYR A . n A 1 164 ASN 164 164 164 ASN ASN A . n A 1 165 LYS 165 165 165 LYS LYS A . n A 1 166 SER 166 166 166 SER SER A . n A 1 167 LEU 167 167 167 LEU LEU A . n A 1 168 GLY 168 168 168 GLY GLY A . n A 1 169 GLY 169 169 169 GLY GLY A . n A 1 170 ALA 170 170 170 ALA ALA A . n A 1 171 LEU 171 171 171 LEU LEU A . n A 1 172 MET 172 172 172 MET MET A . n A 1 173 HIS 173 173 173 HIS HIS A . n A 1 174 PRO 174 174 174 PRO PRO A . n A 1 175 SER 175 175 175 SER SER A . n A 1 176 ILE 176 176 176 ILE ILE A . n A 1 177 GLU 177 177 177 GLU GLU A . n A 1 178 ALA 178 178 178 ALA ALA A . n A 1 179 MET 179 179 179 MET MET A . n A 1 180 GLN 180 180 180 GLN GLN A . n A 1 181 LEU 181 181 181 LEU LEU A . n A 1 182 THR 182 182 182 THR THR A . n A 1 183 GLU 183 183 183 GLU GLU A . n A 1 184 MET 184 184 184 MET MET A . n A 1 185 ALA 185 185 185 ALA ALA A . n A 1 186 SER 186 186 186 SER SER A . n A 1 187 ILE 187 187 187 ILE ILE A . n A 1 188 ASN 188 188 188 ASN ASN A . n A 1 189 ASN 189 189 189 ASN ASN A . n A 1 190 ARG 190 190 190 ARG ARG A . n A 1 191 VAL 191 191 191 VAL VAL A . n A 1 192 TYR 192 192 192 TYR TYR A . n A 1 193 ARG 193 193 193 ARG ARG A . n A 1 194 THR 194 194 194 THR THR A . n A 1 195 ILE 195 195 195 ILE ILE A . n A 1 196 GLY 196 196 196 GLY GLY A . n A 1 197 SER 197 197 197 SER SER A . n A 1 198 PRO 198 198 198 PRO PRO A . n A 1 199 LEU 199 199 199 LEU LEU A . n A 1 200 VAL 200 200 200 VAL VAL A . n A 1 201 PHE 201 201 201 PHE PHE A . n A 1 202 PRO 202 202 202 PRO PRO A . n A 1 203 LYS 203 203 203 LYS LYS A . n A 1 204 HIS 204 204 204 HIS HIS A . n A 1 205 HIS 205 205 205 HIS HIS A . n A 1 206 VAL 206 206 206 VAL VAL A . n A 1 207 VAL 207 207 207 VAL VAL A . n A 1 208 SER 208 208 208 SER SER A . n A 1 209 LEU 209 209 209 LEU LEU A . n A 1 210 GLN 210 210 210 GLN GLN A . n A 1 211 PRO 211 211 211 PRO PRO A . n A 1 212 VAL 212 212 212 VAL VAL A . n A 1 213 ASN 213 213 213 ASN ASN A . n A 1 214 ASP 214 214 214 ASP ASP A . n A 1 215 LYS 215 215 215 LYS LYS A . n A 1 216 ASP 216 216 216 ASP ASP A . n A 1 217 PHE 217 217 217 PHE PHE A . n A 1 218 GLN 218 218 218 GLN GLN A . n A 1 219 ILE 219 219 219 ILE ILE A . n A 1 220 SER 220 220 220 SER SER A . n A 1 221 VAL 221 221 221 VAL VAL A . n A 1 222 ASP 222 222 222 ASP ASP A . n A 1 223 HIS 223 223 223 HIS HIS A . n A 1 224 LEU 224 224 224 LEU LEU A . n A 1 225 SER 225 225 225 SER SER A . n A 1 226 ILE 226 226 226 ILE ILE A . n A 1 227 LEU 227 227 227 LEU LEU A . n A 1 228 HIS 228 228 228 HIS HIS A . n A 1 229 ARG 229 229 229 ARG ARG A . n A 1 230 ASP 230 230 230 ASP ASP A . n A 1 231 VAL 231 231 231 VAL VAL A . n A 1 232 GLN 232 232 232 GLN GLN A . n A 1 233 GLU 233 233 233 GLU GLU A . n A 1 234 ILE 234 234 234 ILE ILE A . n A 1 235 ARG 235 235 235 ARG ARG A . n A 1 236 TYR 236 236 236 TYR TYR A . n A 1 237 GLU 237 237 237 GLU GLU A . n A 1 238 VAL 238 238 238 VAL VAL A . n A 1 239 SER 239 239 239 SER SER A . n A 1 240 ALA 240 240 240 ALA ALA A . n A 1 241 LYS 241 241 241 LYS LYS A . n A 1 242 LYS 242 242 242 LYS LYS A . n A 1 243 ILE 243 243 243 ILE ILE A . n A 1 244 HIS 244 244 244 HIS HIS A . n A 1 245 PHE 245 245 245 PHE PHE A . n A 1 246 ALA 246 246 246 ALA ALA A . n A 1 247 ARG 247 247 247 ARG ARG A . n A 1 248 PHE 248 248 248 PHE PHE A . n A 1 249 ARG 249 249 249 ARG ARG A . n A 1 250 SER 250 250 250 SER SER A . n A 1 251 PHE 251 251 251 PHE PHE A . n A 1 252 PRO 252 252 252 PRO PRO A . n A 1 253 PHE 253 253 253 PHE PHE A . n A 1 254 TRP 254 254 254 TRP TRP A . n A 1 255 ARG 255 255 255 ARG ARG A . n A 1 256 ARG 256 256 256 ARG ARG A . n A 1 257 VAL 257 257 257 VAL VAL A . n A 1 258 HIS 258 258 258 HIS HIS A . n A 1 259 ASP 259 259 259 ASP ASP A . n A 1 260 SER 260 260 260 SER SER A . n A 1 261 PHE 261 261 261 PHE PHE A . n A 1 262 ILE 262 262 262 ILE ILE A . n A 1 263 GLU 263 263 263 GLU GLU A . n A 1 264 ASP 264 264 264 ASP ASP A . n A 1 265 LEU 265 265 ? ? ? A . n A 1 266 GLU 266 266 ? ? ? A . n A 1 267 HIS 267 267 ? ? ? A . n A 1 268 HIS 268 268 ? ? ? A . n A 1 269 HIS 269 269 ? ? ? A . n A 1 270 HIS 270 270 ? ? ? A . n A 1 271 HIS 271 271 ? ? ? A . n A 1 272 HIS 272 272 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CIT 1 301 1 CIT CIT A . C 3 K3B 1 302 1 K3B PDB A . D 4 HOH 1 401 66 HOH HOH A . D 4 HOH 2 402 23 HOH HOH A . D 4 HOH 3 403 13 HOH HOH A . D 4 HOH 4 404 2 HOH HOH A . D 4 HOH 5 405 10 HOH HOH A . D 4 HOH 6 406 19 HOH HOH A . D 4 HOH 7 407 27 HOH HOH A . D 4 HOH 8 408 1 HOH HOH A . D 4 HOH 9 409 8 HOH HOH A . D 4 HOH 10 410 12 HOH HOH A . D 4 HOH 11 411 5 HOH HOH A . D 4 HOH 12 412 4 HOH HOH A . D 4 HOH 13 413 11 HOH HOH A . D 4 HOH 14 414 38 HOH HOH A . D 4 HOH 15 415 39 HOH HOH A . D 4 HOH 16 416 14 HOH HOH A . D 4 HOH 17 417 30 HOH HOH A . D 4 HOH 18 418 56 HOH HOH A . D 4 HOH 19 419 41 HOH HOH A . D 4 HOH 20 420 7 HOH HOH A . D 4 HOH 21 421 15 HOH HOH A . D 4 HOH 22 422 28 HOH HOH A . D 4 HOH 23 423 50 HOH HOH A . D 4 HOH 24 424 6 HOH HOH A . D 4 HOH 25 425 84 HOH HOH A . D 4 HOH 26 426 26 HOH HOH A . D 4 HOH 27 427 18 HOH HOH A . D 4 HOH 28 428 21 HOH HOH A . D 4 HOH 29 429 20 HOH HOH A . D 4 HOH 30 430 67 HOH HOH A . D 4 HOH 31 431 9 HOH HOH A . D 4 HOH 32 432 49 HOH HOH A . D 4 HOH 33 433 82 HOH HOH A . D 4 HOH 34 434 55 HOH HOH A . D 4 HOH 35 435 42 HOH HOH A . D 4 HOH 36 436 3 HOH HOH A . D 4 HOH 37 437 75 HOH HOH A . D 4 HOH 38 438 17 HOH HOH A . D 4 HOH 39 439 29 HOH HOH A . D 4 HOH 40 440 80 HOH HOH A . D 4 HOH 41 441 60 HOH HOH A . D 4 HOH 42 442 45 HOH HOH A . D 4 HOH 43 443 81 HOH HOH A . D 4 HOH 44 444 83 HOH HOH A . D 4 HOH 45 445 62 HOH HOH A . D 4 HOH 46 446 24 HOH HOH A . D 4 HOH 47 447 47 HOH HOH A . D 4 HOH 48 448 69 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ASP 28 ? CG ? A ASP 28 CG 2 1 Y 1 A ASP 28 ? OD1 ? A ASP 28 OD1 3 1 Y 1 A ASP 28 ? OD2 ? A ASP 28 OD2 4 1 Y 1 A ARG 79 ? CG ? A ARG 79 CG 5 1 Y 1 A ARG 79 ? CD ? A ARG 79 CD 6 1 Y 1 A ARG 79 ? NE ? A ARG 79 NE 7 1 Y 1 A ARG 79 ? CZ ? A ARG 79 CZ 8 1 Y 1 A ARG 79 ? NH1 ? A ARG 79 NH1 9 1 Y 1 A ARG 79 ? NH2 ? A ARG 79 NH2 10 1 Y 1 A LYS 114 ? CG ? A LYS 114 CG 11 1 Y 1 A LYS 114 ? CD ? A LYS 114 CD 12 1 Y 1 A LYS 114 ? CE ? A LYS 114 CE 13 1 Y 1 A LYS 114 ? NZ ? A LYS 114 NZ 14 1 Y 1 A GLN 232 ? CG ? A GLN 232 CG 15 1 Y 1 A GLN 232 ? CD ? A GLN 232 CD 16 1 Y 1 A GLN 232 ? OE1 ? A GLN 232 OE1 17 1 Y 1 A GLN 232 ? NE2 ? A GLN 232 NE2 18 1 Y 1 A GLU 263 ? CG ? A GLU 263 CG 19 1 Y 1 A GLU 263 ? CD ? A GLU 263 CD 20 1 Y 1 A GLU 263 ? OE1 ? A GLU 263 OE1 21 1 Y 1 A GLU 263 ? OE2 ? A GLU 263 OE2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.13_2998 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? MOSFLM ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.7.1 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.24 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6RG6 _cell.details ? _cell.formula_units_Z ? _cell.length_a 62.910 _cell.length_a_esd ? _cell.length_b 75.235 _cell.length_b_esd ? _cell.length_c 118.600 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6RG6 _symmetry.cell_setting ? _symmetry.Int_Tables_number 23 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'I 2 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6RG6 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.26 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 45.58 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity 2.140 _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method EVAPORATION _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 5.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '30 mM NaBr, 220 mM Kcitrate, glycerol 6%, 15-16% w/v PEG400' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 210' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2010-09-16 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.933400 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE ID14-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.933400 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ID14-1 _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate 40.200 _reflns.entry_id 6RG6 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.520 _reflns.d_resolution_low 37.620 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 9254 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 94.400 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 8.700 _reflns.pdbx_Rmerge_I_obs 0.212 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 8.000 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects 200 _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.225 _reflns.pdbx_Rpim_I_all 0.074 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 80314 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.985 _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 2.520 2.620 ? ? 8772 ? ? ? 1086 99.700 ? ? ? ? 1.148 ? ? ? ? ? ? ? ? 8.100 ? ? ? 2.100 1.225 0.415 ? 1 1 0.656 ? 9.090 37.620 ? ? 1788 ? ? ? 226 94.800 ? ? ? ? 0.088 ? ? ? ? ? ? ? ? 7.900 ? ? ? 20.500 0.094 0.032 ? 2 1 0.995 ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 116.090 _refine.B_iso_mean 53.3189 _refine.B_iso_min 14.880 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6RG6 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.5200 _refine.ls_d_res_low 37.6180 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 9244 _refine.ls_number_reflns_R_free 455 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 93.9400 _refine.ls_percent_reflns_R_free 4.9200 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2354 _refine.ls_R_factor_R_free 0.2902 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2327 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.340 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 33.2600 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.4200 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.5200 _refine_hist.d_res_low 37.6180 _refine_hist.number_atoms_solvent 48 _refine_hist.number_atoms_total 2140 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 258 _refine_hist.pdbx_B_iso_mean_ligand 42.47 _refine_hist.pdbx_B_iso_mean_solvent 37.70 _refine_hist.pdbx_number_atoms_protein 2047 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 45 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.5202 2.8848 3003 . 151 2852 94.0000 . . . 0.3577 0.0000 0.3110 . . . . . . 3 . . . 'X-RAY DIFFRACTION' 2.8848 3.6341 3109 . 153 2956 96.0000 . . . 0.2896 0.0000 0.2545 . . . . . . 3 . . . 'X-RAY DIFFRACTION' 3.6341 37.6217 3132 . 151 2981 93.0000 . . . 0.2675 0.0000 0.1990 . . . . . . 3 . . . # _struct.entry_id 6RG6 _struct.title 'Crystal structure of NAD kinase 1 from Listeria monocytogenes in complexe with an inhibitor' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6RG6 _struct_keywords.text 'tetrameric NAD kinase, transferase' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code NADK1_LISMO _struct_ref.pdbx_db_accession Q8Y8D7 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MKYMITSKGDEKSDLLRLNMIAGFGEYDMEYDDVEPEIVISIGGDGTFLSAFHQYEERLDEIAFIGIHTGHLGFYADWRP AEADKLVKLLAKGEYQKVSYPLLKTTVKYGIGKKEATYLALNESTVKSSGGPFVVDVVINDIHFERFRGDGLCMSTPSGT TAYNKSLGGALMHPSIEAMQLTEMASINNRVYRTIGSPLVFPKHHVVSLQPVNDKDFQISVDHLSILHRDVQEIRYEVSA KKIHFARFRSFPFWRRVHDSFIED ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6RG6 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 264 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8Y8D7 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 264 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 264 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6RG6 LEU A 265 ? UNP Q8Y8D7 ? ? 'expression tag' 265 1 1 6RG6 GLU A 266 ? UNP Q8Y8D7 ? ? 'expression tag' 266 2 1 6RG6 HIS A 267 ? UNP Q8Y8D7 ? ? 'expression tag' 267 3 1 6RG6 HIS A 268 ? UNP Q8Y8D7 ? ? 'expression tag' 268 4 1 6RG6 HIS A 269 ? UNP Q8Y8D7 ? ? 'expression tag' 269 5 1 6RG6 HIS A 270 ? UNP Q8Y8D7 ? ? 'expression tag' 270 6 1 6RG6 HIS A 271 ? UNP Q8Y8D7 ? ? 'expression tag' 271 7 1 6RG6 HIS A 272 ? UNP Q8Y8D7 ? ? 'expression tag' 272 8 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B,C,D 1 2 A,B,C,D 1 3 A,B,C,D 1 4 A,B,C,D # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support SAXS _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_655 -x+1,-y,z -1.0000000000 0.0000000000 0.0000000000 62.9100000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_655 -x+1,y,-z -1.0000000000 0.0000000000 0.0000000000 62.9100000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 4 'crystal symmetry operation' 4_555 x,-y,-z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 10 ? GLY A 25 ? ASP A 10 GLY A 25 1 ? 16 HELX_P HELX_P2 AA2 GLY A 44 ? TYR A 55 ? GLY A 44 TYR A 55 1 ? 12 HELX_P HELX_P3 AA3 ARG A 79 ? GLU A 82 ? ARG A 79 GLU A 82 5 ? 4 HELX_P HELX_P4 AA4 ALA A 83 ? LEU A 90 ? ALA A 83 LEU A 90 1 ? 8 HELX_P HELX_P5 AA5 PRO A 157 ? THR A 161 ? PRO A 157 THR A 161 5 ? 5 HELX_P HELX_P6 AA6 ALA A 162 ? LEU A 167 ? ALA A 162 LEU A 167 1 ? 6 HELX_P HELX_P7 AA7 PRO A 252 ? ILE A 262 ? PRO A 252 ILE A 262 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 2 ? AA3 ? 6 ? AA4 ? 6 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA2 1 2 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel AA3 4 5 ? anti-parallel AA3 5 6 ? anti-parallel AA4 1 2 ? anti-parallel AA4 2 3 ? anti-parallel AA4 3 4 ? anti-parallel AA4 4 5 ? anti-parallel AA4 5 6 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLU A 30 ? TYR A 31 ? GLU A 30 TYR A 31 AA1 2 LYS A 2 ? SER A 7 ? LYS A 2 SER A 7 AA1 3 ILE A 38 ? GLY A 43 ? ILE A 38 GLY A 43 AA1 4 ALA A 63 ? HIS A 68 ? ALA A 63 HIS A 68 AA2 1 GLN A 96 ? TYR A 100 ? GLN A 96 TYR A 100 AA2 2 ILE A 243 ? ARG A 247 ? ILE A 243 ARG A 247 AA3 1 GLU A 115 ? ALA A 120 ? GLU A 115 ALA A 120 AA3 2 LEU A 103 ? TYR A 109 ? LEU A 103 TYR A 109 AA3 3 VAL A 231 ? VAL A 238 ? VAL A 231 VAL A 238 AA3 4 VAL A 207 ? PRO A 211 ? VAL A 207 PRO A 211 AA3 5 PHE A 133 ? ILE A 139 ? PHE A 133 ILE A 139 AA3 6 ILE A 142 ? GLY A 149 ? ILE A 142 GLY A 149 AA4 1 LEU A 199 ? PHE A 201 ? LEU A 199 PHE A 201 AA4 2 MET A 179 ? MET A 184 ? MET A 179 MET A 184 AA4 3 GLY A 151 ? SER A 155 ? GLY A 151 SER A 155 AA4 4 GLU A 123 ? SER A 128 ? GLU A 123 SER A 128 AA4 5 PHE A 217 ? VAL A 221 ? PHE A 217 VAL A 221 AA4 6 LEU A 224 ? HIS A 228 ? LEU A 224 HIS A 228 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O GLU A 30 ? O GLU A 30 N TYR A 3 ? N TYR A 3 AA1 2 3 N THR A 6 ? N THR A 6 O ILE A 40 ? O ILE A 40 AA1 3 4 N SER A 41 ? N SER A 41 O ILE A 65 ? O ILE A 65 AA2 1 2 N GLN A 96 ? N GLN A 96 O ARG A 247 ? O ARG A 247 AA3 1 2 O ALA A 116 ? O ALA A 116 N VAL A 107 ? N VAL A 107 AA3 2 3 N THR A 106 ? N THR A 106 O ARG A 235 ? O ARG A 235 AA3 3 4 O TYR A 236 ? O TYR A 236 N VAL A 207 ? N VAL A 207 AA3 4 5 O SER A 208 ? O SER A 208 N VAL A 138 ? N VAL A 138 AA3 5 6 N VAL A 137 ? N VAL A 137 O GLU A 145 ? O GLU A 145 AA4 1 2 O PHE A 201 ? O PHE A 201 N MET A 179 ? N MET A 179 AA4 2 3 O GLN A 180 ? O GLN A 180 N SER A 155 ? N SER A 155 AA4 3 4 O MET A 154 ? O MET A 154 N SER A 124 ? N SER A 124 AA4 4 5 N THR A 125 ? N THR A 125 O SER A 220 ? O SER A 220 AA4 5 6 N PHE A 217 ? N PHE A 217 O HIS A 228 ? O HIS A 228 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A CIT 301 ? 8 'binding site for residue CIT A 301' AC2 Software A K3B 302 ? 16 'binding site for residue K3B A 302' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 8 TYR A 100 ? TYR A 100 . ? 1_555 ? 2 AC1 8 HIS A 173 ? HIS A 173 . ? 1_555 ? 3 AC1 8 ARG A 247 ? ARG A 247 . ? 1_555 ? 4 AC1 8 PHE A 251 ? PHE A 251 . ? 1_555 ? 5 AC1 8 PRO A 252 ? PRO A 252 . ? 1_555 ? 6 AC1 8 PHE A 253 ? PHE A 253 . ? 1_555 ? 7 AC1 8 ARG A 256 ? ARG A 256 . ? 1_555 ? 8 AC1 8 HOH D . ? HOH A 403 . ? 1_555 ? 9 AC2 16 ASP A 45 ? ASP A 45 . ? 1_555 ? 10 AC2 16 GLY A 46 ? GLY A 46 . ? 1_555 ? 11 AC2 16 LEU A 49 ? LEU A 49 . ? 1_555 ? 12 AC2 16 PHE A 74 ? PHE A 74 . ? 1_555 ? 13 AC2 16 ASN A 122 ? ASN A 122 . ? 1_555 ? 14 AC2 16 GLU A 123 ? GLU A 123 . ? 1_555 ? 15 AC2 16 ASP A 150 ? ASP A 150 . ? 4_555 ? 16 AC2 16 SER A 158 ? SER A 158 . ? 1_555 ? 17 AC2 16 THR A 161 ? THR A 161 . ? 1_555 ? 18 AC2 16 ALA A 162 ? ALA A 162 . ? 1_555 ? 19 AC2 16 TYR A 163 ? TYR A 163 . ? 1_555 ? 20 AC2 16 SER A 166 ? SER A 166 . ? 1_555 ? 21 AC2 16 ALA A 185 ? ALA A 185 . ? 4_555 ? 22 AC2 16 ILE A 187 ? ILE A 187 . ? 4_555 ? 23 AC2 16 HIS A 223 ? HIS A 223 . ? 1_555 ? 24 AC2 16 HOH D . ? HOH A 414 . ? 1_555 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 TYR A 109 ? ? -107.06 -166.38 2 1 ASN A 122 ? ? -97.95 -71.99 3 1 ASP A 141 ? ? 65.35 -3.45 4 1 ALA A 162 ? ? -99.48 -114.51 5 1 ASN A 189 ? ? -134.62 -152.22 6 1 PRO A 202 ? ? -78.58 -169.01 7 1 HIS A 204 ? ? 64.55 -2.56 8 1 ASN A 213 ? ? -117.29 -70.55 9 1 ASP A 222 ? ? 58.08 -126.74 10 1 ARG A 249 ? ? -161.53 -163.15 11 1 ILE A 262 ? ? -89.79 -75.76 # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined 8.9270 22.4182 28.7345 0.5769 ? 0.1011 ? 0.0211 ? 0.7695 ? -0.0742 ? 0.4014 ? 5.1520 ? 0.5927 ? -1.5216 ? 3.0436 ? 1.7129 ? 5.3709 ? -0.2133 ? -1.1950 ? -0.0200 ? 0.1586 ? -0.0376 ? 0.0757 ? -0.4445 ? -0.1504 ? 0.1853 ? 2 'X-RAY DIFFRACTION' ? refined 9.2750 25.8891 18.1746 0.5217 ? 0.1074 ? 0.0287 ? 0.6380 ? -0.1382 ? 0.3945 ? 5.0814 ? -0.0013 ? -0.2278 ? 2.2281 ? 0.6140 ? 5.5585 ? -0.0715 ? -0.4263 ? 0.5879 ? 0.3033 ? 0.0778 ? 0.3749 ? -0.8561 ? -0.2219 ? 0.1655 ? 3 'X-RAY DIFFRACTION' ? refined 18.4620 20.8307 19.2202 0.5593 ? 0.0999 ? -0.0031 ? 0.5747 ? -0.0649 ? 0.3883 ? 7.8766 ? -0.4418 ? -2.7539 ? 2.2530 ? 2.2640 ? 2.6876 ? -0.2211 ? -0.8794 ? -0.4524 ? 0.0471 ? 0.4215 ? 0.3366 ? -0.2138 ? 0.4738 ? 0.0297 ? 4 'X-RAY DIFFRACTION' ? refined 17.7921 25.5199 15.1667 0.3928 ? 0.1097 ? 0.0163 ? 0.6003 ? -0.1373 ? 0.5046 ? 3.2337 ? 1.3474 ? -1.4356 ? 1.8555 ? -1.4299 ? 6.3838 ? 0.2818 ? -0.8116 ? 0.7808 ? -0.0335 ? -0.2980 ? -0.0429 ? -1.3889 ? -0.1362 ? -0.1801 ? 5 'X-RAY DIFFRACTION' ? refined 10.5471 13.3199 -2.2949 0.3529 ? 0.1376 ? 0.0439 ? 0.4197 ? -0.0087 ? 0.4138 ? 4.4607 ? 1.7401 ? -0.0157 ? 3.6064 ? 1.1081 ? 5.3195 ? 0.0890 ? 0.2021 ? 0.1099 ? -0.4852 ? -0.1177 ? 0.0726 ? -0.6309 ? -1.2854 ? -0.0235 ? 6 'X-RAY DIFFRACTION' ? refined 22.5166 11.9462 -3.8821 0.2255 ? 0.0276 ? 0.0087 ? 0.3208 ? 0.0131 ? 0.3115 ? 2.2477 ? -1.2027 ? 0.8718 ? 3.9462 ? -0.9244 ? 2.8202 ? 0.0617 ? 0.1838 ? 0.1503 ? -0.1016 ? 0.0879 ? 0.1937 ? 0.1485 ? -0.0621 ? -0.1287 ? 7 'X-RAY DIFFRACTION' ? refined 19.1825 9.1714 -10.3162 0.4130 ? 0.1164 ? -0.1169 ? 0.4781 ? 0.0208 ? 0.3060 ? 2.2490 ? -0.6914 ? -0.7076 ? 2.3268 ? -0.9856 ? 3.1645 ? 0.0259 ? 0.1953 ? -0.2421 ? -0.2941 ? 0.0801 ? 0.1540 ? 0.5796 ? -0.2188 ? -0.1443 ? 8 'X-RAY DIFFRACTION' ? refined 8.9763 14.3528 -4.3593 0.4092 ? 0.2056 ? 0.0116 ? 0.6238 ? 0.0398 ? 0.5078 ? 2.1281 ? -0.1223 ? -0.4680 ? 4.0670 ? -0.2820 ? 5.1563 ? 0.2940 ? 1.0064 ? 0.1197 ? 0.0761 ? 0.2295 ? 0.7152 ? -0.6206 ? -2.0190 ? -0.0997 ? 9 'X-RAY DIFFRACTION' ? refined 26.9868 20.1968 16.1139 0.5781 ? 0.0069 ? 0.0083 ? 0.4466 ? -0.1366 ? 0.4463 ? 2.1886 ? -0.8684 ? -0.5238 ? 4.3464 ? -1.0385 ? 2.2566 ? -0.2736 ? -0.7171 ? 0.7229 ? 0.6039 ? 0.0060 ? -0.3857 ? -0.3842 ? 0.1264 ? 0.0115 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? A 1 ? ? A 26 ? ;chain 'A' and (resid 1 through 26 ) ; 2 'X-RAY DIFFRACTION' 2 ? ? A 27 ? ? A 58 ? ;chain 'A' and (resid 27 through 58 ) ; 3 'X-RAY DIFFRACTION' 3 ? ? A 59 ? ? A 79 ? ;chain 'A' and (resid 59 through 79 ) ; 4 'X-RAY DIFFRACTION' 4 ? ? A 80 ? ? A 109 ? ;chain 'A' and (resid 80 through 109 ) ; 5 'X-RAY DIFFRACTION' 5 ? ? A 110 ? ? A 132 ? ;chain 'A' and (resid 110 through 132 ) ; 6 'X-RAY DIFFRACTION' 6 ? ? A 133 ? ? A 184 ? ;chain 'A' and (resid 133 through 184 ) ; 7 'X-RAY DIFFRACTION' 7 ? ? A 185 ? ? A 221 ? ;chain 'A' and (resid 185 through 221 ) ; 8 'X-RAY DIFFRACTION' 8 ? ? A 222 ? ? A 238 ? ;chain 'A' and (resid 222 through 238 ) ; 9 'X-RAY DIFFRACTION' 9 ? ? A 239 ? ? A 264 ? ;chain 'A' and (resid 239 through 264 ) ; # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A LYS 92 ? A LYS 92 2 1 Y 1 A GLY 93 ? A GLY 93 3 1 Y 1 A GLU 94 ? A GLU 94 4 1 Y 1 A ILE 111 ? A ILE 111 5 1 Y 1 A GLY 112 ? A GLY 112 6 1 Y 1 A LYS 113 ? A LYS 113 7 1 Y 1 A LEU 265 ? A LEU 265 8 1 Y 1 A GLU 266 ? A GLU 266 9 1 Y 1 A HIS 267 ? A HIS 267 10 1 Y 1 A HIS 268 ? A HIS 268 11 1 Y 1 A HIS 269 ? A HIS 269 12 1 Y 1 A HIS 270 ? A HIS 270 13 1 Y 1 A HIS 271 ? A HIS 271 14 1 Y 1 A HIS 272 ? A HIS 272 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CIT C1 C N N 74 CIT O1 O N N 75 CIT O2 O N N 76 CIT C2 C N N 77 CIT C3 C N N 78 CIT O7 O N N 79 CIT C4 C N N 80 CIT C5 C N N 81 CIT O3 O N N 82 CIT O4 O N N 83 CIT C6 C N N 84 CIT O5 O N N 85 CIT O6 O N N 86 CIT HO2 H N N 87 CIT H21 H N N 88 CIT H22 H N N 89 CIT HO7 H N N 90 CIT H41 H N N 91 CIT H42 H N N 92 CIT HO4 H N N 93 CIT HO6 H N N 94 CYS N N N N 95 CYS CA C N R 96 CYS C C N N 97 CYS O O N N 98 CYS CB C N N 99 CYS SG S N N 100 CYS OXT O N N 101 CYS H H N N 102 CYS H2 H N N 103 CYS HA H N N 104 CYS HB2 H N N 105 CYS HB3 H N N 106 CYS HG H N N 107 CYS HXT H N N 108 GLN N N N N 109 GLN CA C N S 110 GLN C C N N 111 GLN O O N N 112 GLN CB C N N 113 GLN CG C N N 114 GLN CD C N N 115 GLN OE1 O N N 116 GLN NE2 N N N 117 GLN OXT O N N 118 GLN H H N N 119 GLN H2 H N N 120 GLN HA H N N 121 GLN HB2 H N N 122 GLN HB3 H N N 123 GLN HG2 H N N 124 GLN HG3 H N N 125 GLN HE21 H N N 126 GLN HE22 H N N 127 GLN HXT H N N 128 GLU N N N N 129 GLU CA C N S 130 GLU C C N N 131 GLU O O N N 132 GLU CB C N N 133 GLU CG C N N 134 GLU CD C N N 135 GLU OE1 O N N 136 GLU OE2 O N N 137 GLU OXT O N N 138 GLU H H N N 139 GLU H2 H N N 140 GLU HA H N N 141 GLU HB2 H N N 142 GLU HB3 H N N 143 GLU HG2 H N N 144 GLU HG3 H N N 145 GLU HE2 H N N 146 GLU HXT H N N 147 GLY N N N N 148 GLY CA C N N 149 GLY C C N N 150 GLY O O N N 151 GLY OXT O N N 152 GLY H H N N 153 GLY H2 H N N 154 GLY HA2 H N N 155 GLY HA3 H N N 156 GLY HXT H N N 157 HIS N N N N 158 HIS CA C N S 159 HIS C C N N 160 HIS O O N N 161 HIS CB C N N 162 HIS CG C Y N 163 HIS ND1 N Y N 164 HIS CD2 C Y N 165 HIS CE1 C Y N 166 HIS NE2 N Y N 167 HIS OXT O N N 168 HIS H H N N 169 HIS H2 H N N 170 HIS HA H N N 171 HIS HB2 H N N 172 HIS HB3 H N N 173 HIS HD1 H N N 174 HIS HD2 H N N 175 HIS HE1 H N N 176 HIS HE2 H N N 177 HIS HXT H N N 178 HOH O O N N 179 HOH H1 H N N 180 HOH H2 H N N 181 ILE N N N N 182 ILE CA C N S 183 ILE C C N N 184 ILE O O N N 185 ILE CB C N S 186 ILE CG1 C N N 187 ILE CG2 C N N 188 ILE CD1 C N N 189 ILE OXT O N N 190 ILE H H N N 191 ILE H2 H N N 192 ILE HA H N N 193 ILE HB H N N 194 ILE HG12 H N N 195 ILE HG13 H N N 196 ILE HG21 H N N 197 ILE HG22 H N N 198 ILE HG23 H N N 199 ILE HD11 H N N 200 ILE HD12 H N N 201 ILE HD13 H N N 202 ILE HXT H N N 203 K3B C2 C Y N 204 K3B C4 C Y N 205 K3B C5 C Y N 206 K3B C6 C Y N 207 K3B N9 N Y N 208 K3B "C1'" C N R 209 K3B "C2'" C N R 210 K3B "C3'" C N S 211 K3B "C4'" C N R 212 K3B "C5'" C N N 213 K3B C8 C Y N 214 K3B CAP C N N 215 K3B CAQ C N N 216 K3B CAR C N N 217 K3B CAS C Y N 218 K3B CAU C Y N 219 K3B CAW C Y N 220 K3B CAY C Y N 221 K3B CAZ C Y N 222 K3B N1 N Y N 223 K3B N3 N Y N 224 K3B N6 N N N 225 K3B N7 N Y N 226 K3B NAT N Y N 227 K3B NAV N Y N 228 K3B NAX N Y N 229 K3B NBA N Y N 230 K3B NBB N N N 231 K3B "O2'" O N N 232 K3B "O3'" O N N 233 K3B "O4'" O N N 234 K3B "O5'" O N N 235 K3B H1 H N N 236 K3B H2 H N N 237 K3B H3 H N N 238 K3B H4 H N N 239 K3B H5 H N N 240 K3B H6 H N N 241 K3B H7 H N N 242 K3B H8 H N N 243 K3B H9 H N N 244 K3B H10 H N N 245 K3B H11 H N N 246 K3B H12 H N N 247 K3B H13 H N N 248 K3B H14 H N N 249 K3B H16 H N N 250 K3B H17 H N N 251 K3B H18 H N N 252 K3B H19 H N N 253 LEU N N N N 254 LEU CA C N S 255 LEU C C N N 256 LEU O O N N 257 LEU CB C N N 258 LEU CG C N N 259 LEU CD1 C N N 260 LEU CD2 C N N 261 LEU OXT O N N 262 LEU H H N N 263 LEU H2 H N N 264 LEU HA H N N 265 LEU HB2 H N N 266 LEU HB3 H N N 267 LEU HG H N N 268 LEU HD11 H N N 269 LEU HD12 H N N 270 LEU HD13 H N N 271 LEU HD21 H N N 272 LEU HD22 H N N 273 LEU HD23 H N N 274 LEU HXT H N N 275 LYS N N N N 276 LYS CA C N S 277 LYS C C N N 278 LYS O O N N 279 LYS CB C N N 280 LYS CG C N N 281 LYS CD C N N 282 LYS CE C N N 283 LYS NZ N N N 284 LYS OXT O N N 285 LYS H H N N 286 LYS H2 H N N 287 LYS HA H N N 288 LYS HB2 H N N 289 LYS HB3 H N N 290 LYS HG2 H N N 291 LYS HG3 H N N 292 LYS HD2 H N N 293 LYS HD3 H N N 294 LYS HE2 H N N 295 LYS HE3 H N N 296 LYS HZ1 H N N 297 LYS HZ2 H N N 298 LYS HZ3 H N N 299 LYS HXT H N N 300 MET N N N N 301 MET CA C N S 302 MET C C N N 303 MET O O N N 304 MET CB C N N 305 MET CG C N N 306 MET SD S N N 307 MET CE C N N 308 MET OXT O N N 309 MET H H N N 310 MET H2 H N N 311 MET HA H N N 312 MET HB2 H N N 313 MET HB3 H N N 314 MET HG2 H N N 315 MET HG3 H N N 316 MET HE1 H N N 317 MET HE2 H N N 318 MET HE3 H N N 319 MET HXT H N N 320 PHE N N N N 321 PHE CA C N S 322 PHE C C N N 323 PHE O O N N 324 PHE CB C N N 325 PHE CG C Y N 326 PHE CD1 C Y N 327 PHE CD2 C Y N 328 PHE CE1 C Y N 329 PHE CE2 C Y N 330 PHE CZ C Y N 331 PHE OXT O N N 332 PHE H H N N 333 PHE H2 H N N 334 PHE HA H N N 335 PHE HB2 H N N 336 PHE HB3 H N N 337 PHE HD1 H N N 338 PHE HD2 H N N 339 PHE HE1 H N N 340 PHE HE2 H N N 341 PHE HZ H N N 342 PHE HXT H N N 343 PRO N N N N 344 PRO CA C N S 345 PRO C C N N 346 PRO O O N N 347 PRO CB C N N 348 PRO CG C N N 349 PRO CD C N N 350 PRO OXT O N N 351 PRO H H N N 352 PRO HA H N N 353 PRO HB2 H N N 354 PRO HB3 H N N 355 PRO HG2 H N N 356 PRO HG3 H N N 357 PRO HD2 H N N 358 PRO HD3 H N N 359 PRO HXT H N N 360 SER N N N N 361 SER CA C N S 362 SER C C N N 363 SER O O N N 364 SER CB C N N 365 SER OG O N N 366 SER OXT O N N 367 SER H H N N 368 SER H2 H N N 369 SER HA H N N 370 SER HB2 H N N 371 SER HB3 H N N 372 SER HG H N N 373 SER HXT H N N 374 THR N N N N 375 THR CA C N S 376 THR C C N N 377 THR O O N N 378 THR CB C N R 379 THR OG1 O N N 380 THR CG2 C N N 381 THR OXT O N N 382 THR H H N N 383 THR H2 H N N 384 THR HA H N N 385 THR HB H N N 386 THR HG1 H N N 387 THR HG21 H N N 388 THR HG22 H N N 389 THR HG23 H N N 390 THR HXT H N N 391 TRP N N N N 392 TRP CA C N S 393 TRP C C N N 394 TRP O O N N 395 TRP CB C N N 396 TRP CG C Y N 397 TRP CD1 C Y N 398 TRP CD2 C Y N 399 TRP NE1 N Y N 400 TRP CE2 C Y N 401 TRP CE3 C Y N 402 TRP CZ2 C Y N 403 TRP CZ3 C Y N 404 TRP CH2 C Y N 405 TRP OXT O N N 406 TRP H H N N 407 TRP H2 H N N 408 TRP HA H N N 409 TRP HB2 H N N 410 TRP HB3 H N N 411 TRP HD1 H N N 412 TRP HE1 H N N 413 TRP HE3 H N N 414 TRP HZ2 H N N 415 TRP HZ3 H N N 416 TRP HH2 H N N 417 TRP HXT H N N 418 TYR N N N N 419 TYR CA C N S 420 TYR C C N N 421 TYR O O N N 422 TYR CB C N N 423 TYR CG C Y N 424 TYR CD1 C Y N 425 TYR CD2 C Y N 426 TYR CE1 C Y N 427 TYR CE2 C Y N 428 TYR CZ C Y N 429 TYR OH O N N 430 TYR OXT O N N 431 TYR H H N N 432 TYR H2 H N N 433 TYR HA H N N 434 TYR HB2 H N N 435 TYR HB3 H N N 436 TYR HD1 H N N 437 TYR HD2 H N N 438 TYR HE1 H N N 439 TYR HE2 H N N 440 TYR HH H N N 441 TYR HXT H N N 442 VAL N N N N 443 VAL CA C N S 444 VAL C C N N 445 VAL O O N N 446 VAL CB C N N 447 VAL CG1 C N N 448 VAL CG2 C N N 449 VAL OXT O N N 450 VAL H H N N 451 VAL H2 H N N 452 VAL HA H N N 453 VAL HB H N N 454 VAL HG11 H N N 455 VAL HG12 H N N 456 VAL HG13 H N N 457 VAL HG21 H N N 458 VAL HG22 H N N 459 VAL HG23 H N N 460 VAL HXT H N N 461 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CIT C1 O1 doub N N 70 CIT C1 O2 sing N N 71 CIT C1 C2 sing N N 72 CIT O2 HO2 sing N N 73 CIT C2 C3 sing N N 74 CIT C2 H21 sing N N 75 CIT C2 H22 sing N N 76 CIT C3 O7 sing N N 77 CIT C3 C4 sing N N 78 CIT C3 C6 sing N N 79 CIT O7 HO7 sing N N 80 CIT C4 C5 sing N N 81 CIT C4 H41 sing N N 82 CIT C4 H42 sing N N 83 CIT C5 O3 doub N N 84 CIT C5 O4 sing N N 85 CIT O4 HO4 sing N N 86 CIT C6 O5 doub N N 87 CIT C6 O6 sing N N 88 CIT O6 HO6 sing N N 89 CYS N CA sing N N 90 CYS N H sing N N 91 CYS N H2 sing N N 92 CYS CA C sing N N 93 CYS CA CB sing N N 94 CYS CA HA sing N N 95 CYS C O doub N N 96 CYS C OXT sing N N 97 CYS CB SG sing N N 98 CYS CB HB2 sing N N 99 CYS CB HB3 sing N N 100 CYS SG HG sing N N 101 CYS OXT HXT sing N N 102 GLN N CA sing N N 103 GLN N H sing N N 104 GLN N H2 sing N N 105 GLN CA C sing N N 106 GLN CA CB sing N N 107 GLN CA HA sing N N 108 GLN C O doub N N 109 GLN C OXT sing N N 110 GLN CB CG sing N N 111 GLN CB HB2 sing N N 112 GLN CB HB3 sing N N 113 GLN CG CD sing N N 114 GLN CG HG2 sing N N 115 GLN CG HG3 sing N N 116 GLN CD OE1 doub N N 117 GLN CD NE2 sing N N 118 GLN NE2 HE21 sing N N 119 GLN NE2 HE22 sing N N 120 GLN OXT HXT sing N N 121 GLU N CA sing N N 122 GLU N H sing N N 123 GLU N H2 sing N N 124 GLU CA C sing N N 125 GLU CA CB sing N N 126 GLU CA HA sing N N 127 GLU C O doub N N 128 GLU C OXT sing N N 129 GLU CB CG sing N N 130 GLU CB HB2 sing N N 131 GLU CB HB3 sing N N 132 GLU CG CD sing N N 133 GLU CG HG2 sing N N 134 GLU CG HG3 sing N N 135 GLU CD OE1 doub N N 136 GLU CD OE2 sing N N 137 GLU OE2 HE2 sing N N 138 GLU OXT HXT sing N N 139 GLY N CA sing N N 140 GLY N H sing N N 141 GLY N H2 sing N N 142 GLY CA C sing N N 143 GLY CA HA2 sing N N 144 GLY CA HA3 sing N N 145 GLY C O doub N N 146 GLY C OXT sing N N 147 GLY OXT HXT sing N N 148 HIS N CA sing N N 149 HIS N H sing N N 150 HIS N H2 sing N N 151 HIS CA C sing N N 152 HIS CA CB sing N N 153 HIS CA HA sing N N 154 HIS C O doub N N 155 HIS C OXT sing N N 156 HIS CB CG sing N N 157 HIS CB HB2 sing N N 158 HIS CB HB3 sing N N 159 HIS CG ND1 sing Y N 160 HIS CG CD2 doub Y N 161 HIS ND1 CE1 doub Y N 162 HIS ND1 HD1 sing N N 163 HIS CD2 NE2 sing Y N 164 HIS CD2 HD2 sing N N 165 HIS CE1 NE2 sing Y N 166 HIS CE1 HE1 sing N N 167 HIS NE2 HE2 sing N N 168 HIS OXT HXT sing N N 169 HOH O H1 sing N N 170 HOH O H2 sing N N 171 ILE N CA sing N N 172 ILE N H sing N N 173 ILE N H2 sing N N 174 ILE CA C sing N N 175 ILE CA CB sing N N 176 ILE CA HA sing N N 177 ILE C O doub N N 178 ILE C OXT sing N N 179 ILE CB CG1 sing N N 180 ILE CB CG2 sing N N 181 ILE CB HB sing N N 182 ILE CG1 CD1 sing N N 183 ILE CG1 HG12 sing N N 184 ILE CG1 HG13 sing N N 185 ILE CG2 HG21 sing N N 186 ILE CG2 HG22 sing N N 187 ILE CG2 HG23 sing N N 188 ILE CD1 HD11 sing N N 189 ILE CD1 HD12 sing N N 190 ILE CD1 HD13 sing N N 191 ILE OXT HXT sing N N 192 K3B N6 C6 sing N N 193 K3B N7 C8 doub Y N 194 K3B N7 C5 sing Y N 195 K3B C6 C5 doub Y N 196 K3B C6 N1 sing Y N 197 K3B "O2'" "C2'" sing N N 198 K3B C8 N9 sing Y N 199 K3B C5 C4 sing Y N 200 K3B "C2'" "C3'" sing N N 201 K3B "C2'" "C1'" sing N N 202 K3B N1 C2 doub Y N 203 K3B N9 C4 sing Y N 204 K3B N9 "C1'" sing N N 205 K3B C4 N3 doub Y N 206 K3B "C3'" "O3'" sing N N 207 K3B "C3'" "C4'" sing N N 208 K3B C2 N3 sing Y N 209 K3B "C1'" "O4'" sing N N 210 K3B "O4'" "C4'" sing N N 211 K3B "C4'" "C5'" sing N N 212 K3B "C5'" "O5'" sing N N 213 K3B NBB CAY sing N N 214 K3B "O5'" CAP sing N N 215 K3B CAY NAX doub Y N 216 K3B CAY CAZ sing Y N 217 K3B NBA CAZ sing Y N 218 K3B NBA CAS doub Y N 219 K3B NAX CAW sing Y N 220 K3B CAZ CAU doub Y N 221 K3B CAS CAR sing N N 222 K3B CAS NAT sing Y N 223 K3B CAP CAQ sing N N 224 K3B CAR CAQ trip N N 225 K3B CAW NAV doub Y N 226 K3B CAU NAT sing Y N 227 K3B CAU NAV sing Y N 228 K3B C2 H1 sing N N 229 K3B "C1'" H2 sing N N 230 K3B "C2'" H3 sing N N 231 K3B "C3'" H4 sing N N 232 K3B "C4'" H5 sing N N 233 K3B "C5'" H6 sing N N 234 K3B "C5'" H7 sing N N 235 K3B C8 H8 sing N N 236 K3B CAP H9 sing N N 237 K3B CAP H10 sing N N 238 K3B CAW H11 sing N N 239 K3B N6 H12 sing N N 240 K3B N6 H13 sing N N 241 K3B NAT H14 sing N N 242 K3B NBB H16 sing N N 243 K3B NBB H17 sing N N 244 K3B "O2'" H18 sing N N 245 K3B "O3'" H19 sing N N 246 LEU N CA sing N N 247 LEU N H sing N N 248 LEU N H2 sing N N 249 LEU CA C sing N N 250 LEU CA CB sing N N 251 LEU CA HA sing N N 252 LEU C O doub N N 253 LEU C OXT sing N N 254 LEU CB CG sing N N 255 LEU CB HB2 sing N N 256 LEU CB HB3 sing N N 257 LEU CG CD1 sing N N 258 LEU CG CD2 sing N N 259 LEU CG HG sing N N 260 LEU CD1 HD11 sing N N 261 LEU CD1 HD12 sing N N 262 LEU CD1 HD13 sing N N 263 LEU CD2 HD21 sing N N 264 LEU CD2 HD22 sing N N 265 LEU CD2 HD23 sing N N 266 LEU OXT HXT sing N N 267 LYS N CA sing N N 268 LYS N H sing N N 269 LYS N H2 sing N N 270 LYS CA C sing N N 271 LYS CA CB sing N N 272 LYS CA HA sing N N 273 LYS C O doub N N 274 LYS C OXT sing N N 275 LYS CB CG sing N N 276 LYS CB HB2 sing N N 277 LYS CB HB3 sing N N 278 LYS CG CD sing N N 279 LYS CG HG2 sing N N 280 LYS CG HG3 sing N N 281 LYS CD CE sing N N 282 LYS CD HD2 sing N N 283 LYS CD HD3 sing N N 284 LYS CE NZ sing N N 285 LYS CE HE2 sing N N 286 LYS CE HE3 sing N N 287 LYS NZ HZ1 sing N N 288 LYS NZ HZ2 sing N N 289 LYS NZ HZ3 sing N N 290 LYS OXT HXT sing N N 291 MET N CA sing N N 292 MET N H sing N N 293 MET N H2 sing N N 294 MET CA C sing N N 295 MET CA CB sing N N 296 MET CA HA sing N N 297 MET C O doub N N 298 MET C OXT sing N N 299 MET CB CG sing N N 300 MET CB HB2 sing N N 301 MET CB HB3 sing N N 302 MET CG SD sing N N 303 MET CG HG2 sing N N 304 MET CG HG3 sing N N 305 MET SD CE sing N N 306 MET CE HE1 sing N N 307 MET CE HE2 sing N N 308 MET CE HE3 sing N N 309 MET OXT HXT sing N N 310 PHE N CA sing N N 311 PHE N H sing N N 312 PHE N H2 sing N N 313 PHE CA C sing N N 314 PHE CA CB sing N N 315 PHE CA HA sing N N 316 PHE C O doub N N 317 PHE C OXT sing N N 318 PHE CB CG sing N N 319 PHE CB HB2 sing N N 320 PHE CB HB3 sing N N 321 PHE CG CD1 doub Y N 322 PHE CG CD2 sing Y N 323 PHE CD1 CE1 sing Y N 324 PHE CD1 HD1 sing N N 325 PHE CD2 CE2 doub Y N 326 PHE CD2 HD2 sing N N 327 PHE CE1 CZ doub Y N 328 PHE CE1 HE1 sing N N 329 PHE CE2 CZ sing Y N 330 PHE CE2 HE2 sing N N 331 PHE CZ HZ sing N N 332 PHE OXT HXT sing N N 333 PRO N CA sing N N 334 PRO N CD sing N N 335 PRO N H sing N N 336 PRO CA C sing N N 337 PRO CA CB sing N N 338 PRO CA HA sing N N 339 PRO C O doub N N 340 PRO C OXT sing N N 341 PRO CB CG sing N N 342 PRO CB HB2 sing N N 343 PRO CB HB3 sing N N 344 PRO CG CD sing N N 345 PRO CG HG2 sing N N 346 PRO CG HG3 sing N N 347 PRO CD HD2 sing N N 348 PRO CD HD3 sing N N 349 PRO OXT HXT sing N N 350 SER N CA sing N N 351 SER N H sing N N 352 SER N H2 sing N N 353 SER CA C sing N N 354 SER CA CB sing N N 355 SER CA HA sing N N 356 SER C O doub N N 357 SER C OXT sing N N 358 SER CB OG sing N N 359 SER CB HB2 sing N N 360 SER CB HB3 sing N N 361 SER OG HG sing N N 362 SER OXT HXT sing N N 363 THR N CA sing N N 364 THR N H sing N N 365 THR N H2 sing N N 366 THR CA C sing N N 367 THR CA CB sing N N 368 THR CA HA sing N N 369 THR C O doub N N 370 THR C OXT sing N N 371 THR CB OG1 sing N N 372 THR CB CG2 sing N N 373 THR CB HB sing N N 374 THR OG1 HG1 sing N N 375 THR CG2 HG21 sing N N 376 THR CG2 HG22 sing N N 377 THR CG2 HG23 sing N N 378 THR OXT HXT sing N N 379 TRP N CA sing N N 380 TRP N H sing N N 381 TRP N H2 sing N N 382 TRP CA C sing N N 383 TRP CA CB sing N N 384 TRP CA HA sing N N 385 TRP C O doub N N 386 TRP C OXT sing N N 387 TRP CB CG sing N N 388 TRP CB HB2 sing N N 389 TRP CB HB3 sing N N 390 TRP CG CD1 doub Y N 391 TRP CG CD2 sing Y N 392 TRP CD1 NE1 sing Y N 393 TRP CD1 HD1 sing N N 394 TRP CD2 CE2 doub Y N 395 TRP CD2 CE3 sing Y N 396 TRP NE1 CE2 sing Y N 397 TRP NE1 HE1 sing N N 398 TRP CE2 CZ2 sing Y N 399 TRP CE3 CZ3 doub Y N 400 TRP CE3 HE3 sing N N 401 TRP CZ2 CH2 doub Y N 402 TRP CZ2 HZ2 sing N N 403 TRP CZ3 CH2 sing Y N 404 TRP CZ3 HZ3 sing N N 405 TRP CH2 HH2 sing N N 406 TRP OXT HXT sing N N 407 TYR N CA sing N N 408 TYR N H sing N N 409 TYR N H2 sing N N 410 TYR CA C sing N N 411 TYR CA CB sing N N 412 TYR CA HA sing N N 413 TYR C O doub N N 414 TYR C OXT sing N N 415 TYR CB CG sing N N 416 TYR CB HB2 sing N N 417 TYR CB HB3 sing N N 418 TYR CG CD1 doub Y N 419 TYR CG CD2 sing Y N 420 TYR CD1 CE1 sing Y N 421 TYR CD1 HD1 sing N N 422 TYR CD2 CE2 doub Y N 423 TYR CD2 HD2 sing N N 424 TYR CE1 CZ doub Y N 425 TYR CE1 HE1 sing N N 426 TYR CE2 CZ sing Y N 427 TYR CE2 HE2 sing N N 428 TYR CZ OH sing N N 429 TYR OH HH sing N N 430 TYR OXT HXT sing N N 431 VAL N CA sing N N 432 VAL N H sing N N 433 VAL N H2 sing N N 434 VAL CA C sing N N 435 VAL CA CB sing N N 436 VAL CA HA sing N N 437 VAL C O doub N N 438 VAL C OXT sing N N 439 VAL CB CG1 sing N N 440 VAL CB CG2 sing N N 441 VAL CB HB sing N N 442 VAL CG1 HG11 sing N N 443 VAL CG1 HG12 sing N N 444 VAL CG1 HG13 sing N N 445 VAL CG2 HG21 sing N N 446 VAL CG2 HG22 sing N N 447 VAL CG2 HG23 sing N N 448 VAL OXT HXT sing N N 449 # _atom_sites.entry_id 6RG6 _atom_sites.fract_transf_matrix[1][1] 0.015896 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013292 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008432 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O S # loop_