data_6RJW # _entry.id 6RJW # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.314 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 6RJW WWPDB D_1292102057 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6RJW _pdbx_database_status.recvd_initial_deposition_date 2019-04-29 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Brangulis, K.' 1 ? 'Akopjana, I.' 2 ? 'Kazaks, A.' 3 ? 'Tars, K.' 4 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Acta Crystallogr D Struct Biol' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2059-7983 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 75 _citation.language ? _citation.page_first 825 _citation.page_last 830 _citation.title 'Crystal structure of the N-terminal domain of the major virulence factor BB0323 from the Lyme disease agent Borrelia burgdorferi.' _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1107/S2059798319010751 _citation.pdbx_database_id_PubMed 31478905 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Brangulis, K.' 1 ? primary 'Akopjana, I.' 2 ? primary 'Kazaks, A.' 3 ? primary 'Tars, K.' 4 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6RJW _cell.details ? _cell.formula_units_Z ? _cell.length_a 41.392 _cell.length_a_esd ? _cell.length_b 48.829 _cell.length_b_esd ? _cell.length_c 87.808 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6RJW _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'LysM domain protein' _entity.formula_weight 22436.779 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details 'The first 4 residues (GAMG) are remnants from the expression tag.' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;GA(MSE)GESRESKNAKIAQPDNKNFQLRDIKDIKNELIRERGHLFYSKEFNEAERLEEA(MSE)KQSFSKKKAIEGNEI ALKVLERYKTIIRETREKKEKTNYLKENIEKYLNDAEANEAYIWIPLEIDEVNNLYFEATRKYKNYDLDNALD(MSE)YS KAFNRAQQAAKNAKEAKALKETDER(MSE)YKQLKALEAASNLPI ; _entity_poly.pdbx_seq_one_letter_code_can ;GAMGESRESKNAKIAQPDNKNFQLRDIKDIKNELIRERGHLFYSKEFNEAERLEEAMKQSFSKKKAIEGNEIALKVLERY KTIIRETREKKEKTNYLKENIEKYLNDAEANEAYIWIPLEIDEVNNLYFEATRKYKNYDLDNALDMYSKAFNRAQQAAKN AKEAKALKETDERMYKQLKALEAASNLPI ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ALA n 1 3 MSE n 1 4 GLY n 1 5 GLU n 1 6 SER n 1 7 ARG n 1 8 GLU n 1 9 SER n 1 10 LYS n 1 11 ASN n 1 12 ALA n 1 13 LYS n 1 14 ILE n 1 15 ALA n 1 16 GLN n 1 17 PRO n 1 18 ASP n 1 19 ASN n 1 20 LYS n 1 21 ASN n 1 22 PHE n 1 23 GLN n 1 24 LEU n 1 25 ARG n 1 26 ASP n 1 27 ILE n 1 28 LYS n 1 29 ASP n 1 30 ILE n 1 31 LYS n 1 32 ASN n 1 33 GLU n 1 34 LEU n 1 35 ILE n 1 36 ARG n 1 37 GLU n 1 38 ARG n 1 39 GLY n 1 40 HIS n 1 41 LEU n 1 42 PHE n 1 43 TYR n 1 44 SER n 1 45 LYS n 1 46 GLU n 1 47 PHE n 1 48 ASN n 1 49 GLU n 1 50 ALA n 1 51 GLU n 1 52 ARG n 1 53 LEU n 1 54 GLU n 1 55 GLU n 1 56 ALA n 1 57 MSE n 1 58 LYS n 1 59 GLN n 1 60 SER n 1 61 PHE n 1 62 SER n 1 63 LYS n 1 64 LYS n 1 65 LYS n 1 66 ALA n 1 67 ILE n 1 68 GLU n 1 69 GLY n 1 70 ASN n 1 71 GLU n 1 72 ILE n 1 73 ALA n 1 74 LEU n 1 75 LYS n 1 76 VAL n 1 77 LEU n 1 78 GLU n 1 79 ARG n 1 80 TYR n 1 81 LYS n 1 82 THR n 1 83 ILE n 1 84 ILE n 1 85 ARG n 1 86 GLU n 1 87 THR n 1 88 ARG n 1 89 GLU n 1 90 LYS n 1 91 LYS n 1 92 GLU n 1 93 LYS n 1 94 THR n 1 95 ASN n 1 96 TYR n 1 97 LEU n 1 98 LYS n 1 99 GLU n 1 100 ASN n 1 101 ILE n 1 102 GLU n 1 103 LYS n 1 104 TYR n 1 105 LEU n 1 106 ASN n 1 107 ASP n 1 108 ALA n 1 109 GLU n 1 110 ALA n 1 111 ASN n 1 112 GLU n 1 113 ALA n 1 114 TYR n 1 115 ILE n 1 116 TRP n 1 117 ILE n 1 118 PRO n 1 119 LEU n 1 120 GLU n 1 121 ILE n 1 122 ASP n 1 123 GLU n 1 124 VAL n 1 125 ASN n 1 126 ASN n 1 127 LEU n 1 128 TYR n 1 129 PHE n 1 130 GLU n 1 131 ALA n 1 132 THR n 1 133 ARG n 1 134 LYS n 1 135 TYR n 1 136 LYS n 1 137 ASN n 1 138 TYR n 1 139 ASP n 1 140 LEU n 1 141 ASP n 1 142 ASN n 1 143 ALA n 1 144 LEU n 1 145 ASP n 1 146 MSE n 1 147 TYR n 1 148 SER n 1 149 LYS n 1 150 ALA n 1 151 PHE n 1 152 ASN n 1 153 ARG n 1 154 ALA n 1 155 GLN n 1 156 GLN n 1 157 ALA n 1 158 ALA n 1 159 LYS n 1 160 ASN n 1 161 ALA n 1 162 LYS n 1 163 GLU n 1 164 ALA n 1 165 LYS n 1 166 ALA n 1 167 LEU n 1 168 LYS n 1 169 GLU n 1 170 THR n 1 171 ASP n 1 172 GLU n 1 173 ARG n 1 174 MSE n 1 175 TYR n 1 176 LYS n 1 177 GLN n 1 178 LEU n 1 179 LYS n 1 180 ALA n 1 181 LEU n 1 182 GLU n 1 183 ALA n 1 184 ALA n 1 185 SER n 1 186 ASN n 1 187 LEU n 1 188 PRO n 1 189 ILE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 189 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene BB_0323 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC 35210 / B31 / CIP 102532 / DSM 4680' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 224326 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code O51302_BORBU _struct_ref.pdbx_db_accession O51302 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;ESRESKNAKIAQPDNKNFQLRDIKDIKNELIRERGHLFYSKEFNEAERLEEAMKQSFSKKKAIEGNEIALKVLERYKTII RETREKKEKTNYLKENIEKYLNDAEANEAYIWIPLEIDEVNNLYFEATRKYKNYDLDNALDMYSKAFNRAQQAAKNAKEA KALKETDERMYKQLKALEAASNLPI ; _struct_ref.pdbx_align_begin 26 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6RJW _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 5 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 189 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O51302 _struct_ref_seq.db_align_beg 26 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 210 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 5 _struct_ref_seq.pdbx_auth_seq_align_end 189 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6RJW GLY A 1 ? UNP O51302 ? ? 'expression tag' 1 1 1 6RJW ALA A 2 ? UNP O51302 ? ? 'expression tag' 2 2 1 6RJW MSE A 3 ? UNP O51302 ? ? 'expression tag' 3 3 1 6RJW GLY A 4 ? UNP O51302 ? ? 'expression tag' 4 4 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6RJW _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.99 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 38.32 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 294 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;0.2 M KNO3 18% PEG 3350 ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-05-09 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97972 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'BESSY BEAMLINE 14.1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97972 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 14.1 _diffrn_source.pdbx_synchrotron_site BESSY # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6RJW _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.85 _reflns.d_resolution_low 43.9 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 4510 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100.0 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 12.6 _reflns.pdbx_Rmerge_I_obs 0.087 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 24.0 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.85 _reflns_shell.d_res_low 3.00 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 15.6 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 636 _reflns_shell.percent_possible_all 100.0 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.219 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 13.4 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] 0.0100 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][2] 0.0400 _refine.aniso_B[2][3] -0.0000 _refine.aniso_B[3][3] -0.0500 _refine.B_iso_max 104.110 _refine.B_iso_mean 39.1710 _refine.B_iso_min 16.720 _refine.correlation_coeff_Fo_to_Fc 0.9410 _refine.correlation_coeff_Fo_to_Fc_free 0.8620 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES : REFINED INDIVIDUALLY' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6RJW _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.8500 _refine.ls_d_res_low 43.9000 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 4277 _refine.ls_number_reflns_R_free 205 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.9800 _refine.ls_percent_reflns_R_free 4.6000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2079 _refine.ls_R_factor_R_free 0.2676 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2051 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free 0.4370 _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 14.9190 _refine.overall_SU_ML 0.2830 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.8500 _refine_hist.d_res_low 43.9000 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 1360 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 161 _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1360 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.008 0.013 1379 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.017 1312 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.554 1.662 1841 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.263 1.593 3055 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 6.135 5.000 160 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 34.930 23.409 88 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 20.657 15.000 281 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 23.776 15.000 10 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.070 0.200 175 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.006 0.020 1519 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 287 ? r_gen_planes_other ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.8500 _refine_ls_shell.d_res_low 2.9240 _refine_ls_shell.number_reflns_all 329 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 15 _refine_ls_shell.number_reflns_R_work 314 _refine_ls_shell.percent_reflns_obs 100.0000 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.2830 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.2590 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 6RJW _struct.title 'Crystal structure of the N-terminal domain of Lyme disease agent Borrelia burgdorferi major virulence factor BB0323 (Se-Met data)' _struct.pdbx_descriptor 'membrane attack complex assembly inhibitor BGA71' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6RJW _struct_keywords.text 'lipoprotein, spectrin repeats, STRUCTURAL PROTEIN' _struct_keywords.pdbx_keywords 'STRUCTURAL PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLN A 23 ? GLU A 37 ? GLN A 23 GLU A 37 1 ? 15 HELX_P HELX_P2 AA2 ARG A 38 ? TYR A 43 ? ARG A 38 TYR A 43 1 ? 6 HELX_P HELX_P3 AA3 TYR A 43 ? LYS A 63 ? TYR A 43 LYS A 63 1 ? 21 HELX_P HELX_P4 AA4 LYS A 65 ? ALA A 110 ? LYS A 65 ALA A 110 1 ? 46 HELX_P HELX_P5 AA5 GLU A 112 ? ILE A 117 ? GLU A 112 ILE A 117 1 ? 6 HELX_P HELX_P6 AA6 ILE A 117 ? ASN A 137 ? ILE A 117 ASN A 137 1 ? 21 HELX_P HELX_P7 AA7 ASP A 139 ? LEU A 181 ? ASP A 139 LEU A 181 1 ? 43 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale both ? A ALA 56 C ? ? ? 1_555 A MSE 57 N ? ? A ALA 56 A MSE 57 1_555 ? ? ? ? ? ? ? 1.311 ? covale2 covale both ? A MSE 57 C ? ? ? 1_555 A LYS 58 N ? ? A MSE 57 A LYS 58 1_555 ? ? ? ? ? ? ? 1.303 ? covale3 covale both ? A ASP 145 C ? ? ? 1_555 A MSE 146 N ? ? A ASP 145 A MSE 146 1_555 ? ? ? ? ? ? ? 1.312 ? covale4 covale both ? A MSE 146 C ? ? ? 1_555 A TYR 147 N ? ? A MSE 146 A TYR 147 1_555 ? ? ? ? ? ? ? 1.311 ? covale5 covale both ? A ARG 173 C ? ? ? 1_555 A MSE 174 N ? ? A ARG 173 A MSE 174 1_555 ? ? ? ? ? ? ? 1.331 ? covale6 covale both ? A MSE 174 C ? ? ? 1_555 A TYR 175 N ? ? A MSE 174 A TYR 175 1_555 ? ? ? ? ? ? ? 1.335 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _atom_sites.entry_id 6RJW _atom_sites.fract_transf_matrix[1][1] 0.024159 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.020480 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011388 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 ? ? ? A . n A 1 2 ALA 2 2 ? ? ? A . n A 1 3 MSE 3 3 ? ? ? A . n A 1 4 GLY 4 4 ? ? ? A . n A 1 5 GLU 5 5 ? ? ? A . n A 1 6 SER 6 6 ? ? ? A . n A 1 7 ARG 7 7 ? ? ? A . n A 1 8 GLU 8 8 ? ? ? A . n A 1 9 SER 9 9 ? ? ? A . n A 1 10 LYS 10 10 ? ? ? A . n A 1 11 ASN 11 11 ? ? ? A . n A 1 12 ALA 12 12 ? ? ? A . n A 1 13 LYS 13 13 ? ? ? A . n A 1 14 ILE 14 14 ? ? ? A . n A 1 15 ALA 15 15 ? ? ? A . n A 1 16 GLN 16 16 ? ? ? A . n A 1 17 PRO 17 17 ? ? ? A . n A 1 18 ASP 18 18 ? ? ? A . n A 1 19 ASN 19 19 ? ? ? A . n A 1 20 LYS 20 20 ? ? ? A . n A 1 21 ASN 21 21 21 ASN ASN A . n A 1 22 PHE 22 22 22 PHE PHE A . n A 1 23 GLN 23 23 23 GLN GLN A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 ARG 25 25 25 ARG ARG A . n A 1 26 ASP 26 26 26 ASP ASP A . n A 1 27 ILE 27 27 27 ILE ILE A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 ASP 29 29 29 ASP ASP A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 ASN 32 32 32 ASN ASN A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 ILE 35 35 35 ILE ILE A . n A 1 36 ARG 36 36 36 ARG ARG A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 ARG 38 38 38 ARG ARG A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 HIS 40 40 40 HIS HIS A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 PHE 42 42 42 PHE PHE A . n A 1 43 TYR 43 43 43 TYR TYR A . n A 1 44 SER 44 44 44 SER SER A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 PHE 47 47 47 PHE PHE A . n A 1 48 ASN 48 48 48 ASN ASN A . n A 1 49 GLU 49 49 49 GLU GLU A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 ARG 52 52 52 ARG ARG A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 GLU 55 55 55 GLU GLU A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 MSE 57 57 57 MSE MSE A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 GLN 59 59 59 GLN GLN A . n A 1 60 SER 60 60 60 SER SER A . n A 1 61 PHE 61 61 61 PHE PHE A . n A 1 62 SER 62 62 62 SER SER A . n A 1 63 LYS 63 63 63 LYS LYS A . n A 1 64 LYS 64 64 64 LYS LYS A . n A 1 65 LYS 65 65 65 LYS LYS A . n A 1 66 ALA 66 66 66 ALA ALA A . n A 1 67 ILE 67 67 67 ILE ILE A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 GLY 69 69 69 GLY GLY A . n A 1 70 ASN 70 70 70 ASN ASN A . n A 1 71 GLU 71 71 71 GLU GLU A . n A 1 72 ILE 72 72 72 ILE ILE A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 LEU 74 74 74 LEU LEU A . n A 1 75 LYS 75 75 75 LYS LYS A . n A 1 76 VAL 76 76 76 VAL VAL A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 GLU 78 78 78 GLU GLU A . n A 1 79 ARG 79 79 79 ARG ARG A . n A 1 80 TYR 80 80 80 TYR TYR A . n A 1 81 LYS 81 81 81 LYS LYS A . n A 1 82 THR 82 82 82 THR THR A . n A 1 83 ILE 83 83 83 ILE ILE A . n A 1 84 ILE 84 84 84 ILE ILE A . n A 1 85 ARG 85 85 85 ARG ARG A . n A 1 86 GLU 86 86 86 GLU GLU A . n A 1 87 THR 87 87 87 THR THR A . n A 1 88 ARG 88 88 88 ARG ARG A . n A 1 89 GLU 89 89 89 GLU GLU A . n A 1 90 LYS 90 90 90 LYS LYS A . n A 1 91 LYS 91 91 91 LYS LYS A . n A 1 92 GLU 92 92 92 GLU GLU A . n A 1 93 LYS 93 93 93 LYS LYS A . n A 1 94 THR 94 94 94 THR THR A . n A 1 95 ASN 95 95 95 ASN ASN A . n A 1 96 TYR 96 96 96 TYR TYR A . n A 1 97 LEU 97 97 97 LEU LEU A . n A 1 98 LYS 98 98 98 LYS LYS A . n A 1 99 GLU 99 99 99 GLU GLU A . n A 1 100 ASN 100 100 100 ASN ASN A . n A 1 101 ILE 101 101 101 ILE ILE A . n A 1 102 GLU 102 102 102 GLU GLU A . n A 1 103 LYS 103 103 103 LYS LYS A . n A 1 104 TYR 104 104 104 TYR TYR A . n A 1 105 LEU 105 105 105 LEU LEU A . n A 1 106 ASN 106 106 106 ASN ASN A . n A 1 107 ASP 107 107 107 ASP ASP A . n A 1 108 ALA 108 108 108 ALA ALA A . n A 1 109 GLU 109 109 109 GLU GLU A . n A 1 110 ALA 110 110 110 ALA ALA A . n A 1 111 ASN 111 111 111 ASN ASN A . n A 1 112 GLU 112 112 112 GLU GLU A . n A 1 113 ALA 113 113 113 ALA ALA A . n A 1 114 TYR 114 114 114 TYR TYR A . n A 1 115 ILE 115 115 115 ILE ILE A . n A 1 116 TRP 116 116 116 TRP TRP A . n A 1 117 ILE 117 117 117 ILE ILE A . n A 1 118 PRO 118 118 118 PRO PRO A . n A 1 119 LEU 119 119 119 LEU LEU A . n A 1 120 GLU 120 120 120 GLU GLU A . n A 1 121 ILE 121 121 121 ILE ILE A . n A 1 122 ASP 122 122 122 ASP ASP A . n A 1 123 GLU 123 123 123 GLU GLU A . n A 1 124 VAL 124 124 124 VAL VAL A . n A 1 125 ASN 125 125 125 ASN ASN A . n A 1 126 ASN 126 126 126 ASN ASN A . n A 1 127 LEU 127 127 127 LEU LEU A . n A 1 128 TYR 128 128 128 TYR TYR A . n A 1 129 PHE 129 129 129 PHE PHE A . n A 1 130 GLU 130 130 130 GLU GLU A . n A 1 131 ALA 131 131 131 ALA ALA A . n A 1 132 THR 132 132 132 THR THR A . n A 1 133 ARG 133 133 133 ARG ARG A . n A 1 134 LYS 134 134 134 LYS LYS A . n A 1 135 TYR 135 135 135 TYR TYR A . n A 1 136 LYS 136 136 136 LYS LYS A . n A 1 137 ASN 137 137 137 ASN ASN A . n A 1 138 TYR 138 138 138 TYR TYR A . n A 1 139 ASP 139 139 139 ASP ASP A . n A 1 140 LEU 140 140 140 LEU LEU A . n A 1 141 ASP 141 141 141 ASP ASP A . n A 1 142 ASN 142 142 142 ASN ASN A . n A 1 143 ALA 143 143 143 ALA ALA A . n A 1 144 LEU 144 144 144 LEU LEU A . n A 1 145 ASP 145 145 145 ASP ASP A . n A 1 146 MSE 146 146 146 MSE MSE A . n A 1 147 TYR 147 147 147 TYR TYR A . n A 1 148 SER 148 148 148 SER SER A . n A 1 149 LYS 149 149 149 LYS LYS A . n A 1 150 ALA 150 150 150 ALA ALA A . n A 1 151 PHE 151 151 151 PHE PHE A . n A 1 152 ASN 152 152 152 ASN ASN A . n A 1 153 ARG 153 153 153 ARG ARG A . n A 1 154 ALA 154 154 154 ALA ALA A . n A 1 155 GLN 155 155 155 GLN GLN A . n A 1 156 GLN 156 156 156 GLN GLN A . n A 1 157 ALA 157 157 157 ALA ALA A . n A 1 158 ALA 158 158 158 ALA ALA A . n A 1 159 LYS 159 159 159 LYS LYS A . n A 1 160 ASN 160 160 160 ASN ASN A . n A 1 161 ALA 161 161 161 ALA ALA A . n A 1 162 LYS 162 162 162 LYS LYS A . n A 1 163 GLU 163 163 163 GLU GLU A . n A 1 164 ALA 164 164 164 ALA ALA A . n A 1 165 LYS 165 165 165 LYS LYS A . n A 1 166 ALA 166 166 166 ALA ALA A . n A 1 167 LEU 167 167 167 LEU LEU A . n A 1 168 LYS 168 168 168 LYS LYS A . n A 1 169 GLU 169 169 169 GLU GLU A . n A 1 170 THR 170 170 170 THR THR A . n A 1 171 ASP 171 171 171 ASP ASP A . n A 1 172 GLU 172 172 172 GLU GLU A . n A 1 173 ARG 173 173 173 ARG ARG A . n A 1 174 MSE 174 174 174 MSE MSE A . n A 1 175 TYR 175 175 175 TYR TYR A . n A 1 176 LYS 176 176 176 LYS LYS A . n A 1 177 GLN 177 177 177 GLN GLN A . n A 1 178 LEU 178 178 178 LEU LEU A . n A 1 179 LYS 179 179 179 LYS LYS A . n A 1 180 ALA 180 180 180 ALA ALA A . n A 1 181 LEU 181 181 181 LEU LEU A . n A 1 182 GLU 182 182 ? ? ? A . n A 1 183 ALA 183 183 ? ? ? A . n A 1 184 ALA 184 184 ? ? ? A . n A 1 185 SER 185 185 ? ? ? A . n A 1 186 ASN 186 186 ? ? ? A . n A 1 187 LEU 187 187 ? ? ? A . n A 1 188 PRO 188 188 ? ? ? A . n A 1 189 ILE 189 189 ? ? ? A . n # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 57 A MSE 57 ? MET 'modified residue' 2 A MSE 146 A MSE 146 ? MET 'modified residue' 3 A MSE 174 A MSE 174 ? MET 'modified residue' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 11010 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2019-09-11 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0238 1 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.24 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? SHELXCD ? ? ? . 5 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 64 ? ? 70.11 45.50 2 1 ASN A 111 ? ? -108.81 40.05 3 1 ASP A 139 ? ? -116.17 71.77 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 1 ? A GLY 1 2 1 Y 1 A ALA 2 ? A ALA 2 3 1 Y 1 A MSE 3 ? A MSE 3 4 1 Y 1 A GLY 4 ? A GLY 4 5 1 Y 1 A GLU 5 ? A GLU 5 6 1 Y 1 A SER 6 ? A SER 6 7 1 Y 1 A ARG 7 ? A ARG 7 8 1 Y 1 A GLU 8 ? A GLU 8 9 1 Y 1 A SER 9 ? A SER 9 10 1 Y 1 A LYS 10 ? A LYS 10 11 1 Y 1 A ASN 11 ? A ASN 11 12 1 Y 1 A ALA 12 ? A ALA 12 13 1 Y 1 A LYS 13 ? A LYS 13 14 1 Y 1 A ILE 14 ? A ILE 14 15 1 Y 1 A ALA 15 ? A ALA 15 16 1 Y 1 A GLN 16 ? A GLN 16 17 1 Y 1 A PRO 17 ? A PRO 17 18 1 Y 1 A ASP 18 ? A ASP 18 19 1 Y 1 A ASN 19 ? A ASN 19 20 1 Y 1 A LYS 20 ? A LYS 20 21 1 Y 1 A GLU 182 ? A GLU 182 22 1 Y 1 A ALA 183 ? A ALA 183 23 1 Y 1 A ALA 184 ? A ALA 184 24 1 Y 1 A SER 185 ? A SER 185 25 1 Y 1 A ASN 186 ? A ASN 186 26 1 Y 1 A LEU 187 ? A LEU 187 27 1 Y 1 A PRO 188 ? A PRO 188 28 1 Y 1 A ILE 189 ? A ILE 189 # _pdbx_audit_support.funding_organization 'European Regional Development Fund' _pdbx_audit_support.country Latvia _pdbx_audit_support.grant_number 1.1.1.2/VIAA/1/16/144 _pdbx_audit_support.ordinal 1 # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #