data_6RM0 # _entry.id 6RM0 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.366 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6RM0 pdb_00006rm0 10.2210/pdb6rm0/pdb WWPDB D_1292102169 ? ? # _pdbx_database_PDB_obs_spr.id OBSLTE _pdbx_database_PDB_obs_spr.date 2023-02-15 _pdbx_database_PDB_obs_spr.pdb_id 6S86 _pdbx_database_PDB_obs_spr.replace_pdb_id 6RM0 _pdbx_database_PDB_obs_spr.details ? # _pdbx_database_status.status_code OBS _pdbx_database_status.status_code_sf OBS _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6RM0 _pdbx_database_status.recvd_initial_deposition_date 2019-05-03 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Smola, M.' 1 0000-0002-4611-739X 'Boura, E.' 2 0000-0002-9652-4065 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Acta Crystallogr.,Sect.F' _citation.journal_id_ASTM ACSFEN _citation.journal_id_CSD ? _citation.journal_id_ISSN 2053-230X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 75 _citation.language ? _citation.page_first 593 _citation.page_last 598 _citation.title 'No magnesium is needed for binding of the stimulator of interferon genes to cyclic dinucleotides.' _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1107/S2053230X19010999 _citation.pdbx_database_id_PubMed 31475926 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Smola, M.' 1 ? primary 'Birkus, G.' 2 ? primary 'Boura, E.' 3 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6RM0 _cell.details ? _cell.formula_units_Z ? _cell.length_a 110.708 _cell.length_a_esd ? _cell.length_b 110.708 _cell.length_b_esd ? _cell.length_c 34.331 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6RM0 _symmetry.cell_setting ? _symmetry.Int_Tables_number 92 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 41 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Stimulator of interferon protein' 23189.064 1 ? ? ? ? 2 non-polymer syn ;9,9'-[(2R,3R,3aS,5S,7aR,9R,10R,10aS,12S,14aR)-3,5,10,12-tetrahydroxy-5,12-dioxidooctahydro-2H,7H-difuro[3,2-d:3',2'-j][1,3,7,9,2,8]tetraoxadiphosphacyclododecine-2,9-diyl]bis(2-amino-1,9-dihydro-6H-purin-6-one) ; 690.411 1 ? ? ? ? 3 water nat water 18.015 14 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;APAEISAVCEKGNFNVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNI RFLDKLPQQTGDRAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDIL ADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTV ; _entity_poly.pdbx_seq_one_letter_code_can ;APAEISAVCEKGNFNVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNI RFLDKLPQQTGDRAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDIL ADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTV ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 PRO n 1 3 ALA n 1 4 GLU n 1 5 ILE n 1 6 SER n 1 7 ALA n 1 8 VAL n 1 9 CYS n 1 10 GLU n 1 11 LYS n 1 12 GLY n 1 13 ASN n 1 14 PHE n 1 15 ASN n 1 16 VAL n 1 17 ALA n 1 18 HIS n 1 19 GLY n 1 20 LEU n 1 21 ALA n 1 22 TRP n 1 23 SER n 1 24 TYR n 1 25 TYR n 1 26 ILE n 1 27 GLY n 1 28 TYR n 1 29 LEU n 1 30 ARG n 1 31 LEU n 1 32 ILE n 1 33 LEU n 1 34 PRO n 1 35 GLU n 1 36 LEU n 1 37 GLN n 1 38 ALA n 1 39 ARG n 1 40 ILE n 1 41 ARG n 1 42 THR n 1 43 TYR n 1 44 ASN n 1 45 GLN n 1 46 HIS n 1 47 TYR n 1 48 ASN n 1 49 ASN n 1 50 LEU n 1 51 LEU n 1 52 ARG n 1 53 GLY n 1 54 ALA n 1 55 VAL n 1 56 SER n 1 57 GLN n 1 58 ARG n 1 59 LEU n 1 60 TYR n 1 61 ILE n 1 62 LEU n 1 63 LEU n 1 64 PRO n 1 65 LEU n 1 66 ASP n 1 67 CYS n 1 68 GLY n 1 69 VAL n 1 70 PRO n 1 71 ASP n 1 72 ASN n 1 73 LEU n 1 74 SER n 1 75 MET n 1 76 ALA n 1 77 ASP n 1 78 PRO n 1 79 ASN n 1 80 ILE n 1 81 ARG n 1 82 PHE n 1 83 LEU n 1 84 ASP n 1 85 LYS n 1 86 LEU n 1 87 PRO n 1 88 GLN n 1 89 GLN n 1 90 THR n 1 91 GLY n 1 92 ASP n 1 93 ARG n 1 94 ALA n 1 95 GLY n 1 96 ILE n 1 97 LYS n 1 98 ASP n 1 99 ARG n 1 100 VAL n 1 101 TYR n 1 102 SER n 1 103 ASN n 1 104 SER n 1 105 ILE n 1 106 TYR n 1 107 GLU n 1 108 LEU n 1 109 LEU n 1 110 GLU n 1 111 ASN n 1 112 GLY n 1 113 GLN n 1 114 ARG n 1 115 ALA n 1 116 GLY n 1 117 THR n 1 118 CYS n 1 119 VAL n 1 120 LEU n 1 121 GLU n 1 122 TYR n 1 123 ALA n 1 124 THR n 1 125 PRO n 1 126 LEU n 1 127 GLN n 1 128 THR n 1 129 LEU n 1 130 PHE n 1 131 ALA n 1 132 MET n 1 133 SER n 1 134 GLN n 1 135 TYR n 1 136 SER n 1 137 GLN n 1 138 ALA n 1 139 GLY n 1 140 PHE n 1 141 SER n 1 142 ARG n 1 143 GLU n 1 144 ASP n 1 145 ARG n 1 146 LEU n 1 147 GLU n 1 148 GLN n 1 149 ALA n 1 150 LYS n 1 151 LEU n 1 152 PHE n 1 153 CYS n 1 154 ARG n 1 155 THR n 1 156 LEU n 1 157 GLU n 1 158 ASP n 1 159 ILE n 1 160 LEU n 1 161 ALA n 1 162 ASP n 1 163 ALA n 1 164 PRO n 1 165 GLU n 1 166 SER n 1 167 GLN n 1 168 ASN n 1 169 ASN n 1 170 CYS n 1 171 ARG n 1 172 LEU n 1 173 ILE n 1 174 ALA n 1 175 TYR n 1 176 GLN n 1 177 GLU n 1 178 PRO n 1 179 ALA n 1 180 ASP n 1 181 ASP n 1 182 SER n 1 183 SER n 1 184 PHE n 1 185 SER n 1 186 LEU n 1 187 SER n 1 188 GLN n 1 189 GLU n 1 190 VAL n 1 191 LEU n 1 192 ARG n 1 193 HIS n 1 194 LEU n 1 195 ARG n 1 196 GLN n 1 197 GLU n 1 198 GLU n 1 199 LYS n 1 200 GLU n 1 201 GLU n 1 202 VAL n 1 203 THR n 1 204 VAL n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 204 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'STING, LOC340061, hCG_1782396' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A2R3XZB7_HUMAN _struct_ref.pdbx_db_accession A0A2R3XZB7 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;APAEISAVCEKGNFNVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNI RFLDKLPQQTGDRAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDIL ADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTV ; _struct_ref.pdbx_align_begin 140 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6RM0 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 204 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A2R3XZB7 _struct_ref_seq.db_align_beg 140 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 343 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 140 _struct_ref_seq.pdbx_auth_seq_align_end 343 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 C2E non-polymer . ;9,9'-[(2R,3R,3aS,5S,7aR,9R,10R,10aS,12S,14aR)-3,5,10,12-tetrahydroxy-5,12-dioxidooctahydro-2H,7H-difuro[3,2-d:3',2'-j][1,3,7,9,2,8]tetraoxadiphosphacyclododecine-2,9-diyl]bis(2-amino-1,9-dihydro-6H-purin-6-one) ; 'c-di-GMP; Cyclic diguanosine monophosphate' 'C20 H24 N10 O14 P2' 690.411 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6RM0 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.27 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 45.77 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2 M Lithium sulphate, 20% (w/v) PEG 3350' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 200K' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2019-04-18 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.54187 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source 'ROTATING ANODE' _diffrn_source.target ? _diffrn_source.type 'RIGAKU MICROMAX-007 HF' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.54187 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_synchrotron_site ? # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6RM0 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.513 _reflns.d_resolution_low 31.44 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 7677 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.62 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 12.2 _reflns.pdbx_Rmerge_I_obs 0.07824 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 22.37 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.08185 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.513 _reflns_shell.d_res_low 2.603 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 735 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 126.210 _refine.B_iso_mean 72.2586 _refine.B_iso_min 30.720 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6RM0 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.5130 _refine.ls_d_res_low 31.44 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 13840 _refine.ls_number_reflns_R_free 1377 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.6900 _refine.ls_percent_reflns_R_free 9.9500 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2472 _refine.ls_R_factor_R_free 0.3014 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2417 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.400 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 4KSY _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 27.9800 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.4000 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.5130 _refine_hist.d_res_low 31.44 _refine_hist.number_atoms_solvent 14 _refine_hist.number_atoms_total 1456 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 173 _refine_hist.pdbx_B_iso_mean_ligand 46.54 _refine_hist.pdbx_B_iso_mean_solvent 55.18 _refine_hist.pdbx_number_atoms_protein 1374 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 68 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.5135 2.6033 1360 . 136 1224 98.0000 . . . 0.3847 0.0000 0.3294 . . . . . . 10 . . . 'X-RAY DIFFRACTION' 2.6033 2.7075 1385 . 138 1247 100.0000 . . . 0.3631 0.0000 0.3033 . . . . . . 10 . . . 'X-RAY DIFFRACTION' 2.7075 2.8307 1400 . 144 1256 100.0000 . . . 0.3164 0.0000 0.3120 . . . . . . 10 . . . 'X-RAY DIFFRACTION' 2.8307 2.9799 1373 . 139 1234 100.0000 . . . 0.3569 0.0000 0.3020 . . . . . . 10 . . . 'X-RAY DIFFRACTION' 2.9799 3.1665 1394 . 139 1255 100.0000 . . . 0.3070 0.0000 0.2722 . . . . . . 10 . . . 'X-RAY DIFFRACTION' 3.1665 3.4109 1397 . 136 1261 100.0000 . . . 0.3463 0.0000 0.2737 . . . . . . 10 . . . 'X-RAY DIFFRACTION' 3.4109 3.7539 1375 . 138 1237 100.0000 . . . 0.2903 0.0000 0.2438 . . . . . . 10 . . . 'X-RAY DIFFRACTION' 3.7539 4.2965 1400 . 136 1264 100.0000 . . . 0.2859 0.0000 0.2113 . . . . . . 10 . . . 'X-RAY DIFFRACTION' 4.2965 5.4109 1360 . 130 1230 100.0000 . . . 0.2878 0.0000 0.2018 . . . . . . 10 . . . 'X-RAY DIFFRACTION' 5.4109 39.1459 1396 . 141 1255 100.0000 . . . 0.2683 0.0000 0.2264 . . . . . . 10 . . . # _struct.entry_id 6RM0 _struct.title ;Human wtSTING in complex with 3'3'-c-di-GMP ; _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6RM0 _struct_keywords.text 'Activator, Membrane protein, Immune system, Receptor, PROTEIN BINDING' _struct_keywords.pdbx_keywords 'PROTEIN BINDING' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 VAL A 16 ? TYR A 28 ? VAL A 155 TYR A 167 1 ? 13 HELX_P HELX_P2 AA2 TYR A 28 ? TYR A 47 ? TYR A 167 TYR A 186 1 ? 20 HELX_P HELX_P3 AA3 ASN A 72 ? ALA A 76 ? ASN A 211 ALA A 215 5 ? 5 HELX_P HELX_P4 AA4 ALA A 123 ? SER A 133 ? ALA A 262 SER A 272 1 ? 11 HELX_P HELX_P5 AA5 SER A 141 ? GLU A 143 ? SER A 280 GLU A 282 5 ? 3 HELX_P HELX_P6 AA6 ASP A 144 ? ASP A 162 ? ASP A 283 ASP A 301 1 ? 19 HELX_P HELX_P7 AA7 SER A 185 ? GLN A 196 ? SER A 324 GLN A 335 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 80 ? LYS A 85 ? ILE A 219 LYS A 224 AA1 2 SER A 104 ? GLU A 110 ? SER A 243 GLU A 249 AA1 3 GLN A 113 ? TYR A 122 ? GLN A 252 TYR A 261 AA1 4 LEU A 59 ? PRO A 64 ? LEU A 198 PRO A 203 AA1 5 CYS A 170 ? TYR A 175 ? CYS A 309 TYR A 314 AA2 1 GLN A 89 ? ARG A 93 ? GLN A 228 ARG A 232 AA2 2 ILE A 96 ? TYR A 101 ? ILE A 235 TYR A 240 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ASP A 84 ? N ASP A 223 O ILE A 105 ? O ILE A 244 AA1 2 3 N LEU A 108 ? N LEU A 247 O GLY A 116 ? O GLY A 255 AA1 3 4 O GLU A 121 ? O GLU A 260 N LEU A 62 ? N LEU A 201 AA1 4 5 N LEU A 63 ? N LEU A 202 O ILE A 173 ? O ILE A 312 AA2 1 2 N GLN A 89 ? N GLN A 228 O TYR A 101 ? O TYR A 240 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id C2E _struct_site.pdbx_auth_seq_id 401 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 28 _struct_site.details 'binding site for residue C2E A 401' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 28 GLY A 27 ? GLY A 166 . ? 1_555 ? 2 AC1 28 GLY A 27 ? GLY A 166 . ? 7_556 ? 3 AC1 28 TYR A 28 ? TYR A 167 . ? 1_555 ? 4 AC1 28 TYR A 28 ? TYR A 167 . ? 7_556 ? 5 AC1 28 ARG A 93 ? ARG A 232 . ? 7_556 ? 6 AC1 28 ARG A 93 ? ARG A 232 . ? 1_555 ? 7 AC1 28 ILE A 96 ? ILE A 235 . ? 7_556 ? 8 AC1 28 ILE A 96 ? ILE A 235 . ? 1_555 ? 9 AC1 28 ARG A 99 ? ARG A 238 . ? 7_556 ? 10 AC1 28 ARG A 99 ? ARG A 238 . ? 1_555 ? 11 AC1 28 VAL A 100 ? VAL A 239 . ? 1_555 ? 12 AC1 28 VAL A 100 ? VAL A 239 . ? 7_556 ? 13 AC1 28 TYR A 101 ? TYR A 240 . ? 1_555 ? 14 AC1 28 TYR A 101 ? TYR A 240 . ? 7_556 ? 15 AC1 28 SER A 102 ? SER A 241 . ? 7_556 ? 16 AC1 28 SER A 102 ? SER A 241 . ? 1_555 ? 17 AC1 28 GLU A 121 ? GLU A 260 . ? 1_555 ? 18 AC1 28 GLU A 121 ? GLU A 260 . ? 7_556 ? 19 AC1 28 THR A 124 ? THR A 263 . ? 7_556 ? 20 AC1 28 THR A 124 ? THR A 263 . ? 1_555 ? 21 AC1 28 PRO A 125 ? PRO A 264 . ? 7_556 ? 22 AC1 28 PRO A 125 ? PRO A 264 . ? 1_555 ? 23 AC1 28 HOH C . ? HOH A 501 . ? 1_555 ? 24 AC1 28 HOH C . ? HOH A 501 . ? 7_556 ? 25 AC1 28 HOH C . ? HOH A 505 . ? 1_555 ? 26 AC1 28 HOH C . ? HOH A 505 . ? 7_556 ? 27 AC1 28 HOH C . ? HOH A 514 . ? 7_556 ? 28 AC1 28 HOH C . ? HOH A 514 . ? 1_555 ? # _atom_sites.entry_id 6RM0 _atom_sites.fract_transf_matrix[1][1] 0.009033 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.009033 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.029128 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C H N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 140 ? ? ? A . n A 1 2 PRO 2 141 ? ? ? A . n A 1 3 ALA 3 142 ? ? ? A . n A 1 4 GLU 4 143 ? ? ? A . n A 1 5 ILE 5 144 ? ? ? A . n A 1 6 SER 6 145 ? ? ? A . n A 1 7 ALA 7 146 ? ? ? A . n A 1 8 VAL 8 147 ? ? ? A . n A 1 9 CYS 9 148 ? ? ? A . n A 1 10 GLU 10 149 ? ? ? A . n A 1 11 LYS 11 150 ? ? ? A . n A 1 12 GLY 12 151 ? ? ? A . n A 1 13 ASN 13 152 ? ? ? A . n A 1 14 PHE 14 153 ? ? ? A . n A 1 15 ASN 15 154 154 ASN ASN A . n A 1 16 VAL 16 155 155 VAL VAL A . n A 1 17 ALA 17 156 156 ALA ALA A . n A 1 18 HIS 18 157 157 HIS HIS A . n A 1 19 GLY 19 158 158 GLY GLY A . n A 1 20 LEU 20 159 159 LEU LEU A . n A 1 21 ALA 21 160 160 ALA ALA A . n A 1 22 TRP 22 161 161 TRP TRP A . n A 1 23 SER 23 162 162 SER SER A . n A 1 24 TYR 24 163 163 TYR TYR A . n A 1 25 TYR 25 164 164 TYR TYR A . n A 1 26 ILE 26 165 165 ILE ILE A . n A 1 27 GLY 27 166 166 GLY GLY A . n A 1 28 TYR 28 167 167 TYR TYR A . n A 1 29 LEU 29 168 168 LEU LEU A . n A 1 30 ARG 30 169 169 ARG ARG A . n A 1 31 LEU 31 170 170 LEU LEU A . n A 1 32 ILE 32 171 171 ILE ILE A . n A 1 33 LEU 33 172 172 LEU LEU A . n A 1 34 PRO 34 173 173 PRO PRO A . n A 1 35 GLU 35 174 174 GLU GLU A . n A 1 36 LEU 36 175 175 LEU LEU A . n A 1 37 GLN 37 176 176 GLN GLN A . n A 1 38 ALA 38 177 177 ALA ALA A . n A 1 39 ARG 39 178 178 ARG ARG A . n A 1 40 ILE 40 179 179 ILE ILE A . n A 1 41 ARG 41 180 180 ARG ARG A . n A 1 42 THR 42 181 181 THR THR A . n A 1 43 TYR 43 182 182 TYR TYR A . n A 1 44 ASN 44 183 183 ASN ASN A . n A 1 45 GLN 45 184 184 GLN GLN A . n A 1 46 HIS 46 185 185 HIS HIS A . n A 1 47 TYR 47 186 186 TYR TYR A . n A 1 48 ASN 48 187 187 ASN ASN A . n A 1 49 ASN 49 188 ? ? ? A . n A 1 50 LEU 50 189 ? ? ? A . n A 1 51 LEU 51 190 ? ? ? A . n A 1 52 ARG 52 191 ? ? ? A . n A 1 53 GLY 53 192 ? ? ? A . n A 1 54 ALA 54 193 193 ALA ALA A . n A 1 55 VAL 55 194 194 VAL VAL A . n A 1 56 SER 56 195 195 SER SER A . n A 1 57 GLN 57 196 196 GLN GLN A . n A 1 58 ARG 58 197 197 ARG ARG A . n A 1 59 LEU 59 198 198 LEU LEU A . n A 1 60 TYR 60 199 199 TYR TYR A . n A 1 61 ILE 61 200 200 ILE ILE A . n A 1 62 LEU 62 201 201 LEU LEU A . n A 1 63 LEU 63 202 202 LEU LEU A . n A 1 64 PRO 64 203 203 PRO PRO A . n A 1 65 LEU 65 204 204 LEU LEU A . n A 1 66 ASP 66 205 205 ASP ASP A . n A 1 67 CYS 67 206 206 CYS CYS A . n A 1 68 GLY 68 207 207 GLY GLY A . n A 1 69 VAL 69 208 208 VAL VAL A . n A 1 70 PRO 70 209 209 PRO PRO A . n A 1 71 ASP 71 210 210 ASP ASP A . n A 1 72 ASN 72 211 211 ASN ASN A . n A 1 73 LEU 73 212 212 LEU LEU A . n A 1 74 SER 74 213 213 SER SER A . n A 1 75 MET 75 214 214 MET MET A . n A 1 76 ALA 76 215 215 ALA ALA A . n A 1 77 ASP 77 216 216 ASP ASP A . n A 1 78 PRO 78 217 217 PRO PRO A . n A 1 79 ASN 79 218 218 ASN ASN A . n A 1 80 ILE 80 219 219 ILE ILE A . n A 1 81 ARG 81 220 220 ARG ARG A . n A 1 82 PHE 82 221 221 PHE PHE A . n A 1 83 LEU 83 222 222 LEU LEU A . n A 1 84 ASP 84 223 223 ASP ASP A . n A 1 85 LYS 85 224 224 LYS LYS A . n A 1 86 LEU 86 225 225 LEU LEU A . n A 1 87 PRO 87 226 226 PRO PRO A . n A 1 88 GLN 88 227 227 GLN GLN A . n A 1 89 GLN 89 228 228 GLN GLN A . n A 1 90 THR 90 229 229 THR THR A . n A 1 91 GLY 91 230 230 GLY GLY A . n A 1 92 ASP 92 231 231 ASP ASP A . n A 1 93 ARG 93 232 232 ARG ARG A . n A 1 94 ALA 94 233 233 ALA ALA A . n A 1 95 GLY 95 234 234 GLY GLY A . n A 1 96 ILE 96 235 235 ILE ILE A . n A 1 97 LYS 97 236 236 LYS LYS A . n A 1 98 ASP 98 237 237 ASP ASP A . n A 1 99 ARG 99 238 238 ARG ARG A . n A 1 100 VAL 100 239 239 VAL VAL A . n A 1 101 TYR 101 240 240 TYR TYR A . n A 1 102 SER 102 241 241 SER SER A . n A 1 103 ASN 103 242 242 ASN ASN A . n A 1 104 SER 104 243 243 SER SER A . n A 1 105 ILE 105 244 244 ILE ILE A . n A 1 106 TYR 106 245 245 TYR TYR A . n A 1 107 GLU 107 246 246 GLU GLU A . n A 1 108 LEU 108 247 247 LEU LEU A . n A 1 109 LEU 109 248 248 LEU LEU A . n A 1 110 GLU 110 249 249 GLU GLU A . n A 1 111 ASN 111 250 250 ASN ASN A . n A 1 112 GLY 112 251 251 GLY GLY A . n A 1 113 GLN 113 252 252 GLN GLN A . n A 1 114 ARG 114 253 253 ARG ARG A . n A 1 115 ALA 115 254 254 ALA ALA A . n A 1 116 GLY 116 255 255 GLY GLY A . n A 1 117 THR 117 256 256 THR THR A . n A 1 118 CYS 118 257 257 CYS CYS A . n A 1 119 VAL 119 258 258 VAL VAL A . n A 1 120 LEU 120 259 259 LEU LEU A . n A 1 121 GLU 121 260 260 GLU GLU A . n A 1 122 TYR 122 261 261 TYR TYR A . n A 1 123 ALA 123 262 262 ALA ALA A . n A 1 124 THR 124 263 263 THR THR A . n A 1 125 PRO 125 264 264 PRO PRO A . n A 1 126 LEU 126 265 265 LEU LEU A . n A 1 127 GLN 127 266 266 GLN GLN A . n A 1 128 THR 128 267 267 THR THR A . n A 1 129 LEU 129 268 268 LEU LEU A . n A 1 130 PHE 130 269 269 PHE PHE A . n A 1 131 ALA 131 270 270 ALA ALA A . n A 1 132 MET 132 271 271 MET MET A . n A 1 133 SER 133 272 272 SER SER A . n A 1 134 GLN 134 273 273 GLN GLN A . n A 1 135 TYR 135 274 274 TYR TYR A . n A 1 136 SER 136 275 275 SER SER A . n A 1 137 GLN 137 276 276 GLN GLN A . n A 1 138 ALA 138 277 277 ALA ALA A . n A 1 139 GLY 139 278 278 GLY GLY A . n A 1 140 PHE 140 279 279 PHE PHE A . n A 1 141 SER 141 280 280 SER SER A . n A 1 142 ARG 142 281 281 ARG ARG A . n A 1 143 GLU 143 282 282 GLU GLU A . n A 1 144 ASP 144 283 283 ASP ASP A . n A 1 145 ARG 145 284 284 ARG ARG A . n A 1 146 LEU 146 285 285 LEU LEU A . n A 1 147 GLU 147 286 286 GLU GLU A . n A 1 148 GLN 148 287 287 GLN GLN A . n A 1 149 ALA 149 288 288 ALA ALA A . n A 1 150 LYS 150 289 289 LYS LYS A . n A 1 151 LEU 151 290 290 LEU LEU A . n A 1 152 PHE 152 291 291 PHE PHE A . n A 1 153 CYS 153 292 292 CYS CYS A . n A 1 154 ARG 154 293 293 ARG ARG A . n A 1 155 THR 155 294 294 THR THR A . n A 1 156 LEU 156 295 295 LEU LEU A . n A 1 157 GLU 157 296 296 GLU GLU A . n A 1 158 ASP 158 297 297 ASP ASP A . n A 1 159 ILE 159 298 298 ILE ILE A . n A 1 160 LEU 160 299 299 LEU LEU A . n A 1 161 ALA 161 300 300 ALA ALA A . n A 1 162 ASP 162 301 301 ASP ASP A . n A 1 163 ALA 163 302 302 ALA ALA A . n A 1 164 PRO 164 303 303 PRO PRO A . n A 1 165 GLU 165 304 304 GLU GLU A . n A 1 166 SER 166 305 305 SER SER A . n A 1 167 GLN 167 306 306 GLN GLN A . n A 1 168 ASN 168 307 307 ASN ASN A . n A 1 169 ASN 169 308 308 ASN ASN A . n A 1 170 CYS 170 309 309 CYS CYS A . n A 1 171 ARG 171 310 310 ARG ARG A . n A 1 172 LEU 172 311 311 LEU LEU A . n A 1 173 ILE 173 312 312 ILE ILE A . n A 1 174 ALA 174 313 313 ALA ALA A . n A 1 175 TYR 175 314 314 TYR TYR A . n A 1 176 GLN 176 315 315 GLN GLN A . n A 1 177 GLU 177 316 316 GLU GLU A . n A 1 178 PRO 178 317 317 PRO PRO A . n A 1 179 ALA 179 318 ? ? ? A . n A 1 180 ASP 180 319 ? ? ? A . n A 1 181 ASP 181 320 ? ? ? A . n A 1 182 SER 182 321 ? ? ? A . n A 1 183 SER 183 322 ? ? ? A . n A 1 184 PHE 184 323 323 PHE PHE A . n A 1 185 SER 185 324 324 SER SER A . n A 1 186 LEU 186 325 325 LEU LEU A . n A 1 187 SER 187 326 326 SER SER A . n A 1 188 GLN 188 327 327 GLN GLN A . n A 1 189 GLU 189 328 328 GLU GLU A . n A 1 190 VAL 190 329 329 VAL VAL A . n A 1 191 LEU 191 330 330 LEU LEU A . n A 1 192 ARG 192 331 331 ARG ARG A . n A 1 193 HIS 193 332 332 HIS HIS A . n A 1 194 LEU 194 333 333 LEU LEU A . n A 1 195 ARG 195 334 334 ARG ARG A . n A 1 196 GLN 196 335 335 GLN GLN A . n A 1 197 GLU 197 336 336 GLU GLU A . n A 1 198 GLU 198 337 ? ? ? A . n A 1 199 LYS 199 338 ? ? ? A . n A 1 200 GLU 200 339 ? ? ? A . n A 1 201 GLU 201 340 ? ? ? A . n A 1 202 VAL 202 341 ? ? ? A . n A 1 203 THR 203 342 ? ? ? A . n A 1 204 VAL 204 343 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 C2E 1 401 401 C2E C2E A . C 3 HOH 1 501 15 HOH HOH A . C 3 HOH 2 502 5 HOH HOH A . C 3 HOH 3 503 1 HOH HOH A . C 3 HOH 4 504 13 HOH HOH A . C 3 HOH 5 505 16 HOH HOH A . C 3 HOH 6 506 9 HOH HOH A . C 3 HOH 7 507 8 HOH HOH A . C 3 HOH 8 508 2 HOH HOH A . C 3 HOH 9 509 3 HOH HOH A . C 3 HOH 10 510 7 HOH HOH A . C 3 HOH 11 511 6 HOH HOH A . C 3 HOH 12 512 4 HOH HOH A . C 3 HOH 13 513 11 HOH HOH A . C 3 HOH 14 514 10 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 5440 ? 1 MORE -8 ? 1 'SSA (A^2)' 15260 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 7_556 y,x,-z+1 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 34.3310000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 512 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id C _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-06-19 2 'Structure model' 1 1 2019-08-14 3 'Structure model' 1 2 2019-09-11 4 'Structure model' 1 3 2023-02-15 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 4 'Structure model' repository Obsolete ? ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 4 'Structure model' Advisory 5 4 'Structure model' 'Database references' 6 4 'Structure model' Other 7 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' reflns 2 3 'Structure model' citation 3 3 'Structure model' citation_author 4 3 'Structure model' reflns_shell 5 4 'Structure model' chem_comp 6 4 'Structure model' database_2 7 4 'Structure model' pdbx_database_PDB_obs_spr 8 4 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_reflns.pdbx_Rmerge_I_obs' 2 2 'Structure model' '_reflns.pdbx_Rrim_I_all' 3 3 'Structure model' '_citation.country' 4 3 'Structure model' '_citation.journal_abbrev' 5 3 'Structure model' '_citation.journal_id_ASTM' 6 3 'Structure model' '_citation.journal_id_CSD' 7 3 'Structure model' '_citation.journal_id_ISSN' 8 3 'Structure model' '_citation.journal_volume' 9 3 'Structure model' '_citation.page_first' 10 3 'Structure model' '_citation.page_last' 11 3 'Structure model' '_citation.pdbx_database_id_DOI' 12 3 'Structure model' '_citation.pdbx_database_id_PubMed' 13 3 'Structure model' '_citation.title' 14 3 'Structure model' '_citation.year' 15 3 'Structure model' '_citation_author.name' 16 3 'Structure model' '_reflns_shell.d_res_high' 17 3 'Structure model' '_reflns_shell.d_res_low' 18 4 'Structure model' '_chem_comp.pdbx_synonyms' 19 4 'Structure model' '_database_2.pdbx_DOI' 20 4 'Structure model' '_database_2.pdbx_database_accession' 21 4 'Structure model' '_pdbx_database_status.status_code' 22 4 'Structure model' '_pdbx_database_status.status_code_sf' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.14_3260 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 5 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HH A TYR 164 ? ? OE1 A GLU 304 ? ? 1.59 2 1 H A GLN 276 ? ? O A HOH 506 ? ? 1.60 3 1 HH22 A ARG 232 ? ? O A HOH 505 ? ? 1.60 4 1 OH A TYR 164 ? ? OE1 A GLU 304 ? ? 1.85 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 HH11 A ARG 232 ? ? 1_555 OE1 A GLN 266 ? ? 7_556 1.51 2 1 NH1 A ARG 232 ? ? 1_555 OE1 A GLN 266 ? ? 7_556 2.12 # _pdbx_validate_rmsd_bond.id 1 _pdbx_validate_rmsd_bond.PDB_model_num 1 _pdbx_validate_rmsd_bond.auth_atom_id_1 C _pdbx_validate_rmsd_bond.auth_asym_id_1 A _pdbx_validate_rmsd_bond.auth_comp_id_1 CYS _pdbx_validate_rmsd_bond.auth_seq_id_1 309 _pdbx_validate_rmsd_bond.PDB_ins_code_1 ? _pdbx_validate_rmsd_bond.label_alt_id_1 ? _pdbx_validate_rmsd_bond.auth_atom_id_2 N _pdbx_validate_rmsd_bond.auth_asym_id_2 A _pdbx_validate_rmsd_bond.auth_comp_id_2 ARG _pdbx_validate_rmsd_bond.auth_seq_id_2 310 _pdbx_validate_rmsd_bond.PDB_ins_code_2 ? _pdbx_validate_rmsd_bond.label_alt_id_2 ? _pdbx_validate_rmsd_bond.bond_value 1.059 _pdbx_validate_rmsd_bond.bond_target_value 1.336 _pdbx_validate_rmsd_bond.bond_deviation -0.277 _pdbx_validate_rmsd_bond.bond_standard_deviation 0.023 _pdbx_validate_rmsd_bond.linker_flag Y # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CA A LEU 212 ? ? CB A LEU 212 ? ? CG A LEU 212 ? ? 130.90 115.30 15.60 2.30 N 2 1 CB A LEU 212 ? ? CG A LEU 212 ? ? CD2 A LEU 212 ? ? 97.66 111.00 -13.34 1.70 N 3 1 CA A ARG 310 ? ? C A ARG 310 ? ? N A LEU 311 ? ? 133.74 117.20 16.54 2.20 Y 4 1 O A ARG 310 ? ? C A ARG 310 ? ? N A LEU 311 ? ? 108.57 122.70 -14.13 1.60 Y 5 1 CA A LEU 333 ? ? CB A LEU 333 ? ? CG A LEU 333 ? ? 132.79 115.30 17.49 2.30 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 TYR A 167 ? ? -127.44 -62.15 2 1 GLN A 227 ? ? -49.57 150.62 # _pdbx_validate_polymer_linkage.id 1 _pdbx_validate_polymer_linkage.PDB_model_num 1 _pdbx_validate_polymer_linkage.auth_atom_id_1 C _pdbx_validate_polymer_linkage.auth_asym_id_1 A _pdbx_validate_polymer_linkage.auth_comp_id_1 CYS _pdbx_validate_polymer_linkage.auth_seq_id_1 309 _pdbx_validate_polymer_linkage.PDB_ins_code_1 ? _pdbx_validate_polymer_linkage.label_alt_id_1 ? _pdbx_validate_polymer_linkage.auth_atom_id_2 N _pdbx_validate_polymer_linkage.auth_asym_id_2 A _pdbx_validate_polymer_linkage.auth_comp_id_2 ARG _pdbx_validate_polymer_linkage.auth_seq_id_2 310 _pdbx_validate_polymer_linkage.PDB_ins_code_2 ? _pdbx_validate_polymer_linkage.label_alt_id_2 ? _pdbx_validate_polymer_linkage.dist 1.06 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A TYR 186 ? CG ? A TYR 47 CG 2 1 Y 1 A TYR 186 ? CD1 ? A TYR 47 CD1 3 1 Y 1 A TYR 186 ? CD2 ? A TYR 47 CD2 4 1 Y 1 A TYR 186 ? CE1 ? A TYR 47 CE1 5 1 Y 1 A TYR 186 ? CE2 ? A TYR 47 CE2 6 1 Y 1 A TYR 186 ? CZ ? A TYR 47 CZ 7 1 Y 1 A TYR 186 ? OH ? A TYR 47 OH 8 1 Y 1 A ARG 220 ? CG ? A ARG 81 CG 9 1 Y 1 A ARG 220 ? CD ? A ARG 81 CD 10 1 Y 1 A ARG 220 ? NE ? A ARG 81 NE 11 1 Y 1 A ARG 220 ? CZ ? A ARG 81 CZ 12 1 Y 1 A ARG 220 ? NH1 ? A ARG 81 NH1 13 1 Y 1 A ARG 220 ? NH2 ? A ARG 81 NH2 14 1 Y 1 A LYS 236 ? CD ? A LYS 97 CD 15 1 Y 1 A LYS 236 ? CE ? A LYS 97 CE 16 1 Y 1 A LYS 236 ? NZ ? A LYS 97 NZ 17 1 Y 1 A ARG 281 ? CG ? A ARG 142 CG 18 1 Y 1 A ARG 281 ? CD ? A ARG 142 CD 19 1 Y 1 A ARG 281 ? NE ? A ARG 142 NE 20 1 Y 1 A ARG 281 ? CZ ? A ARG 142 CZ 21 1 Y 1 A ARG 281 ? NH1 ? A ARG 142 NH1 22 1 Y 1 A ARG 281 ? NH2 ? A ARG 142 NH2 23 1 Y 1 A LYS 289 ? CG ? A LYS 150 CG 24 1 Y 1 A LYS 289 ? CD ? A LYS 150 CD 25 1 Y 1 A LYS 289 ? CE ? A LYS 150 CE 26 1 Y 1 A LYS 289 ? NZ ? A LYS 150 NZ 27 1 Y 1 A SER 324 ? OG ? A SER 185 OG # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ALA 140 ? A ALA 1 2 1 Y 1 A PRO 141 ? A PRO 2 3 1 Y 1 A ALA 142 ? A ALA 3 4 1 Y 1 A GLU 143 ? A GLU 4 5 1 Y 1 A ILE 144 ? A ILE 5 6 1 Y 1 A SER 145 ? A SER 6 7 1 Y 1 A ALA 146 ? A ALA 7 8 1 Y 1 A VAL 147 ? A VAL 8 9 1 Y 1 A CYS 148 ? A CYS 9 10 1 Y 1 A GLU 149 ? A GLU 10 11 1 Y 1 A LYS 150 ? A LYS 11 12 1 Y 1 A GLY 151 ? A GLY 12 13 1 Y 1 A ASN 152 ? A ASN 13 14 1 Y 1 A PHE 153 ? A PHE 14 15 1 Y 1 A ASN 188 ? A ASN 49 16 1 Y 1 A LEU 189 ? A LEU 50 17 1 Y 1 A LEU 190 ? A LEU 51 18 1 Y 1 A ARG 191 ? A ARG 52 19 1 Y 1 A GLY 192 ? A GLY 53 20 1 Y 1 A ALA 318 ? A ALA 179 21 1 Y 1 A ASP 319 ? A ASP 180 22 1 Y 1 A ASP 320 ? A ASP 181 23 1 Y 1 A SER 321 ? A SER 182 24 1 Y 1 A SER 322 ? A SER 183 25 1 Y 1 A GLU 337 ? A GLU 198 26 1 Y 1 A LYS 338 ? A LYS 199 27 1 Y 1 A GLU 339 ? A GLU 200 28 1 Y 1 A GLU 340 ? A GLU 201 29 1 Y 1 A VAL 341 ? A VAL 202 30 1 Y 1 A THR 342 ? A THR 203 31 1 Y 1 A VAL 343 ? A VAL 204 # _pdbx_audit_support.funding_organization 'European Regional Development Fund' _pdbx_audit_support.country 'Czech Republic' _pdbx_audit_support.grant_number CZ.02.1.01/0.0/0.0/16_019/0000729 _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id C2E _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id C2E _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 ;9,9'-[(2R,3R,3aS,5S,7aR,9R,10R,10aS,12S,14aR)-3,5,10,12-tetrahydroxy-5,12-dioxidooctahydro-2H,7H-difuro[3,2-d:3',2'-j][1,3,7,9,2,8]tetraoxadiphosphacyclododecine-2,9-diyl]bis(2-amino-1,9-dihydro-6H-purin-6-one) ; C2E 3 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #