data_6ROZ
# 
_entry.id   6ROZ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.397 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   6ROZ         pdb_00006roz 10.2210/pdb6roz/pdb 
WWPDB D_1292102330 ?            ?                   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2020-02-19 
2 'Structure model' 1 1 2020-02-26 
3 'Structure model' 1 2 2024-01-24 
4 'Structure model' 1 3 2024-10-23 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'    
2 3 'Structure model' 'Data collection'        
3 3 'Structure model' 'Database references'    
4 3 'Structure model' 'Refinement description' 
5 4 'Structure model' 'Structure summary'      
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation                      
2 2 'Structure model' citation_author               
3 3 'Structure model' chem_comp_atom                
4 3 'Structure model' chem_comp_bond                
5 3 'Structure model' database_2                    
6 3 'Structure model' pdbx_initial_refinement_model 
7 3 'Structure model' struct_ncs_dom_lim            
8 4 'Structure model' pdbx_entry_details            
9 4 'Structure model' pdbx_modification_feature     
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  2 'Structure model' '_citation.journal_volume'              
2  2 'Structure model' '_citation.page_first'                  
3  2 'Structure model' '_citation.page_last'                   
4  2 'Structure model' '_citation.pdbx_database_id_PubMed'     
5  2 'Structure model' '_citation.title'                       
6  2 'Structure model' '_citation_author.identifier_ORCID'     
7  3 'Structure model' '_database_2.pdbx_DOI'                  
8  3 'Structure model' '_database_2.pdbx_database_accession'   
9  3 'Structure model' '_struct_ncs_dom_lim.beg_auth_comp_id'  
10 3 'Structure model' '_struct_ncs_dom_lim.beg_label_asym_id' 
11 3 'Structure model' '_struct_ncs_dom_lim.beg_label_comp_id' 
12 3 'Structure model' '_struct_ncs_dom_lim.beg_label_seq_id'  
13 3 'Structure model' '_struct_ncs_dom_lim.end_auth_comp_id'  
14 3 'Structure model' '_struct_ncs_dom_lim.end_label_asym_id' 
15 3 'Structure model' '_struct_ncs_dom_lim.end_label_comp_id' 
16 3 'Structure model' '_struct_ncs_dom_lim.end_label_seq_id'  
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6ROZ 
_pdbx_database_status.recvd_initial_deposition_date   2019-05-13 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Krausze, J.'    1 ? 
'Sikorska, J.'   2 ? 
'Carlomagno, T.' 3 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Sci Adv' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2375-2548 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            6 
_citation.language                  ? 
_citation.page_first                eaay4458 
_citation.page_last                 eaay4458 
_citation.title                     'Molecular mechanism of SHP2 activation by PD-1 stimulation.' 
_citation.year                      2020 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1126/sciadv.aay4458 
_citation.pdbx_database_id_PubMed   32064351 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Marasco, M.'       1  0000-0001-7082-9824 
primary 'Berteotti, A.'     2  ?                   
primary 'Weyershaeuser, J.' 3  0000-0001-8404-3339 
primary 'Thorausch, N.'     4  0000-0002-8042-6727 
primary 'Sikorska, J.'      5  0000-0002-3836-6708 
primary 'Krausze, J.'       6  0000-0001-5333-8046 
primary 'Brandt, H.J.'      7  0000-0002-4067-8591 
primary 'Kirkpatrick, J.'   8  0000-0002-9761-3377 
primary 'Rios, P.'          9  0000-0002-9979-5514 
primary 'Schamel, W.W.'     10 ?                   
primary 'Kohn, M.'          11 0000-0001-8142-3504 
primary 'Carlomagno, T.'    12 0000-0002-2437-2760 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Tyrosine-protein phosphatase non-receptor type 11'  11790.277 2 3.1.3.48 ? ? ?                                
2 polymer syn 'immune receptor tyrosine-based switch motif (ITSM)' 1377.387  2 ?        ? ? 'chemically synthesized peptide' 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Protein-tyrosine phosphatase 1D,PTP-1D,Protein-tyrosine phosphatase 2C,PTP-2C,SH-PTP2,Shp2,SH-PTP3' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no  
;MASRRWFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGDFTLSVRRNGAVTHIKIQNTGDYYDLYGGEKFATLAELVQY
YMEHHGQLKEKNGDVIELKYPLNC
;
;MASRRWFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGDFTLSVRRNGAVTHIKIQNTGDYYDLYGGEKFATLAELVQY
YMEHHGQLKEKNGDVIELKYPLNC
;
A,C ? 
2 'polypeptide(L)' no yes 'EQTE(PTR)ATIVFP' EQTEYATIVFP B,D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   SER n 
1 4   ARG n 
1 5   ARG n 
1 6   TRP n 
1 7   PHE n 
1 8   HIS n 
1 9   PRO n 
1 10  ASN n 
1 11  ILE n 
1 12  THR n 
1 13  GLY n 
1 14  VAL n 
1 15  GLU n 
1 16  ALA n 
1 17  GLU n 
1 18  ASN n 
1 19  LEU n 
1 20  LEU n 
1 21  LEU n 
1 22  THR n 
1 23  ARG n 
1 24  GLY n 
1 25  VAL n 
1 26  ASP n 
1 27  GLY n 
1 28  SER n 
1 29  PHE n 
1 30  LEU n 
1 31  ALA n 
1 32  ARG n 
1 33  PRO n 
1 34  SER n 
1 35  LYS n 
1 36  SER n 
1 37  ASN n 
1 38  PRO n 
1 39  GLY n 
1 40  ASP n 
1 41  PHE n 
1 42  THR n 
1 43  LEU n 
1 44  SER n 
1 45  VAL n 
1 46  ARG n 
1 47  ARG n 
1 48  ASN n 
1 49  GLY n 
1 50  ALA n 
1 51  VAL n 
1 52  THR n 
1 53  HIS n 
1 54  ILE n 
1 55  LYS n 
1 56  ILE n 
1 57  GLN n 
1 58  ASN n 
1 59  THR n 
1 60  GLY n 
1 61  ASP n 
1 62  TYR n 
1 63  TYR n 
1 64  ASP n 
1 65  LEU n 
1 66  TYR n 
1 67  GLY n 
1 68  GLY n 
1 69  GLU n 
1 70  LYS n 
1 71  PHE n 
1 72  ALA n 
1 73  THR n 
1 74  LEU n 
1 75  ALA n 
1 76  GLU n 
1 77  LEU n 
1 78  VAL n 
1 79  GLN n 
1 80  TYR n 
1 81  TYR n 
1 82  MET n 
1 83  GLU n 
1 84  HIS n 
1 85  HIS n 
1 86  GLY n 
1 87  GLN n 
1 88  LEU n 
1 89  LYS n 
1 90  GLU n 
1 91  LYS n 
1 92  ASN n 
1 93  GLY n 
1 94  ASP n 
1 95  VAL n 
1 96  ILE n 
1 97  GLU n 
1 98  LEU n 
1 99  LYS n 
1 100 TYR n 
1 101 PRO n 
1 102 LEU n 
1 103 ASN n 
1 104 CYS n 
2 1   GLU n 
2 2   GLN n 
2 3   THR n 
2 4   GLU n 
2 5   PTR n 
2 6   ALA n 
2 7   THR n 
2 8   ILE n 
2 9   VAL n 
2 10  PHE n 
2 11  PRO n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   104 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'PTPN11, PTP2C, SHPTP2' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pEMT22 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       1 
_pdbx_entity_src_syn.pdbx_end_seq_num       11 
_pdbx_entity_src_syn.organism_scientific    'synthetic construct' 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       32630 
_pdbx_entity_src_syn.details                ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE           ?                 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE          ?                 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE        ?                 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'   ?                 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE          ?                 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE         ?                 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'   ?                 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE           ?                 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE         ?                 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE        ?                 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE           ?                 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE            ?                 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE        ?                 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE     ?                 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE           ?                 'C5 H9 N O2'     115.130 
PTR 'L-peptide linking' n O-PHOSPHOTYROSINE PHOSPHONOTYROSINE 'C9 H12 N O6 P'  261.168 
SER 'L-peptide linking' y SERINE            ?                 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE         ?                 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN        ?                 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE          ?                 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE            ?                 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   ALA 2   2   ?   ?   ?   A . n 
A 1 3   SER 3   3   3   SER SER A . n 
A 1 4   ARG 4   4   4   ARG ARG A . n 
A 1 5   ARG 5   5   5   ARG ARG A . n 
A 1 6   TRP 6   6   6   TRP TRP A . n 
A 1 7   PHE 7   7   7   PHE PHE A . n 
A 1 8   HIS 8   8   8   HIS HIS A . n 
A 1 9   PRO 9   9   9   PRO PRO A . n 
A 1 10  ASN 10  10  10  ASN ASN A . n 
A 1 11  ILE 11  11  11  ILE ILE A . n 
A 1 12  THR 12  12  12  THR THR A . n 
A 1 13  GLY 13  13  13  GLY GLY A . n 
A 1 14  VAL 14  14  14  VAL VAL A . n 
A 1 15  GLU 15  15  15  GLU GLU A . n 
A 1 16  ALA 16  16  16  ALA ALA A . n 
A 1 17  GLU 17  17  17  GLU GLU A . n 
A 1 18  ASN 18  18  18  ASN ASN A . n 
A 1 19  LEU 19  19  19  LEU LEU A . n 
A 1 20  LEU 20  20  20  LEU LEU A . n 
A 1 21  LEU 21  21  21  LEU LEU A . n 
A 1 22  THR 22  22  22  THR THR A . n 
A 1 23  ARG 23  23  23  ARG ARG A . n 
A 1 24  GLY 24  24  24  GLY GLY A . n 
A 1 25  VAL 25  25  25  VAL VAL A . n 
A 1 26  ASP 26  26  26  ASP ASP A . n 
A 1 27  GLY 27  27  27  GLY GLY A . n 
A 1 28  SER 28  28  28  SER SER A . n 
A 1 29  PHE 29  29  29  PHE PHE A . n 
A 1 30  LEU 30  30  30  LEU LEU A . n 
A 1 31  ALA 31  31  31  ALA ALA A . n 
A 1 32  ARG 32  32  32  ARG ARG A . n 
A 1 33  PRO 33  33  33  PRO PRO A . n 
A 1 34  SER 34  34  34  SER SER A . n 
A 1 35  LYS 35  35  35  LYS LYS A . n 
A 1 36  SER 36  36  36  SER SER A . n 
A 1 37  ASN 37  37  37  ASN ASN A . n 
A 1 38  PRO 38  38  38  PRO PRO A . n 
A 1 39  GLY 39  39  39  GLY GLY A . n 
A 1 40  ASP 40  40  40  ASP ASP A . n 
A 1 41  PHE 41  41  41  PHE PHE A . n 
A 1 42  THR 42  42  42  THR THR A . n 
A 1 43  LEU 43  43  43  LEU LEU A . n 
A 1 44  SER 44  44  44  SER SER A . n 
A 1 45  VAL 45  45  45  VAL VAL A . n 
A 1 46  ARG 46  46  46  ARG ARG A . n 
A 1 47  ARG 47  47  47  ARG ARG A . n 
A 1 48  ASN 48  48  48  ASN ASN A . n 
A 1 49  GLY 49  49  49  GLY GLY A . n 
A 1 50  ALA 50  50  50  ALA ALA A . n 
A 1 51  VAL 51  51  51  VAL VAL A . n 
A 1 52  THR 52  52  52  THR THR A . n 
A 1 53  HIS 53  53  53  HIS HIS A . n 
A 1 54  ILE 54  54  54  ILE ILE A . n 
A 1 55  LYS 55  55  55  LYS LYS A . n 
A 1 56  ILE 56  56  56  ILE ILE A . n 
A 1 57  GLN 57  57  57  GLN GLN A . n 
A 1 58  ASN 58  58  58  ASN ASN A . n 
A 1 59  THR 59  59  59  THR THR A . n 
A 1 60  GLY 60  60  60  GLY GLY A . n 
A 1 61  ASP 61  61  61  ASP ASP A . n 
A 1 62  TYR 62  62  62  TYR TYR A . n 
A 1 63  TYR 63  63  63  TYR TYR A . n 
A 1 64  ASP 64  64  64  ASP ASP A . n 
A 1 65  LEU 65  65  65  LEU LEU A . n 
A 1 66  TYR 66  66  66  TYR TYR A . n 
A 1 67  GLY 67  67  67  GLY GLY A . n 
A 1 68  GLY 68  68  68  GLY GLY A . n 
A 1 69  GLU 69  69  69  GLU GLU A . n 
A 1 70  LYS 70  70  70  LYS LYS A . n 
A 1 71  PHE 71  71  71  PHE PHE A . n 
A 1 72  ALA 72  72  72  ALA ALA A . n 
A 1 73  THR 73  73  73  THR THR A . n 
A 1 74  LEU 74  74  74  LEU LEU A . n 
A 1 75  ALA 75  75  75  ALA ALA A . n 
A 1 76  GLU 76  76  76  GLU GLU A . n 
A 1 77  LEU 77  77  77  LEU LEU A . n 
A 1 78  VAL 78  78  78  VAL VAL A . n 
A 1 79  GLN 79  79  79  GLN GLN A . n 
A 1 80  TYR 80  80  80  TYR TYR A . n 
A 1 81  TYR 81  81  81  TYR TYR A . n 
A 1 82  MET 82  82  82  MET MET A . n 
A 1 83  GLU 83  83  83  GLU GLU A . n 
A 1 84  HIS 84  84  84  HIS HIS A . n 
A 1 85  HIS 85  85  85  HIS HIS A . n 
A 1 86  GLY 86  86  86  GLY GLY A . n 
A 1 87  GLN 87  87  87  GLN GLN A . n 
A 1 88  LEU 88  88  88  LEU LEU A . n 
A 1 89  LYS 89  89  89  LYS LYS A . n 
A 1 90  GLU 90  90  90  GLU GLU A . n 
A 1 91  LYS 91  91  91  LYS LYS A . n 
A 1 92  ASN 92  92  92  ASN ASN A . n 
A 1 93  GLY 93  93  93  GLY GLY A . n 
A 1 94  ASP 94  94  94  ASP ASP A . n 
A 1 95  VAL 95  95  95  VAL VAL A . n 
A 1 96  ILE 96  96  96  ILE ILE A . n 
A 1 97  GLU 97  97  97  GLU GLU A . n 
A 1 98  LEU 98  98  98  LEU LEU A . n 
A 1 99  LYS 99  99  99  LYS LYS A . n 
A 1 100 TYR 100 100 100 TYR TYR A . n 
A 1 101 PRO 101 101 101 PRO PRO A . n 
A 1 102 LEU 102 102 102 LEU LEU A . n 
A 1 103 ASN 103 103 103 ASN ASN A . n 
A 1 104 CYS 104 104 104 CYS CYS A . n 
B 2 1   GLU 1   1   ?   ?   ?   B . n 
B 2 2   GLN 2   2   2   GLN GLN B . n 
B 2 3   THR 3   3   3   THR THR B . n 
B 2 4   GLU 4   4   4   GLU GLU B . n 
B 2 5   PTR 5   5   5   PTR PTR B . n 
B 2 6   ALA 6   6   6   ALA ALA B . n 
B 2 7   THR 7   7   7   THR THR B . n 
B 2 8   ILE 8   8   8   ILE ILE B . n 
B 2 9   VAL 9   9   9   VAL VAL B . n 
B 2 10  PHE 10  10  10  PHE PHE B . n 
B 2 11  PRO 11  11  11  PRO PRO B . n 
C 1 1   MET 1   1   ?   ?   ?   C . n 
C 1 2   ALA 2   2   ?   ?   ?   C . n 
C 1 3   SER 3   3   3   SER SER C . n 
C 1 4   ARG 4   4   4   ARG ARG C . n 
C 1 5   ARG 5   5   5   ARG ARG C . n 
C 1 6   TRP 6   6   6   TRP TRP C . n 
C 1 7   PHE 7   7   7   PHE PHE C . n 
C 1 8   HIS 8   8   8   HIS HIS C . n 
C 1 9   PRO 9   9   9   PRO PRO C . n 
C 1 10  ASN 10  10  10  ASN ASN C . n 
C 1 11  ILE 11  11  11  ILE ILE C . n 
C 1 12  THR 12  12  12  THR THR C . n 
C 1 13  GLY 13  13  13  GLY GLY C . n 
C 1 14  VAL 14  14  14  VAL VAL C . n 
C 1 15  GLU 15  15  15  GLU GLU C . n 
C 1 16  ALA 16  16  16  ALA ALA C . n 
C 1 17  GLU 17  17  17  GLU GLU C . n 
C 1 18  ASN 18  18  18  ASN ASN C . n 
C 1 19  LEU 19  19  19  LEU LEU C . n 
C 1 20  LEU 20  20  20  LEU LEU C . n 
C 1 21  LEU 21  21  21  LEU LEU C . n 
C 1 22  THR 22  22  22  THR THR C . n 
C 1 23  ARG 23  23  23  ARG ARG C . n 
C 1 24  GLY 24  24  24  GLY GLY C . n 
C 1 25  VAL 25  25  25  VAL VAL C . n 
C 1 26  ASP 26  26  26  ASP ASP C . n 
C 1 27  GLY 27  27  27  GLY GLY C . n 
C 1 28  SER 28  28  28  SER SER C . n 
C 1 29  PHE 29  29  29  PHE PHE C . n 
C 1 30  LEU 30  30  30  LEU LEU C . n 
C 1 31  ALA 31  31  31  ALA ALA C . n 
C 1 32  ARG 32  32  32  ARG ARG C . n 
C 1 33  PRO 33  33  33  PRO PRO C . n 
C 1 34  SER 34  34  34  SER SER C . n 
C 1 35  LYS 35  35  35  LYS LYS C . n 
C 1 36  SER 36  36  36  SER SER C . n 
C 1 37  ASN 37  37  37  ASN ASN C . n 
C 1 38  PRO 38  38  38  PRO PRO C . n 
C 1 39  GLY 39  39  39  GLY GLY C . n 
C 1 40  ASP 40  40  40  ASP ASP C . n 
C 1 41  PHE 41  41  41  PHE PHE C . n 
C 1 42  THR 42  42  42  THR THR C . n 
C 1 43  LEU 43  43  43  LEU LEU C . n 
C 1 44  SER 44  44  44  SER SER C . n 
C 1 45  VAL 45  45  45  VAL VAL C . n 
C 1 46  ARG 46  46  46  ARG ARG C . n 
C 1 47  ARG 47  47  47  ARG ARG C . n 
C 1 48  ASN 48  48  48  ASN ASN C . n 
C 1 49  GLY 49  49  49  GLY GLY C . n 
C 1 50  ALA 50  50  50  ALA ALA C . n 
C 1 51  VAL 51  51  51  VAL VAL C . n 
C 1 52  THR 52  52  52  THR THR C . n 
C 1 53  HIS 53  53  53  HIS HIS C . n 
C 1 54  ILE 54  54  54  ILE ILE C . n 
C 1 55  LYS 55  55  55  LYS LYS C . n 
C 1 56  ILE 56  56  56  ILE ILE C . n 
C 1 57  GLN 57  57  57  GLN GLN C . n 
C 1 58  ASN 58  58  58  ASN ASN C . n 
C 1 59  THR 59  59  59  THR THR C . n 
C 1 60  GLY 60  60  60  GLY GLY C . n 
C 1 61  ASP 61  61  61  ASP ASP C . n 
C 1 62  TYR 62  62  62  TYR TYR C . n 
C 1 63  TYR 63  63  63  TYR TYR C . n 
C 1 64  ASP 64  64  64  ASP ASP C . n 
C 1 65  LEU 65  65  65  LEU LEU C . n 
C 1 66  TYR 66  66  66  TYR TYR C . n 
C 1 67  GLY 67  67  67  GLY GLY C . n 
C 1 68  GLY 68  68  68  GLY GLY C . n 
C 1 69  GLU 69  69  69  GLU GLU C . n 
C 1 70  LYS 70  70  70  LYS LYS C . n 
C 1 71  PHE 71  71  71  PHE PHE C . n 
C 1 72  ALA 72  72  72  ALA ALA C . n 
C 1 73  THR 73  73  73  THR THR C . n 
C 1 74  LEU 74  74  74  LEU LEU C . n 
C 1 75  ALA 75  75  75  ALA ALA C . n 
C 1 76  GLU 76  76  76  GLU GLU C . n 
C 1 77  LEU 77  77  77  LEU LEU C . n 
C 1 78  VAL 78  78  78  VAL VAL C . n 
C 1 79  GLN 79  79  79  GLN GLN C . n 
C 1 80  TYR 80  80  80  TYR TYR C . n 
C 1 81  TYR 81  81  81  TYR TYR C . n 
C 1 82  MET 82  82  82  MET MET C . n 
C 1 83  GLU 83  83  83  GLU GLU C . n 
C 1 84  HIS 84  84  84  HIS HIS C . n 
C 1 85  HIS 85  85  85  HIS HIS C . n 
C 1 86  GLY 86  86  86  GLY GLY C . n 
C 1 87  GLN 87  87  87  GLN GLN C . n 
C 1 88  LEU 88  88  88  LEU LEU C . n 
C 1 89  LYS 89  89  89  LYS LYS C . n 
C 1 90  GLU 90  90  90  GLU GLU C . n 
C 1 91  LYS 91  91  91  LYS LYS C . n 
C 1 92  ASN 92  92  92  ASN ASN C . n 
C 1 93  GLY 93  93  93  GLY GLY C . n 
C 1 94  ASP 94  94  94  ASP ASP C . n 
C 1 95  VAL 95  95  95  VAL VAL C . n 
C 1 96  ILE 96  96  96  ILE ILE C . n 
C 1 97  GLU 97  97  97  GLU GLU C . n 
C 1 98  LEU 98  98  98  LEU LEU C . n 
C 1 99  LYS 99  99  99  LYS LYS C . n 
C 1 100 TYR 100 100 100 TYR TYR C . n 
C 1 101 PRO 101 101 101 PRO PRO C . n 
C 1 102 LEU 102 102 102 LEU LEU C . n 
C 1 103 ASN 103 103 103 ASN ASN C . n 
C 1 104 CYS 104 104 104 CYS CYS C . n 
D 2 1   GLU 1   1   ?   ?   ?   D . n 
D 2 2   GLN 2   2   2   GLN GLN D . n 
D 2 3   THR 3   3   3   THR THR D . n 
D 2 4   GLU 4   4   4   GLU GLU D . n 
D 2 5   PTR 5   5   5   PTR PTR D . n 
D 2 6   ALA 6   6   6   ALA ALA D . n 
D 2 7   THR 7   7   7   THR THR D . n 
D 2 8   ILE 8   8   8   ILE ILE D . n 
D 2 9   VAL 9   9   9   VAL VAL D . n 
D 2 10  PHE 10  10  10  PHE PHE D . n 
D 2 11  PRO 11  11  11  PRO PRO D . n 
# 
_pdbx_entity_instance_feature.ordinal        1 
_pdbx_entity_instance_feature.comp_id        PTR 
_pdbx_entity_instance_feature.asym_id        ? 
_pdbx_entity_instance_feature.seq_num        ? 
_pdbx_entity_instance_feature.auth_comp_id   PTR 
_pdbx_entity_instance_feature.auth_asym_id   ? 
_pdbx_entity_instance_feature.auth_seq_num   ? 
_pdbx_entity_instance_feature.feature_type   'SUBJECT OF INVESTIGATION' 
_pdbx_entity_instance_feature.details        ? 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? REFMAC  ? ? ? 5.8.0171 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS     ? ? ? .        2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? .        3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHASER  ? ? ? .        4 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6ROZ 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     30.035 
_cell.length_a_esd                 ? 
_cell.length_b                     30.035 
_cell.length_b_esd                 ? 
_cell.length_c                     213.113 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6ROZ 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                78 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 43' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6ROZ 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            1.85 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         34.30 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              7.1 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '31.7% (w/v) PEG 3350, 0.1 M HEPES, 0.233 M MgSO4' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      'TOROIDAL FOCUSING MIRRORS' 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 2M-F' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2016-02-22 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    'DOUBLE CRYSTAL SI(111)' 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.00002 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'SLS BEAMLINE X06DA' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.00002 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   X06DA 
_diffrn_source.pdbx_synchrotron_site       SLS 
# 
_reflns.B_iso_Wilson_estimate            61.79 
_reflns.entry_id                         6ROZ 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.89 
_reflns.d_resolution_low                 53.28 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       4283 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       -3 
_reflns.percent_possible_obs             100.0 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  13.8 
_reflns.pdbx_Rmerge_I_obs                0.182 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            10.4 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  0.074 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.998 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.89 
_reflns_shell.d_res_low                   3.07 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         2.0 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           713 
_reflns_shell.percent_possible_all        100.0 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                1.316 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             13.2 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             0.552 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                0.764 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            -0.32 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][2]                            -0.32 
_refine.aniso_B[2][3]                            0.00 
_refine.aniso_B[3][3]                            0.64 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               70.991 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               0.924 
_refine.correlation_coeff_Fo_to_Fc_free          0.914 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6ROZ 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.89 
_refine.ls_d_res_low                             53.28 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     3811 
_refine.ls_number_reflns_R_free                  418 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.98 
_refine.ls_percent_reflns_R_free                 9.9 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.24372 
_refine.ls_R_factor_R_free                       0.28462 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.23943 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      3tkz 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  0.587 
_refine.pdbx_solvent_vdw_probe_radii             1.10 
_refine.pdbx_solvent_ion_probe_radii             1.00 
_refine.pdbx_solvent_shrinkage_radii             1.00 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             67.134 
_refine.overall_SU_ML                            0.526 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.details                          ? 
_refine_hist.d_res_high                       2.89 
_refine_hist.d_res_low                        53.28 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               1808 
_refine_hist.number_reflns_all                ? 
_refine_hist.number_reflns_obs                ? 
_refine_hist.number_reflns_R_free             ? 
_refine_hist.number_reflns_R_work             ? 
_refine_hist.R_factor_all                     ? 
_refine_hist.R_factor_obs                     ? 
_refine_hist.R_factor_R_free                  ? 
_refine_hist.R_factor_R_work                  ? 
_refine_hist.pdbx_number_residues_total       ? 
_refine_hist.pdbx_B_iso_mean_ligand           ? 
_refine_hist.pdbx_B_iso_mean_solvent          ? 
_refine_hist.pdbx_number_atoms_protein        1808 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.pdbx_number_atoms_lipid          ? 
_refine_hist.pdbx_number_atoms_carb           ? 
_refine_hist.pdbx_pseudo_atom_details         ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.008  0.019  1850 ? r_bond_refined_d             ? ? 
'X-RAY DIFFRACTION' ? 0.004  0.020  1660 ? r_bond_other_d               ? ? 
'X-RAY DIFFRACTION' ? 1.252  1.969  2508 ? r_angle_refined_deg          ? ? 
'X-RAY DIFFRACTION' ? 0.978  3.000  3850 ? r_angle_other_deg            ? ? 
'X-RAY DIFFRACTION' ? 6.127  5.000  220  ? r_dihedral_angle_1_deg       ? ? 
'X-RAY DIFFRACTION' ? 35.873 23.913 92   ? r_dihedral_angle_2_deg       ? ? 
'X-RAY DIFFRACTION' ? 16.305 15.000 300  ? r_dihedral_angle_3_deg       ? ? 
'X-RAY DIFFRACTION' ? 23.298 15.000 12   ? r_dihedral_angle_4_deg       ? ? 
'X-RAY DIFFRACTION' ? 0.073  0.200  266  ? r_chiral_restr               ? ? 
'X-RAY DIFFRACTION' ? 0.004  0.021  2060 ? r_gen_planes_refined         ? ? 
'X-RAY DIFFRACTION' ? 0.002  0.020  392  ? r_gen_planes_other           ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_nbd_refined                ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_nbd_other                  ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_nbtor_refined              ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_nbtor_other                ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_xyhbond_nbd_refined        ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_xyhbond_nbd_other          ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_metal_ion_refined          ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_metal_ion_other            ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_vdw_refined       ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_vdw_other         ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_hbond_refined     ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_hbond_other       ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_metal_ion_refined ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_metal_ion_other   ? ? 
'X-RAY DIFFRACTION' ? 0.125  3.708  892  ? r_mcbond_it                  ? ? 
'X-RAY DIFFRACTION' ? 0.126  3.709  891  ? r_mcbond_other               ? ? 
'X-RAY DIFFRACTION' ? 0.236  5.561  1108 ? r_mcangle_it                 ? ? 
'X-RAY DIFFRACTION' ? 0.236  5.561  1109 ? r_mcangle_other              ? ? 
'X-RAY DIFFRACTION' ? 0.063  3.727  958  ? r_scbond_it                  ? ? 
'X-RAY DIFFRACTION' ? 0.063  3.727  959  ? r_scbond_other               ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_scangle_it                 ? ? 
'X-RAY DIFFRACTION' ? 0.130  5.591  1401 ? r_scangle_other              ? ? 
'X-RAY DIFFRACTION' ? 1.041  69.839 7083 ? r_long_range_B_refined       ? ? 
'X-RAY DIFFRACTION' ? 1.041  69.834 7082 ? r_long_range_B_other         ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_rigid_bond_restr           ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_sphericity_free            ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_sphericity_bonded          ? ? 
# 
loop_
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_B_iso 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_asym_id 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.pdbx_rms 
_refine_ls_restr_ncs.pdbx_weight 
_refine_ls_restr_ncs.pdbx_ens_id 
'X-RAY DIFFRACTION' 1 ? ? 0.11 ? 0.05 1 'interatomic distance' ? A 6222 ? ? 1 
'X-RAY DIFFRACTION' 2 ? ? 0.11 ? 0.05 2 'interatomic distance' ? C 6222 ? ? 1 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       2.890 
_refine_ls_shell.d_res_low                        2.965 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             23 
_refine_ls_shell.number_reflns_R_work             308 
_refine_ls_shell.percent_reflns_obs               100.00 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free                  0.398 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.R_factor_R_work                  0.381 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.pdbx_phase_error                 ? 
_refine_ls_shell.pdbx_fsc_work                    ? 
_refine_ls_shell.pdbx_fsc_free                    ? 
# 
loop_
_struct_ncs_dom.id 
_struct_ncs_dom.details 
_struct_ncs_dom.pdbx_ens_id 
1 A 1 
2 C 1 
# 
loop_
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_comp_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_comp_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.selection_details 
1 1 0 A SER 3 . A CYS 104 . A SER 3 A CYS 104 0 ? 
1 2 0 C SER 3 . C CYS 104 . C SER 3 C CYS 104 0 ? 
# 
_struct_ncs_ens.details       'A, C' 
_struct_ncs_ens.id            1 
_struct_ncs_ens.point_group   ? 
# 
_struct.entry_id                     6ROZ 
_struct.title                        
;Structure of the N-SH2 domain of the human tyrosine-protein phosphatase non-receptor type 11 in complex with the phosphorylated immune receptor tyrosine-based switch motif
;
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6ROZ 
_struct_keywords.text            
;Phosphatase, inhibitory peptide, signal transducer, Src homology-2 domains, CELL CYCLE, ITSM, immune receptor tyrosine-based switch motif
;
_struct_keywords.pdbx_keywords   'CELL CYCLE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP PTN11_HUMAN Q06124 Q06124-3 1 
;SRRWFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGDFTLSVRRNGAVTHIKIQNTGDYYDLYGGEKFATLAELVQYYM
EHHGQLKEKNGDVIELKYPLNC
;
3 
2 PDB 6ROZ        6ROZ   ?        2 ? 1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6ROZ A 3 ? 104 ? Q06124 3 ? 104 ? 3 104 
2 2 6ROZ B 1 ? 11  ? 6ROZ   1 ? 11  ? 1 11  
3 1 6ROZ C 3 ? 104 ? Q06124 3 ? 104 ? 3 104 
4 2 6ROZ D 1 ? 11  ? 6ROZ   1 ? 11  ? 1 11  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6ROZ MET A 1 ? UNP Q06124 ? ? 'initiating methionine' 1 1 
1 6ROZ ALA A 2 ? UNP Q06124 ? ? 'expression tag'        2 2 
3 6ROZ MET C 1 ? UNP Q06124 ? ? 'initiating methionine' 1 3 
3 6ROZ ALA C 2 ? UNP Q06124 ? ? 'expression tag'        2 4 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA dimeric 2 
2 author_and_software_defined_assembly PISA dimeric 2 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1230 ? 
1 MORE         -12  ? 
1 'SSA (A^2)'  6170 ? 
2 'ABSA (A^2)' 1260 ? 
2 MORE         -14  ? 
2 'SSA (A^2)'  6190 ? 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B 
2 1 C,D 
# 
loop_
_pdbx_struct_assembly_auth_evidence.id 
_pdbx_struct_assembly_auth_evidence.assembly_id 
_pdbx_struct_assembly_auth_evidence.experimental_support 
_pdbx_struct_assembly_auth_evidence.details 
1 1 'gel filtration' ? 
2 2 'gel filtration' ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 THR A 12 ? GLY A 24 ? THR A 12 GLY A 24 1 ? 13 
HELX_P HELX_P2 AA2 THR A 73 ? HIS A 84 ? THR A 73 HIS A 84 1 ? 12 
HELX_P HELX_P3 AA3 HIS A 85 ? LEU A 88 ? HIS A 85 LEU A 88 5 ? 4  
HELX_P HELX_P4 AA4 THR C 12 ? GLY C 24 ? THR C 12 GLY C 24 1 ? 13 
HELX_P HELX_P5 AA5 THR C 73 ? HIS C 84 ? THR C 73 HIS C 84 1 ? 12 
HELX_P HELX_P6 AA6 HIS C 85 ? LEU C 88 ? HIS C 85 LEU C 88 5 ? 4  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
covale1 covale both ? B GLU 4 C ? ? ? 1_555 B PTR 5 N ? ? B GLU 4 B PTR 5 1_555 ? ? ? ? ? ? ? 1.329 ? ? 
covale2 covale both ? B PTR 5 C ? ? ? 1_555 B ALA 6 N ? ? B PTR 5 B ALA 6 1_555 ? ? ? ? ? ? ? 1.333 ? ? 
covale3 covale both ? D GLU 4 C ? ? ? 1_555 D PTR 5 N ? ? D GLU 4 D PTR 5 1_555 ? ? ? ? ? ? ? 1.328 ? ? 
covale4 covale both ? D PTR 5 C ? ? ? 1_555 D ALA 6 N ? ? D PTR 5 D ALA 6 1_555 ? ? ? ? ? ? ? 1.331 ? ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_pdbx_modification_feature.ordinal 
_pdbx_modification_feature.label_comp_id 
_pdbx_modification_feature.label_asym_id 
_pdbx_modification_feature.label_seq_id 
_pdbx_modification_feature.label_alt_id 
_pdbx_modification_feature.modified_residue_label_comp_id 
_pdbx_modification_feature.modified_residue_label_asym_id 
_pdbx_modification_feature.modified_residue_label_seq_id 
_pdbx_modification_feature.modified_residue_label_alt_id 
_pdbx_modification_feature.auth_comp_id 
_pdbx_modification_feature.auth_asym_id 
_pdbx_modification_feature.auth_seq_id 
_pdbx_modification_feature.PDB_ins_code 
_pdbx_modification_feature.symmetry 
_pdbx_modification_feature.modified_residue_auth_comp_id 
_pdbx_modification_feature.modified_residue_auth_asym_id 
_pdbx_modification_feature.modified_residue_auth_seq_id 
_pdbx_modification_feature.modified_residue_PDB_ins_code 
_pdbx_modification_feature.modified_residue_symmetry 
_pdbx_modification_feature.comp_id_linking_atom 
_pdbx_modification_feature.modified_residue_id_linking_atom 
_pdbx_modification_feature.modified_residue_id 
_pdbx_modification_feature.ref_pcm_id 
_pdbx_modification_feature.ref_comp_id 
_pdbx_modification_feature.type 
_pdbx_modification_feature.category 
1 PTR B 5 ? . . . . PTR B 5 ? 1_555 . . . . . . . TYR 1 PTR Phosphorylation 'Named protein modification' 
2 PTR D 5 ? . . . . PTR D 5 ? 1_555 . . . . . . . TYR 1 PTR Phosphorylation 'Named protein modification' 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 5 ? 
AA2 ? 2 ? 
AA3 ? 5 ? 
AA4 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? parallel      
AA2 1 2 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
AA3 4 5 ? parallel      
AA4 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 TYR A 63  ? ASP A 64  ? TYR A 63  ASP A 64  
AA1 2 ALA A 50  ? ASN A 58  ? ALA A 50  ASN A 58  
AA1 3 PHE A 41  ? ARG A 47  ? PHE A 41  ARG A 47  
AA1 4 SER A 28  ? ARG A 32  ? SER A 28  ARG A 32  
AA1 5 TYR A 100 ? PRO A 101 ? TYR A 100 PRO A 101 
AA2 1 LYS A 89  ? GLU A 90  ? LYS A 89  GLU A 90  
AA2 2 ILE B 8   ? VAL B 9   ? ILE B 8   VAL B 9   
AA3 1 TYR C 63  ? ASP C 64  ? TYR C 63  ASP C 64  
AA3 2 ALA C 50  ? ASN C 58  ? ALA C 50  ASN C 58  
AA3 3 PHE C 41  ? ARG C 47  ? PHE C 41  ARG C 47  
AA3 4 SER C 28  ? ARG C 32  ? SER C 28  ARG C 32  
AA3 5 TYR C 100 ? PRO C 101 ? TYR C 100 PRO C 101 
AA4 1 LYS C 89  ? GLU C 90  ? LYS C 89  GLU C 90  
AA4 2 ILE D 8   ? VAL D 9   ? ILE D 8   VAL D 9   
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O ASP A 64 ? O ASP A 64 N GLN A 57  ? N GLN A 57  
AA1 2 3 O ILE A 54 ? O ILE A 54 N LEU A 43  ? N LEU A 43  
AA1 3 4 O ARG A 46 ? O ARG A 46 N SER A 28  ? N SER A 28  
AA1 4 5 N PHE A 29 ? N PHE A 29 O TYR A 100 ? O TYR A 100 
AA2 1 2 N LYS A 89 ? N LYS A 89 O VAL B 9   ? O VAL B 9   
AA3 1 2 O ASP C 64 ? O ASP C 64 N GLN C 57  ? N GLN C 57  
AA3 2 3 O ILE C 54 ? O ILE C 54 N LEU C 43  ? N LEU C 43  
AA3 3 4 O ARG C 46 ? O ARG C 46 N SER C 28  ? N SER C 28  
AA3 4 5 N PHE C 29 ? N PHE C 29 O TYR C 100 ? O TYR C 100 
AA4 1 2 N LYS C 89 ? N LYS C 89 O VAL D 9   ? O VAL D 9   
# 
_pdbx_entry_details.entry_id                   6ROZ 
_pdbx_entry_details.compound_details           ? 
_pdbx_entry_details.source_details             ? 
_pdbx_entry_details.nonpolymer_details         ? 
_pdbx_entry_details.sequence_details           ? 
_pdbx_entry_details.has_ligand_of_interest     ? 
_pdbx_entry_details.has_protein_modification   Y 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   OH 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   TYR 
_pdbx_validate_close_contact.auth_seq_id_1    80 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   OE1 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   GLN 
_pdbx_validate_close_contact.auth_seq_id_2    87 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.19 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ARG A 4  ? ? 36.20   51.52  
2 1 SER A 34 ? ? 76.37   115.89 
3 1 LEU A 65 ? ? -107.82 41.04  
4 1 ARG C 4  ? ? 33.77   54.55  
5 1 SER C 34 ? ? 75.85   115.19 
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[1][1]_esd 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][2]_esd 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[1][3]_esd 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[2][2]_esd 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.T[2][3]_esd 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[3][3]_esd 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[1][1]_esd 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][2]_esd 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[1][3]_esd 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[2][2]_esd 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.L[2][3]_esd 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[3][3]_esd 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][1]_esd 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][2]_esd 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[1][3]_esd 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][1]_esd 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][2]_esd 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][3]_esd 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][1]_esd 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][2]_esd 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[3][3]_esd 
1 'X-RAY DIFFRACTION' ? refined 41.1900 -16.1300 21.1820 0.1629 ? 0.1605  ? -0.0129 ? 0.3384 ? -0.0259 ? 0.0219 ? 10.9460 ? 0.1989 
? -1.4303 ? 4.5686  ? -0.8787 ? 8.5362  ? -0.4982 ? -0.7772 ? 0.3225  ? 0.2828  ? 0.2531 ? 0.0733  ? 0.0198  ? 0.1431  ? 0.2451  ? 
2 'X-RAY DIFFRACTION' ? refined 48.3130 -23.9340 17.5620 0.1822 ? 0.1749  ? -0.0838 ? 0.4059 ? -0.0214 ? 0.2313 ? 10.6792 ? 5.3609 
? -8.1714 ? 9.2143  ? -8.9171 ? 29.6902 ? -0.5070 ? 0.1964  ? -0.2132 ? -0.1289 ? 0.6382 ? -0.3988 ? 0.9155  ? -1.2439 ? -0.1312 ? 
3 'X-RAY DIFFRACTION' ? refined 33.9510 -1.0830  -6.3450 0.1673 ? -0.1500 ? -0.0310 ? 0.3491 ? 0.0346  ? 0.0197 ? 10.6425 ? 
-0.2924 ? -1.1614 ? 3.6581  ? 1.0561  ? 7.5465  ? -0.3687 ? 0.7934  ? 0.1490  ? -0.2706 ? 0.1673 ? 0.2174  ? -0.0605 ? -0.1360 ? 
0.2014  ? 
4 'X-RAY DIFFRACTION' ? refined 26.8650 -9.2290  -2.9370 0.2839 ? -0.1836 ? -0.0253 ? 0.5081 ? -0.0078 ? 0.1849 ? 4.5435  ? 
-4.1110 ? -1.7592 ? 12.1958 ? 11.5976 ? 33.8459 ? -0.5302 ? -0.2243 ? -0.1544 ? -0.0871 ? 0.3539 ? 0.7069  ? 0.7497  ? 0.8287  ? 
0.1762  ? 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
1 'X-RAY DIFFRACTION' 1 ? ? A 3 ? ? A 104 ? ? 
2 'X-RAY DIFFRACTION' 2 ? ? B 2 ? ? B 11  ? ? 
3 'X-RAY DIFFRACTION' 3 ? ? C 3 ? ? C 104 ? ? 
4 'X-RAY DIFFRACTION' 4 ? ? D 2 ? ? D 11  ? ? 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A MET 1 ? A MET 1 
2 1 Y 1 A ALA 2 ? A ALA 2 
3 1 Y 1 B GLU 1 ? B GLU 1 
4 1 Y 1 C MET 1 ? C MET 1 
5 1 Y 1 C ALA 2 ? C ALA 2 
6 1 Y 1 D GLU 1 ? D GLU 1 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N    N N N 1   
ALA CA   C N S 2   
ALA C    C N N 3   
ALA O    O N N 4   
ALA CB   C N N 5   
ALA OXT  O N N 6   
ALA H    H N N 7   
ALA H2   H N N 8   
ALA HA   H N N 9   
ALA HB1  H N N 10  
ALA HB2  H N N 11  
ALA HB3  H N N 12  
ALA HXT  H N N 13  
ARG N    N N N 14  
ARG CA   C N S 15  
ARG C    C N N 16  
ARG O    O N N 17  
ARG CB   C N N 18  
ARG CG   C N N 19  
ARG CD   C N N 20  
ARG NE   N N N 21  
ARG CZ   C N N 22  
ARG NH1  N N N 23  
ARG NH2  N N N 24  
ARG OXT  O N N 25  
ARG H    H N N 26  
ARG H2   H N N 27  
ARG HA   H N N 28  
ARG HB2  H N N 29  
ARG HB3  H N N 30  
ARG HG2  H N N 31  
ARG HG3  H N N 32  
ARG HD2  H N N 33  
ARG HD3  H N N 34  
ARG HE   H N N 35  
ARG HH11 H N N 36  
ARG HH12 H N N 37  
ARG HH21 H N N 38  
ARG HH22 H N N 39  
ARG HXT  H N N 40  
ASN N    N N N 41  
ASN CA   C N S 42  
ASN C    C N N 43  
ASN O    O N N 44  
ASN CB   C N N 45  
ASN CG   C N N 46  
ASN OD1  O N N 47  
ASN ND2  N N N 48  
ASN OXT  O N N 49  
ASN H    H N N 50  
ASN H2   H N N 51  
ASN HA   H N N 52  
ASN HB2  H N N 53  
ASN HB3  H N N 54  
ASN HD21 H N N 55  
ASN HD22 H N N 56  
ASN HXT  H N N 57  
ASP N    N N N 58  
ASP CA   C N S 59  
ASP C    C N N 60  
ASP O    O N N 61  
ASP CB   C N N 62  
ASP CG   C N N 63  
ASP OD1  O N N 64  
ASP OD2  O N N 65  
ASP OXT  O N N 66  
ASP H    H N N 67  
ASP H2   H N N 68  
ASP HA   H N N 69  
ASP HB2  H N N 70  
ASP HB3  H N N 71  
ASP HD2  H N N 72  
ASP HXT  H N N 73  
CYS N    N N N 74  
CYS CA   C N R 75  
CYS C    C N N 76  
CYS O    O N N 77  
CYS CB   C N N 78  
CYS SG   S N N 79  
CYS OXT  O N N 80  
CYS H    H N N 81  
CYS H2   H N N 82  
CYS HA   H N N 83  
CYS HB2  H N N 84  
CYS HB3  H N N 85  
CYS HG   H N N 86  
CYS HXT  H N N 87  
GLN N    N N N 88  
GLN CA   C N S 89  
GLN C    C N N 90  
GLN O    O N N 91  
GLN CB   C N N 92  
GLN CG   C N N 93  
GLN CD   C N N 94  
GLN OE1  O N N 95  
GLN NE2  N N N 96  
GLN OXT  O N N 97  
GLN H    H N N 98  
GLN H2   H N N 99  
GLN HA   H N N 100 
GLN HB2  H N N 101 
GLN HB3  H N N 102 
GLN HG2  H N N 103 
GLN HG3  H N N 104 
GLN HE21 H N N 105 
GLN HE22 H N N 106 
GLN HXT  H N N 107 
GLU N    N N N 108 
GLU CA   C N S 109 
GLU C    C N N 110 
GLU O    O N N 111 
GLU CB   C N N 112 
GLU CG   C N N 113 
GLU CD   C N N 114 
GLU OE1  O N N 115 
GLU OE2  O N N 116 
GLU OXT  O N N 117 
GLU H    H N N 118 
GLU H2   H N N 119 
GLU HA   H N N 120 
GLU HB2  H N N 121 
GLU HB3  H N N 122 
GLU HG2  H N N 123 
GLU HG3  H N N 124 
GLU HE2  H N N 125 
GLU HXT  H N N 126 
GLY N    N N N 127 
GLY CA   C N N 128 
GLY C    C N N 129 
GLY O    O N N 130 
GLY OXT  O N N 131 
GLY H    H N N 132 
GLY H2   H N N 133 
GLY HA2  H N N 134 
GLY HA3  H N N 135 
GLY HXT  H N N 136 
HIS N    N N N 137 
HIS CA   C N S 138 
HIS C    C N N 139 
HIS O    O N N 140 
HIS CB   C N N 141 
HIS CG   C Y N 142 
HIS ND1  N Y N 143 
HIS CD2  C Y N 144 
HIS CE1  C Y N 145 
HIS NE2  N Y N 146 
HIS OXT  O N N 147 
HIS H    H N N 148 
HIS H2   H N N 149 
HIS HA   H N N 150 
HIS HB2  H N N 151 
HIS HB3  H N N 152 
HIS HD1  H N N 153 
HIS HD2  H N N 154 
HIS HE1  H N N 155 
HIS HE2  H N N 156 
HIS HXT  H N N 157 
ILE N    N N N 158 
ILE CA   C N S 159 
ILE C    C N N 160 
ILE O    O N N 161 
ILE CB   C N S 162 
ILE CG1  C N N 163 
ILE CG2  C N N 164 
ILE CD1  C N N 165 
ILE OXT  O N N 166 
ILE H    H N N 167 
ILE H2   H N N 168 
ILE HA   H N N 169 
ILE HB   H N N 170 
ILE HG12 H N N 171 
ILE HG13 H N N 172 
ILE HG21 H N N 173 
ILE HG22 H N N 174 
ILE HG23 H N N 175 
ILE HD11 H N N 176 
ILE HD12 H N N 177 
ILE HD13 H N N 178 
ILE HXT  H N N 179 
LEU N    N N N 180 
LEU CA   C N S 181 
LEU C    C N N 182 
LEU O    O N N 183 
LEU CB   C N N 184 
LEU CG   C N N 185 
LEU CD1  C N N 186 
LEU CD2  C N N 187 
LEU OXT  O N N 188 
LEU H    H N N 189 
LEU H2   H N N 190 
LEU HA   H N N 191 
LEU HB2  H N N 192 
LEU HB3  H N N 193 
LEU HG   H N N 194 
LEU HD11 H N N 195 
LEU HD12 H N N 196 
LEU HD13 H N N 197 
LEU HD21 H N N 198 
LEU HD22 H N N 199 
LEU HD23 H N N 200 
LEU HXT  H N N 201 
LYS N    N N N 202 
LYS CA   C N S 203 
LYS C    C N N 204 
LYS O    O N N 205 
LYS CB   C N N 206 
LYS CG   C N N 207 
LYS CD   C N N 208 
LYS CE   C N N 209 
LYS NZ   N N N 210 
LYS OXT  O N N 211 
LYS H    H N N 212 
LYS H2   H N N 213 
LYS HA   H N N 214 
LYS HB2  H N N 215 
LYS HB3  H N N 216 
LYS HG2  H N N 217 
LYS HG3  H N N 218 
LYS HD2  H N N 219 
LYS HD3  H N N 220 
LYS HE2  H N N 221 
LYS HE3  H N N 222 
LYS HZ1  H N N 223 
LYS HZ2  H N N 224 
LYS HZ3  H N N 225 
LYS HXT  H N N 226 
MET N    N N N 227 
MET CA   C N S 228 
MET C    C N N 229 
MET O    O N N 230 
MET CB   C N N 231 
MET CG   C N N 232 
MET SD   S N N 233 
MET CE   C N N 234 
MET OXT  O N N 235 
MET H    H N N 236 
MET H2   H N N 237 
MET HA   H N N 238 
MET HB2  H N N 239 
MET HB3  H N N 240 
MET HG2  H N N 241 
MET HG3  H N N 242 
MET HE1  H N N 243 
MET HE2  H N N 244 
MET HE3  H N N 245 
MET HXT  H N N 246 
PHE N    N N N 247 
PHE CA   C N S 248 
PHE C    C N N 249 
PHE O    O N N 250 
PHE CB   C N N 251 
PHE CG   C Y N 252 
PHE CD1  C Y N 253 
PHE CD2  C Y N 254 
PHE CE1  C Y N 255 
PHE CE2  C Y N 256 
PHE CZ   C Y N 257 
PHE OXT  O N N 258 
PHE H    H N N 259 
PHE H2   H N N 260 
PHE HA   H N N 261 
PHE HB2  H N N 262 
PHE HB3  H N N 263 
PHE HD1  H N N 264 
PHE HD2  H N N 265 
PHE HE1  H N N 266 
PHE HE2  H N N 267 
PHE HZ   H N N 268 
PHE HXT  H N N 269 
PRO N    N N N 270 
PRO CA   C N S 271 
PRO C    C N N 272 
PRO O    O N N 273 
PRO CB   C N N 274 
PRO CG   C N N 275 
PRO CD   C N N 276 
PRO OXT  O N N 277 
PRO H    H N N 278 
PRO HA   H N N 279 
PRO HB2  H N N 280 
PRO HB3  H N N 281 
PRO HG2  H N N 282 
PRO HG3  H N N 283 
PRO HD2  H N N 284 
PRO HD3  H N N 285 
PRO HXT  H N N 286 
PTR N    N N N 287 
PTR CA   C N S 288 
PTR C    C N N 289 
PTR O    O N N 290 
PTR OXT  O N N 291 
PTR CB   C N N 292 
PTR CG   C Y N 293 
PTR CD1  C Y N 294 
PTR CD2  C Y N 295 
PTR CE1  C Y N 296 
PTR CE2  C Y N 297 
PTR CZ   C Y N 298 
PTR OH   O N N 299 
PTR P    P N N 300 
PTR O1P  O N N 301 
PTR O2P  O N N 302 
PTR O3P  O N N 303 
PTR H    H N N 304 
PTR H2   H N N 305 
PTR HA   H N N 306 
PTR HXT  H N N 307 
PTR HB2  H N N 308 
PTR HB3  H N N 309 
PTR HD1  H N N 310 
PTR HD2  H N N 311 
PTR HE1  H N N 312 
PTR HE2  H N N 313 
PTR HO2P H N N 314 
PTR HO3P H N N 315 
SER N    N N N 316 
SER CA   C N S 317 
SER C    C N N 318 
SER O    O N N 319 
SER CB   C N N 320 
SER OG   O N N 321 
SER OXT  O N N 322 
SER H    H N N 323 
SER H2   H N N 324 
SER HA   H N N 325 
SER HB2  H N N 326 
SER HB3  H N N 327 
SER HG   H N N 328 
SER HXT  H N N 329 
THR N    N N N 330 
THR CA   C N S 331 
THR C    C N N 332 
THR O    O N N 333 
THR CB   C N R 334 
THR OG1  O N N 335 
THR CG2  C N N 336 
THR OXT  O N N 337 
THR H    H N N 338 
THR H2   H N N 339 
THR HA   H N N 340 
THR HB   H N N 341 
THR HG1  H N N 342 
THR HG21 H N N 343 
THR HG22 H N N 344 
THR HG23 H N N 345 
THR HXT  H N N 346 
TRP N    N N N 347 
TRP CA   C N S 348 
TRP C    C N N 349 
TRP O    O N N 350 
TRP CB   C N N 351 
TRP CG   C Y N 352 
TRP CD1  C Y N 353 
TRP CD2  C Y N 354 
TRP NE1  N Y N 355 
TRP CE2  C Y N 356 
TRP CE3  C Y N 357 
TRP CZ2  C Y N 358 
TRP CZ3  C Y N 359 
TRP CH2  C Y N 360 
TRP OXT  O N N 361 
TRP H    H N N 362 
TRP H2   H N N 363 
TRP HA   H N N 364 
TRP HB2  H N N 365 
TRP HB3  H N N 366 
TRP HD1  H N N 367 
TRP HE1  H N N 368 
TRP HE3  H N N 369 
TRP HZ2  H N N 370 
TRP HZ3  H N N 371 
TRP HH2  H N N 372 
TRP HXT  H N N 373 
TYR N    N N N 374 
TYR CA   C N S 375 
TYR C    C N N 376 
TYR O    O N N 377 
TYR CB   C N N 378 
TYR CG   C Y N 379 
TYR CD1  C Y N 380 
TYR CD2  C Y N 381 
TYR CE1  C Y N 382 
TYR CE2  C Y N 383 
TYR CZ   C Y N 384 
TYR OH   O N N 385 
TYR OXT  O N N 386 
TYR H    H N N 387 
TYR H2   H N N 388 
TYR HA   H N N 389 
TYR HB2  H N N 390 
TYR HB3  H N N 391 
TYR HD1  H N N 392 
TYR HD2  H N N 393 
TYR HE1  H N N 394 
TYR HE2  H N N 395 
TYR HH   H N N 396 
TYR HXT  H N N 397 
VAL N    N N N 398 
VAL CA   C N S 399 
VAL C    C N N 400 
VAL O    O N N 401 
VAL CB   C N N 402 
VAL CG1  C N N 403 
VAL CG2  C N N 404 
VAL OXT  O N N 405 
VAL H    H N N 406 
VAL H2   H N N 407 
VAL HA   H N N 408 
VAL HB   H N N 409 
VAL HG11 H N N 410 
VAL HG12 H N N 411 
VAL HG13 H N N 412 
VAL HG21 H N N 413 
VAL HG22 H N N 414 
VAL HG23 H N N 415 
VAL HXT  H N N 416 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N   CA   sing N N 1   
ALA N   H    sing N N 2   
ALA N   H2   sing N N 3   
ALA CA  C    sing N N 4   
ALA CA  CB   sing N N 5   
ALA CA  HA   sing N N 6   
ALA C   O    doub N N 7   
ALA C   OXT  sing N N 8   
ALA CB  HB1  sing N N 9   
ALA CB  HB2  sing N N 10  
ALA CB  HB3  sing N N 11  
ALA OXT HXT  sing N N 12  
ARG N   CA   sing N N 13  
ARG N   H    sing N N 14  
ARG N   H2   sing N N 15  
ARG CA  C    sing N N 16  
ARG CA  CB   sing N N 17  
ARG CA  HA   sing N N 18  
ARG C   O    doub N N 19  
ARG C   OXT  sing N N 20  
ARG CB  CG   sing N N 21  
ARG CB  HB2  sing N N 22  
ARG CB  HB3  sing N N 23  
ARG CG  CD   sing N N 24  
ARG CG  HG2  sing N N 25  
ARG CG  HG3  sing N N 26  
ARG CD  NE   sing N N 27  
ARG CD  HD2  sing N N 28  
ARG CD  HD3  sing N N 29  
ARG NE  CZ   sing N N 30  
ARG NE  HE   sing N N 31  
ARG CZ  NH1  sing N N 32  
ARG CZ  NH2  doub N N 33  
ARG NH1 HH11 sing N N 34  
ARG NH1 HH12 sing N N 35  
ARG NH2 HH21 sing N N 36  
ARG NH2 HH22 sing N N 37  
ARG OXT HXT  sing N N 38  
ASN N   CA   sing N N 39  
ASN N   H    sing N N 40  
ASN N   H2   sing N N 41  
ASN CA  C    sing N N 42  
ASN CA  CB   sing N N 43  
ASN CA  HA   sing N N 44  
ASN C   O    doub N N 45  
ASN C   OXT  sing N N 46  
ASN CB  CG   sing N N 47  
ASN CB  HB2  sing N N 48  
ASN CB  HB3  sing N N 49  
ASN CG  OD1  doub N N 50  
ASN CG  ND2  sing N N 51  
ASN ND2 HD21 sing N N 52  
ASN ND2 HD22 sing N N 53  
ASN OXT HXT  sing N N 54  
ASP N   CA   sing N N 55  
ASP N   H    sing N N 56  
ASP N   H2   sing N N 57  
ASP CA  C    sing N N 58  
ASP CA  CB   sing N N 59  
ASP CA  HA   sing N N 60  
ASP C   O    doub N N 61  
ASP C   OXT  sing N N 62  
ASP CB  CG   sing N N 63  
ASP CB  HB2  sing N N 64  
ASP CB  HB3  sing N N 65  
ASP CG  OD1  doub N N 66  
ASP CG  OD2  sing N N 67  
ASP OD2 HD2  sing N N 68  
ASP OXT HXT  sing N N 69  
CYS N   CA   sing N N 70  
CYS N   H    sing N N 71  
CYS N   H2   sing N N 72  
CYS CA  C    sing N N 73  
CYS CA  CB   sing N N 74  
CYS CA  HA   sing N N 75  
CYS C   O    doub N N 76  
CYS C   OXT  sing N N 77  
CYS CB  SG   sing N N 78  
CYS CB  HB2  sing N N 79  
CYS CB  HB3  sing N N 80  
CYS SG  HG   sing N N 81  
CYS OXT HXT  sing N N 82  
GLN N   CA   sing N N 83  
GLN N   H    sing N N 84  
GLN N   H2   sing N N 85  
GLN CA  C    sing N N 86  
GLN CA  CB   sing N N 87  
GLN CA  HA   sing N N 88  
GLN C   O    doub N N 89  
GLN C   OXT  sing N N 90  
GLN CB  CG   sing N N 91  
GLN CB  HB2  sing N N 92  
GLN CB  HB3  sing N N 93  
GLN CG  CD   sing N N 94  
GLN CG  HG2  sing N N 95  
GLN CG  HG3  sing N N 96  
GLN CD  OE1  doub N N 97  
GLN CD  NE2  sing N N 98  
GLN NE2 HE21 sing N N 99  
GLN NE2 HE22 sing N N 100 
GLN OXT HXT  sing N N 101 
GLU N   CA   sing N N 102 
GLU N   H    sing N N 103 
GLU N   H2   sing N N 104 
GLU CA  C    sing N N 105 
GLU CA  CB   sing N N 106 
GLU CA  HA   sing N N 107 
GLU C   O    doub N N 108 
GLU C   OXT  sing N N 109 
GLU CB  CG   sing N N 110 
GLU CB  HB2  sing N N 111 
GLU CB  HB3  sing N N 112 
GLU CG  CD   sing N N 113 
GLU CG  HG2  sing N N 114 
GLU CG  HG3  sing N N 115 
GLU CD  OE1  doub N N 116 
GLU CD  OE2  sing N N 117 
GLU OE2 HE2  sing N N 118 
GLU OXT HXT  sing N N 119 
GLY N   CA   sing N N 120 
GLY N   H    sing N N 121 
GLY N   H2   sing N N 122 
GLY CA  C    sing N N 123 
GLY CA  HA2  sing N N 124 
GLY CA  HA3  sing N N 125 
GLY C   O    doub N N 126 
GLY C   OXT  sing N N 127 
GLY OXT HXT  sing N N 128 
HIS N   CA   sing N N 129 
HIS N   H    sing N N 130 
HIS N   H2   sing N N 131 
HIS CA  C    sing N N 132 
HIS CA  CB   sing N N 133 
HIS CA  HA   sing N N 134 
HIS C   O    doub N N 135 
HIS C   OXT  sing N N 136 
HIS CB  CG   sing N N 137 
HIS CB  HB2  sing N N 138 
HIS CB  HB3  sing N N 139 
HIS CG  ND1  sing Y N 140 
HIS CG  CD2  doub Y N 141 
HIS ND1 CE1  doub Y N 142 
HIS ND1 HD1  sing N N 143 
HIS CD2 NE2  sing Y N 144 
HIS CD2 HD2  sing N N 145 
HIS CE1 NE2  sing Y N 146 
HIS CE1 HE1  sing N N 147 
HIS NE2 HE2  sing N N 148 
HIS OXT HXT  sing N N 149 
ILE N   CA   sing N N 150 
ILE N   H    sing N N 151 
ILE N   H2   sing N N 152 
ILE CA  C    sing N N 153 
ILE CA  CB   sing N N 154 
ILE CA  HA   sing N N 155 
ILE C   O    doub N N 156 
ILE C   OXT  sing N N 157 
ILE CB  CG1  sing N N 158 
ILE CB  CG2  sing N N 159 
ILE CB  HB   sing N N 160 
ILE CG1 CD1  sing N N 161 
ILE CG1 HG12 sing N N 162 
ILE CG1 HG13 sing N N 163 
ILE CG2 HG21 sing N N 164 
ILE CG2 HG22 sing N N 165 
ILE CG2 HG23 sing N N 166 
ILE CD1 HD11 sing N N 167 
ILE CD1 HD12 sing N N 168 
ILE CD1 HD13 sing N N 169 
ILE OXT HXT  sing N N 170 
LEU N   CA   sing N N 171 
LEU N   H    sing N N 172 
LEU N   H2   sing N N 173 
LEU CA  C    sing N N 174 
LEU CA  CB   sing N N 175 
LEU CA  HA   sing N N 176 
LEU C   O    doub N N 177 
LEU C   OXT  sing N N 178 
LEU CB  CG   sing N N 179 
LEU CB  HB2  sing N N 180 
LEU CB  HB3  sing N N 181 
LEU CG  CD1  sing N N 182 
LEU CG  CD2  sing N N 183 
LEU CG  HG   sing N N 184 
LEU CD1 HD11 sing N N 185 
LEU CD1 HD12 sing N N 186 
LEU CD1 HD13 sing N N 187 
LEU CD2 HD21 sing N N 188 
LEU CD2 HD22 sing N N 189 
LEU CD2 HD23 sing N N 190 
LEU OXT HXT  sing N N 191 
LYS N   CA   sing N N 192 
LYS N   H    sing N N 193 
LYS N   H2   sing N N 194 
LYS CA  C    sing N N 195 
LYS CA  CB   sing N N 196 
LYS CA  HA   sing N N 197 
LYS C   O    doub N N 198 
LYS C   OXT  sing N N 199 
LYS CB  CG   sing N N 200 
LYS CB  HB2  sing N N 201 
LYS CB  HB3  sing N N 202 
LYS CG  CD   sing N N 203 
LYS CG  HG2  sing N N 204 
LYS CG  HG3  sing N N 205 
LYS CD  CE   sing N N 206 
LYS CD  HD2  sing N N 207 
LYS CD  HD3  sing N N 208 
LYS CE  NZ   sing N N 209 
LYS CE  HE2  sing N N 210 
LYS CE  HE3  sing N N 211 
LYS NZ  HZ1  sing N N 212 
LYS NZ  HZ2  sing N N 213 
LYS NZ  HZ3  sing N N 214 
LYS OXT HXT  sing N N 215 
MET N   CA   sing N N 216 
MET N   H    sing N N 217 
MET N   H2   sing N N 218 
MET CA  C    sing N N 219 
MET CA  CB   sing N N 220 
MET CA  HA   sing N N 221 
MET C   O    doub N N 222 
MET C   OXT  sing N N 223 
MET CB  CG   sing N N 224 
MET CB  HB2  sing N N 225 
MET CB  HB3  sing N N 226 
MET CG  SD   sing N N 227 
MET CG  HG2  sing N N 228 
MET CG  HG3  sing N N 229 
MET SD  CE   sing N N 230 
MET CE  HE1  sing N N 231 
MET CE  HE2  sing N N 232 
MET CE  HE3  sing N N 233 
MET OXT HXT  sing N N 234 
PHE N   CA   sing N N 235 
PHE N   H    sing N N 236 
PHE N   H2   sing N N 237 
PHE CA  C    sing N N 238 
PHE CA  CB   sing N N 239 
PHE CA  HA   sing N N 240 
PHE C   O    doub N N 241 
PHE C   OXT  sing N N 242 
PHE CB  CG   sing N N 243 
PHE CB  HB2  sing N N 244 
PHE CB  HB3  sing N N 245 
PHE CG  CD1  doub Y N 246 
PHE CG  CD2  sing Y N 247 
PHE CD1 CE1  sing Y N 248 
PHE CD1 HD1  sing N N 249 
PHE CD2 CE2  doub Y N 250 
PHE CD2 HD2  sing N N 251 
PHE CE1 CZ   doub Y N 252 
PHE CE1 HE1  sing N N 253 
PHE CE2 CZ   sing Y N 254 
PHE CE2 HE2  sing N N 255 
PHE CZ  HZ   sing N N 256 
PHE OXT HXT  sing N N 257 
PRO N   CA   sing N N 258 
PRO N   CD   sing N N 259 
PRO N   H    sing N N 260 
PRO CA  C    sing N N 261 
PRO CA  CB   sing N N 262 
PRO CA  HA   sing N N 263 
PRO C   O    doub N N 264 
PRO C   OXT  sing N N 265 
PRO CB  CG   sing N N 266 
PRO CB  HB2  sing N N 267 
PRO CB  HB3  sing N N 268 
PRO CG  CD   sing N N 269 
PRO CG  HG2  sing N N 270 
PRO CG  HG3  sing N N 271 
PRO CD  HD2  sing N N 272 
PRO CD  HD3  sing N N 273 
PRO OXT HXT  sing N N 274 
PTR N   CA   sing N N 275 
PTR N   H    sing N N 276 
PTR N   H2   sing N N 277 
PTR CA  C    sing N N 278 
PTR CA  CB   sing N N 279 
PTR CA  HA   sing N N 280 
PTR C   O    doub N N 281 
PTR C   OXT  sing N N 282 
PTR OXT HXT  sing N N 283 
PTR CB  CG   sing N N 284 
PTR CB  HB2  sing N N 285 
PTR CB  HB3  sing N N 286 
PTR CG  CD1  doub Y N 287 
PTR CG  CD2  sing Y N 288 
PTR CD1 CE1  sing Y N 289 
PTR CD1 HD1  sing N N 290 
PTR CD2 CE2  doub Y N 291 
PTR CD2 HD2  sing N N 292 
PTR CE1 CZ   doub Y N 293 
PTR CE1 HE1  sing N N 294 
PTR CE2 CZ   sing Y N 295 
PTR CE2 HE2  sing N N 296 
PTR CZ  OH   sing N N 297 
PTR OH  P    sing N N 298 
PTR P   O1P  doub N N 299 
PTR P   O2P  sing N N 300 
PTR P   O3P  sing N N 301 
PTR O2P HO2P sing N N 302 
PTR O3P HO3P sing N N 303 
SER N   CA   sing N N 304 
SER N   H    sing N N 305 
SER N   H2   sing N N 306 
SER CA  C    sing N N 307 
SER CA  CB   sing N N 308 
SER CA  HA   sing N N 309 
SER C   O    doub N N 310 
SER C   OXT  sing N N 311 
SER CB  OG   sing N N 312 
SER CB  HB2  sing N N 313 
SER CB  HB3  sing N N 314 
SER OG  HG   sing N N 315 
SER OXT HXT  sing N N 316 
THR N   CA   sing N N 317 
THR N   H    sing N N 318 
THR N   H2   sing N N 319 
THR CA  C    sing N N 320 
THR CA  CB   sing N N 321 
THR CA  HA   sing N N 322 
THR C   O    doub N N 323 
THR C   OXT  sing N N 324 
THR CB  OG1  sing N N 325 
THR CB  CG2  sing N N 326 
THR CB  HB   sing N N 327 
THR OG1 HG1  sing N N 328 
THR CG2 HG21 sing N N 329 
THR CG2 HG22 sing N N 330 
THR CG2 HG23 sing N N 331 
THR OXT HXT  sing N N 332 
TRP N   CA   sing N N 333 
TRP N   H    sing N N 334 
TRP N   H2   sing N N 335 
TRP CA  C    sing N N 336 
TRP CA  CB   sing N N 337 
TRP CA  HA   sing N N 338 
TRP C   O    doub N N 339 
TRP C   OXT  sing N N 340 
TRP CB  CG   sing N N 341 
TRP CB  HB2  sing N N 342 
TRP CB  HB3  sing N N 343 
TRP CG  CD1  doub Y N 344 
TRP CG  CD2  sing Y N 345 
TRP CD1 NE1  sing Y N 346 
TRP CD1 HD1  sing N N 347 
TRP CD2 CE2  doub Y N 348 
TRP CD2 CE3  sing Y N 349 
TRP NE1 CE2  sing Y N 350 
TRP NE1 HE1  sing N N 351 
TRP CE2 CZ2  sing Y N 352 
TRP CE3 CZ3  doub Y N 353 
TRP CE3 HE3  sing N N 354 
TRP CZ2 CH2  doub Y N 355 
TRP CZ2 HZ2  sing N N 356 
TRP CZ3 CH2  sing Y N 357 
TRP CZ3 HZ3  sing N N 358 
TRP CH2 HH2  sing N N 359 
TRP OXT HXT  sing N N 360 
TYR N   CA   sing N N 361 
TYR N   H    sing N N 362 
TYR N   H2   sing N N 363 
TYR CA  C    sing N N 364 
TYR CA  CB   sing N N 365 
TYR CA  HA   sing N N 366 
TYR C   O    doub N N 367 
TYR C   OXT  sing N N 368 
TYR CB  CG   sing N N 369 
TYR CB  HB2  sing N N 370 
TYR CB  HB3  sing N N 371 
TYR CG  CD1  doub Y N 372 
TYR CG  CD2  sing Y N 373 
TYR CD1 CE1  sing Y N 374 
TYR CD1 HD1  sing N N 375 
TYR CD2 CE2  doub Y N 376 
TYR CD2 HD2  sing N N 377 
TYR CE1 CZ   doub Y N 378 
TYR CE1 HE1  sing N N 379 
TYR CE2 CZ   sing Y N 380 
TYR CE2 HE2  sing N N 381 
TYR CZ  OH   sing N N 382 
TYR OH  HH   sing N N 383 
TYR OXT HXT  sing N N 384 
VAL N   CA   sing N N 385 
VAL N   H    sing N N 386 
VAL N   H2   sing N N 387 
VAL CA  C    sing N N 388 
VAL CA  CB   sing N N 389 
VAL CA  HA   sing N N 390 
VAL C   O    doub N N 391 
VAL C   OXT  sing N N 392 
VAL CB  CG1  sing N N 393 
VAL CB  CG2  sing N N 394 
VAL CB  HB   sing N N 395 
VAL CG1 HG11 sing N N 396 
VAL CG1 HG12 sing N N 397 
VAL CG1 HG13 sing N N 398 
VAL CG2 HG21 sing N N 399 
VAL CG2 HG22 sing N N 400 
VAL CG2 HG23 sing N N 401 
VAL OXT HXT  sing N N 402 
# 
_pdbx_initial_refinement_model.id               1 
_pdbx_initial_refinement_model.entity_id_list   ? 
_pdbx_initial_refinement_model.type             'experimental model' 
_pdbx_initial_refinement_model.source_name      PDB 
_pdbx_initial_refinement_model.accession_code   3TKZ 
_pdbx_initial_refinement_model.details          ? 
# 
_atom_sites.entry_id                    6ROZ 
_atom_sites.fract_transf_matrix[1][1]   0.033294 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   -0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.033294 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   -0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004692 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_