data_6RP6 # _entry.id 6RP6 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6RP6 pdb_00006rp6 10.2210/pdb6rp6/pdb WWPDB D_1292102186 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-06-17 2 'Structure model' 1 1 2020-07-22 3 'Structure model' 1 2 2024-01-24 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' database_2 6 3 'Structure model' pdbx_initial_refinement_model 7 3 'Structure model' pdbx_struct_conn_angle 8 3 'Structure model' struct_conn 9 3 'Structure model' struct_conn_type # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation_author.name' 5 3 'Structure model' '_database_2.pdbx_DOI' 6 3 'Structure model' '_database_2.pdbx_database_accession' 7 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 8 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 9 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 10 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 11 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 12 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 13 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_symmetry' 14 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 15 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 16 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 17 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 18 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 19 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 20 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_symmetry' 21 3 'Structure model' '_pdbx_struct_conn_angle.value' 22 3 'Structure model' '_struct_conn.conn_type_id' 23 3 'Structure model' '_struct_conn.id' 24 3 'Structure model' '_struct_conn.pdbx_dist_value' 25 3 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 26 3 'Structure model' '_struct_conn.pdbx_ptnr1_label_alt_id' 27 3 'Structure model' '_struct_conn.ptnr1_auth_asym_id' 28 3 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 29 3 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 30 3 'Structure model' '_struct_conn.ptnr1_label_asym_id' 31 3 'Structure model' '_struct_conn.ptnr1_label_atom_id' 32 3 'Structure model' '_struct_conn.ptnr1_label_comp_id' 33 3 'Structure model' '_struct_conn.ptnr1_label_seq_id' 34 3 'Structure model' '_struct_conn.ptnr2_auth_asym_id' 35 3 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 36 3 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 37 3 'Structure model' '_struct_conn.ptnr2_label_asym_id' 38 3 'Structure model' '_struct_conn.ptnr2_label_atom_id' 39 3 'Structure model' '_struct_conn.ptnr2_label_comp_id' 40 3 'Structure model' '_struct_conn.ptnr2_label_seq_id' 41 3 'Structure model' '_struct_conn.ptnr2_symmetry' 42 3 'Structure model' '_struct_conn_type.id' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6RP6 _pdbx_database_status.recvd_initial_deposition_date 2019-05-14 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Genet, S.' 1 ? 'Wolter, M.' 2 ? 'Guillory, X.' 3 ? 'Somsen, B.' 4 ? 'Leysen, S.' 5 ? 'Patel, J.' 6 ? 'Castaldi, P.' 7 ? 'Ottmann, C.' 8 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Med.Chem. _citation.journal_id_ASTM JMCMAR _citation.journal_id_CSD 0151 _citation.journal_id_ISSN 0022-2623 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 63 _citation.language ? _citation.page_first 6694 _citation.page_last 6707 _citation.title 'Fragment-based Differential Targeting of PPI Stabilizer Interfaces.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.jmedchem.9b01942 _citation.pdbx_database_id_PubMed 32501690 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Guillory, X.' 1 ? primary 'Wolter, M.' 2 ? primary 'Leysen, S.' 3 ? primary 'Neves, J.F.' 4 ? primary 'Kuusk, A.' 5 ? primary 'Genet, S.' 6 ? primary 'Somsen, B.' 7 ? primary 'Morrow, J.K.' 8 ? primary 'Rivers, E.' 9 ? primary 'van Beek, L.' 10 ? primary 'Patel, J.' 11 ? primary 'Goodnow, R.' 12 ? primary 'Schoenherr, H.' 13 ? primary 'Fuller, N.' 14 ? primary 'Cao, Q.' 15 ? primary 'Doveston, R.G.' 16 ? primary 'Brunsveld, L.' 17 ? primary 'Arkin, M.R.' 18 ? primary 'Castaldi, P.' 19 ? primary 'Boyd, H.' 20 ? primary 'Landrieu, I.' 21 ? primary 'Chen, H.' 22 ? primary 'Ottmann, C.' 23 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man '14-3-3 protein sigma' 26542.914 1 ? ? ? ? 2 polymer syn 'WW domain-containing transcription regulator protein 1' 1422.439 1 ? ? ? ? 3 non-polymer syn '4-phenyl-5-(piperidin-4-ylmethyl)thiophene-2-carboximidamide' 299.434 1 ? ? ? ? 4 non-polymer syn 'CALCIUM ION' 40.078 1 ? ? ? ? 5 non-polymer syn 'SODIUM ION' 22.990 1 ? ? ? ? 6 water nat water 18.015 336 ? ? ? ? # loop_ _entity_name_com.entity_id _entity_name_com.name 1 'Epithelial cell marker protein 1,Stratifin' 2 'Transcriptional coactivator with PDZ-binding motif' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;GAMGSMERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSE EKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAM DISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWT ; ;GAMGSMERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSE EKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAM DISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWT ; A ? 2 'polypeptide(L)' no yes 'RSH(SEP)SPASLQLGT' RSHSSPASLQLGT P ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 '4-phenyl-5-(piperidin-4-ylmethyl)thiophene-2-carboximidamide' KDK 4 'CALCIUM ION' CA 5 'SODIUM ION' NA 6 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ALA n 1 3 MET n 1 4 GLY n 1 5 SER n 1 6 MET n 1 7 GLU n 1 8 ARG n 1 9 ALA n 1 10 SER n 1 11 LEU n 1 12 ILE n 1 13 GLN n 1 14 LYS n 1 15 ALA n 1 16 LYS n 1 17 LEU n 1 18 ALA n 1 19 GLU n 1 20 GLN n 1 21 ALA n 1 22 GLU n 1 23 ARG n 1 24 TYR n 1 25 GLU n 1 26 ASP n 1 27 MET n 1 28 ALA n 1 29 ALA n 1 30 PHE n 1 31 MET n 1 32 LYS n 1 33 GLY n 1 34 ALA n 1 35 VAL n 1 36 GLU n 1 37 LYS n 1 38 GLY n 1 39 GLU n 1 40 GLU n 1 41 LEU n 1 42 SER n 1 43 CYS n 1 44 GLU n 1 45 GLU n 1 46 ARG n 1 47 ASN n 1 48 LEU n 1 49 LEU n 1 50 SER n 1 51 VAL n 1 52 ALA n 1 53 TYR n 1 54 LYS n 1 55 ASN n 1 56 VAL n 1 57 VAL n 1 58 GLY n 1 59 GLY n 1 60 GLN n 1 61 ARG n 1 62 ALA n 1 63 ALA n 1 64 TRP n 1 65 ARG n 1 66 VAL n 1 67 LEU n 1 68 SER n 1 69 SER n 1 70 ILE n 1 71 GLU n 1 72 GLN n 1 73 LYS n 1 74 SER n 1 75 ASN n 1 76 GLU n 1 77 GLU n 1 78 GLY n 1 79 SER n 1 80 GLU n 1 81 GLU n 1 82 LYS n 1 83 GLY n 1 84 PRO n 1 85 GLU n 1 86 VAL n 1 87 ARG n 1 88 GLU n 1 89 TYR n 1 90 ARG n 1 91 GLU n 1 92 LYS n 1 93 VAL n 1 94 GLU n 1 95 THR n 1 96 GLU n 1 97 LEU n 1 98 GLN n 1 99 GLY n 1 100 VAL n 1 101 CYS n 1 102 ASP n 1 103 THR n 1 104 VAL n 1 105 LEU n 1 106 GLY n 1 107 LEU n 1 108 LEU n 1 109 ASP n 1 110 SER n 1 111 HIS n 1 112 LEU n 1 113 ILE n 1 114 LYS n 1 115 GLU n 1 116 ALA n 1 117 GLY n 1 118 ASP n 1 119 ALA n 1 120 GLU n 1 121 SER n 1 122 ARG n 1 123 VAL n 1 124 PHE n 1 125 TYR n 1 126 LEU n 1 127 LYS n 1 128 MET n 1 129 LYS n 1 130 GLY n 1 131 ASP n 1 132 TYR n 1 133 TYR n 1 134 ARG n 1 135 TYR n 1 136 LEU n 1 137 ALA n 1 138 GLU n 1 139 VAL n 1 140 ALA n 1 141 THR n 1 142 GLY n 1 143 ASP n 1 144 ASP n 1 145 LYS n 1 146 LYS n 1 147 ARG n 1 148 ILE n 1 149 ILE n 1 150 ASP n 1 151 SER n 1 152 ALA n 1 153 ARG n 1 154 SER n 1 155 ALA n 1 156 TYR n 1 157 GLN n 1 158 GLU n 1 159 ALA n 1 160 MET n 1 161 ASP n 1 162 ILE n 1 163 SER n 1 164 LYS n 1 165 LYS n 1 166 GLU n 1 167 MET n 1 168 PRO n 1 169 PRO n 1 170 THR n 1 171 ASN n 1 172 PRO n 1 173 ILE n 1 174 ARG n 1 175 LEU n 1 176 GLY n 1 177 LEU n 1 178 ALA n 1 179 LEU n 1 180 ASN n 1 181 PHE n 1 182 SER n 1 183 VAL n 1 184 PHE n 1 185 HIS n 1 186 TYR n 1 187 GLU n 1 188 ILE n 1 189 ALA n 1 190 ASN n 1 191 SER n 1 192 PRO n 1 193 GLU n 1 194 GLU n 1 195 ALA n 1 196 ILE n 1 197 SER n 1 198 LEU n 1 199 ALA n 1 200 LYS n 1 201 THR n 1 202 THR n 1 203 PHE n 1 204 ASP n 1 205 GLU n 1 206 ALA n 1 207 MET n 1 208 ALA n 1 209 ASP n 1 210 LEU n 1 211 HIS n 1 212 THR n 1 213 LEU n 1 214 SER n 1 215 GLU n 1 216 ASP n 1 217 SER n 1 218 TYR n 1 219 LYS n 1 220 ASP n 1 221 SER n 1 222 THR n 1 223 LEU n 1 224 ILE n 1 225 MET n 1 226 GLN n 1 227 LEU n 1 228 LEU n 1 229 ARG n 1 230 ASP n 1 231 ASN n 1 232 LEU n 1 233 THR n 1 234 LEU n 1 235 TRP n 1 236 THR n 2 1 ARG n 2 2 SER n 2 3 HIS n 2 4 SEP n 2 5 SER n 2 6 PRO n 2 7 ALA n 2 8 SER n 2 9 LEU n 2 10 GLN n 2 11 LEU n 2 12 GLY n 2 13 THR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 236 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'SFN, HME1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 13 _pdbx_entity_src_syn.organism_scientific 'Homo sapiens' _pdbx_entity_src_syn.organism_common_name Human _pdbx_entity_src_syn.ncbi_taxonomy_id 9606 _pdbx_entity_src_syn.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 KDK non-polymer . '4-phenyl-5-(piperidin-4-ylmethyl)thiophene-2-carboximidamide' ? 'C17 H21 N3 S' 299.434 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NA non-polymer . 'SODIUM ION' ? 'Na 1' 22.990 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SEP 'L-peptide linking' n PHOSPHOSERINE PHOSPHONOSERINE 'C3 H8 N O6 P' 185.072 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -4 -4 GLY GLY A . n A 1 2 ALA 2 -3 -3 ALA ALA A . n A 1 3 MET 3 -2 -2 MET MET A . n A 1 4 GLY 4 -1 -1 GLY GLY A . n A 1 5 SER 5 0 0 SER SER A . n A 1 6 MET 6 1 1 MET MET A . n A 1 7 GLU 7 2 2 GLU GLU A . n A 1 8 ARG 8 3 3 ARG ARG A . n A 1 9 ALA 9 4 4 ALA ALA A . n A 1 10 SER 10 5 5 SER SER A . n A 1 11 LEU 11 6 6 LEU LEU A . n A 1 12 ILE 12 7 7 ILE ILE A . n A 1 13 GLN 13 8 8 GLN GLN A . n A 1 14 LYS 14 9 9 LYS LYS A . n A 1 15 ALA 15 10 10 ALA ALA A . n A 1 16 LYS 16 11 11 LYS LYS A . n A 1 17 LEU 17 12 12 LEU LEU A . n A 1 18 ALA 18 13 13 ALA ALA A . n A 1 19 GLU 19 14 14 GLU GLU A . n A 1 20 GLN 20 15 15 GLN GLN A . n A 1 21 ALA 21 16 16 ALA ALA A . n A 1 22 GLU 22 17 17 GLU GLU A . n A 1 23 ARG 23 18 18 ARG ARG A . n A 1 24 TYR 24 19 19 TYR TYR A . n A 1 25 GLU 25 20 20 GLU GLU A . n A 1 26 ASP 26 21 21 ASP ASP A . n A 1 27 MET 27 22 22 MET MET A . n A 1 28 ALA 28 23 23 ALA ALA A . n A 1 29 ALA 29 24 24 ALA ALA A . n A 1 30 PHE 30 25 25 PHE PHE A . n A 1 31 MET 31 26 26 MET MET A . n A 1 32 LYS 32 27 27 LYS LYS A . n A 1 33 GLY 33 28 28 GLY GLY A . n A 1 34 ALA 34 29 29 ALA ALA A . n A 1 35 VAL 35 30 30 VAL VAL A . n A 1 36 GLU 36 31 31 GLU GLU A . n A 1 37 LYS 37 32 32 LYS LYS A . n A 1 38 GLY 38 33 33 GLY GLY A . n A 1 39 GLU 39 34 34 GLU GLU A . n A 1 40 GLU 40 35 35 GLU GLU A . n A 1 41 LEU 41 36 36 LEU LEU A . n A 1 42 SER 42 37 37 SER SER A . n A 1 43 CYS 43 38 38 CYS CSO A . n A 1 44 GLU 44 39 39 GLU GLU A . n A 1 45 GLU 45 40 40 GLU GLU A . n A 1 46 ARG 46 41 41 ARG ARG A . n A 1 47 ASN 47 42 42 ASN ASN A . n A 1 48 LEU 48 43 43 LEU LEU A . n A 1 49 LEU 49 44 44 LEU LEU A . n A 1 50 SER 50 45 45 SER SER A . n A 1 51 VAL 51 46 46 VAL VAL A . n A 1 52 ALA 52 47 47 ALA ALA A . n A 1 53 TYR 53 48 48 TYR TYR A . n A 1 54 LYS 54 49 49 LYS LYS A . n A 1 55 ASN 55 50 50 ASN ASN A . n A 1 56 VAL 56 51 51 VAL VAL A . n A 1 57 VAL 57 52 52 VAL VAL A . n A 1 58 GLY 58 53 53 GLY GLY A . n A 1 59 GLY 59 54 54 GLY GLY A . n A 1 60 GLN 60 55 55 GLN GLN A . n A 1 61 ARG 61 56 56 ARG ARG A . n A 1 62 ALA 62 57 57 ALA ALA A . n A 1 63 ALA 63 58 58 ALA ALA A . n A 1 64 TRP 64 59 59 TRP TRP A . n A 1 65 ARG 65 60 60 ARG ARG A . n A 1 66 VAL 66 61 61 VAL VAL A . n A 1 67 LEU 67 62 62 LEU LEU A . n A 1 68 SER 68 63 63 SER SER A . n A 1 69 SER 69 64 64 SER SER A . n A 1 70 ILE 70 65 65 ILE ILE A . n A 1 71 GLU 71 66 66 GLU GLU A . n A 1 72 GLN 72 67 67 GLN GLN A . n A 1 73 LYS 73 68 68 LYS LYS A . n A 1 74 SER 74 69 69 SER SER A . n A 1 75 ASN 75 70 70 ASN ASN A . n A 1 76 GLU 76 71 71 GLU GLU A . n A 1 77 GLU 77 72 72 GLU GLU A . n A 1 78 GLY 78 73 73 GLY GLY A . n A 1 79 SER 79 74 74 SER SER A . n A 1 80 GLU 80 75 75 GLU GLU A . n A 1 81 GLU 81 76 76 GLU GLU A . n A 1 82 LYS 82 77 77 LYS LYS A . n A 1 83 GLY 83 78 78 GLY GLY A . n A 1 84 PRO 84 79 79 PRO PRO A . n A 1 85 GLU 85 80 80 GLU GLU A . n A 1 86 VAL 86 81 81 VAL VAL A . n A 1 87 ARG 87 82 82 ARG ARG A . n A 1 88 GLU 88 83 83 GLU GLU A . n A 1 89 TYR 89 84 84 TYR TYR A . n A 1 90 ARG 90 85 85 ARG ARG A . n A 1 91 GLU 91 86 86 GLU GLU A . n A 1 92 LYS 92 87 87 LYS LYS A . n A 1 93 VAL 93 88 88 VAL VAL A . n A 1 94 GLU 94 89 89 GLU GLU A . n A 1 95 THR 95 90 90 THR THR A . n A 1 96 GLU 96 91 91 GLU GLU A . n A 1 97 LEU 97 92 92 LEU LEU A . n A 1 98 GLN 98 93 93 GLN GLN A . n A 1 99 GLY 99 94 94 GLY GLY A . n A 1 100 VAL 100 95 95 VAL VAL A . n A 1 101 CYS 101 96 96 CYS CYS A . n A 1 102 ASP 102 97 97 ASP ASP A . n A 1 103 THR 103 98 98 THR THR A . n A 1 104 VAL 104 99 99 VAL VAL A . n A 1 105 LEU 105 100 100 LEU LEU A . n A 1 106 GLY 106 101 101 GLY GLY A . n A 1 107 LEU 107 102 102 LEU LEU A . n A 1 108 LEU 108 103 103 LEU LEU A . n A 1 109 ASP 109 104 104 ASP ASP A . n A 1 110 SER 110 105 105 SER SER A . n A 1 111 HIS 111 106 106 HIS HIS A . n A 1 112 LEU 112 107 107 LEU LEU A . n A 1 113 ILE 113 108 108 ILE ILE A . n A 1 114 LYS 114 109 109 LYS LYS A . n A 1 115 GLU 115 110 110 GLU GLU A . n A 1 116 ALA 116 111 111 ALA ALA A . n A 1 117 GLY 117 112 112 GLY GLY A . n A 1 118 ASP 118 113 113 ASP ASP A . n A 1 119 ALA 119 114 114 ALA ALA A . n A 1 120 GLU 120 115 115 GLU GLU A . n A 1 121 SER 121 116 116 SER SER A . n A 1 122 ARG 122 117 117 ARG ARG A . n A 1 123 VAL 123 118 118 VAL VAL A . n A 1 124 PHE 124 119 119 PHE PHE A . n A 1 125 TYR 125 120 120 TYR TYR A . n A 1 126 LEU 126 121 121 LEU LEU A . n A 1 127 LYS 127 122 122 LYS LYS A . n A 1 128 MET 128 123 123 MET MET A . n A 1 129 LYS 129 124 124 LYS LYS A . n A 1 130 GLY 130 125 125 GLY GLY A . n A 1 131 ASP 131 126 126 ASP ASP A . n A 1 132 TYR 132 127 127 TYR TYR A . n A 1 133 TYR 133 128 128 TYR TYR A . n A 1 134 ARG 134 129 129 ARG ARG A . n A 1 135 TYR 135 130 130 TYR TYR A . n A 1 136 LEU 136 131 131 LEU LEU A . n A 1 137 ALA 137 132 132 ALA ALA A . n A 1 138 GLU 138 133 133 GLU GLU A . n A 1 139 VAL 139 134 134 VAL VAL A . n A 1 140 ALA 140 135 135 ALA ALA A . n A 1 141 THR 141 136 136 THR THR A . n A 1 142 GLY 142 137 137 GLY GLY A . n A 1 143 ASP 143 138 138 ASP ASP A . n A 1 144 ASP 144 139 139 ASP ASP A . n A 1 145 LYS 145 140 140 LYS LYS A . n A 1 146 LYS 146 141 141 LYS LYS A . n A 1 147 ARG 147 142 142 ARG ARG A . n A 1 148 ILE 148 143 143 ILE ILE A . n A 1 149 ILE 149 144 144 ILE ILE A . n A 1 150 ASP 150 145 145 ASP ASP A . n A 1 151 SER 151 146 146 SER SER A . n A 1 152 ALA 152 147 147 ALA ALA A . n A 1 153 ARG 153 148 148 ARG ARG A . n A 1 154 SER 154 149 149 SER SER A . n A 1 155 ALA 155 150 150 ALA ALA A . n A 1 156 TYR 156 151 151 TYR TYR A . n A 1 157 GLN 157 152 152 GLN GLN A . n A 1 158 GLU 158 153 153 GLU GLU A . n A 1 159 ALA 159 154 154 ALA ALA A . n A 1 160 MET 160 155 155 MET MET A . n A 1 161 ASP 161 156 156 ASP ASP A . n A 1 162 ILE 162 157 157 ILE ILE A . n A 1 163 SER 163 158 158 SER SER A . n A 1 164 LYS 164 159 159 LYS LYS A . n A 1 165 LYS 165 160 160 LYS LYS A . n A 1 166 GLU 166 161 161 GLU GLU A . n A 1 167 MET 167 162 162 MET MET A . n A 1 168 PRO 168 163 163 PRO PRO A . n A 1 169 PRO 169 164 164 PRO PRO A . n A 1 170 THR 170 165 165 THR THR A . n A 1 171 ASN 171 166 166 ASN ASN A . n A 1 172 PRO 172 167 167 PRO PRO A . n A 1 173 ILE 173 168 168 ILE ILE A . n A 1 174 ARG 174 169 169 ARG ARG A . n A 1 175 LEU 175 170 170 LEU LEU A . n A 1 176 GLY 176 171 171 GLY GLY A . n A 1 177 LEU 177 172 172 LEU LEU A . n A 1 178 ALA 178 173 173 ALA ALA A . n A 1 179 LEU 179 174 174 LEU LEU A . n A 1 180 ASN 180 175 175 ASN ASN A . n A 1 181 PHE 181 176 176 PHE PHE A . n A 1 182 SER 182 177 177 SER SER A . n A 1 183 VAL 183 178 178 VAL VAL A . n A 1 184 PHE 184 179 179 PHE PHE A . n A 1 185 HIS 185 180 180 HIS HIS A . n A 1 186 TYR 186 181 181 TYR TYR A . n A 1 187 GLU 187 182 182 GLU GLU A . n A 1 188 ILE 188 183 183 ILE ILE A . n A 1 189 ALA 189 184 184 ALA ALA A . n A 1 190 ASN 190 185 185 ASN ASN A . n A 1 191 SER 191 186 186 SER SER A . n A 1 192 PRO 192 187 187 PRO PRO A . n A 1 193 GLU 193 188 188 GLU GLU A . n A 1 194 GLU 194 189 189 GLU GLU A . n A 1 195 ALA 195 190 190 ALA ALA A . n A 1 196 ILE 196 191 191 ILE ILE A . n A 1 197 SER 197 192 192 SER SER A . n A 1 198 LEU 198 193 193 LEU LEU A . n A 1 199 ALA 199 194 194 ALA ALA A . n A 1 200 LYS 200 195 195 LYS LYS A . n A 1 201 THR 201 196 196 THR THR A . n A 1 202 THR 202 197 197 THR THR A . n A 1 203 PHE 203 198 198 PHE PHE A . n A 1 204 ASP 204 199 199 ASP ASP A . n A 1 205 GLU 205 200 200 GLU GLU A . n A 1 206 ALA 206 201 201 ALA ALA A . n A 1 207 MET 207 202 202 MET MET A . n A 1 208 ALA 208 203 203 ALA ALA A . n A 1 209 ASP 209 204 204 ASP ASP A . n A 1 210 LEU 210 205 205 LEU LEU A . n A 1 211 HIS 211 206 206 HIS HIS A . n A 1 212 THR 212 207 207 THR THR A . n A 1 213 LEU 213 208 208 LEU LEU A . n A 1 214 SER 214 209 209 SER SER A . n A 1 215 GLU 215 210 210 GLU GLU A . n A 1 216 ASP 216 211 211 ASP ASP A . n A 1 217 SER 217 212 212 SER SER A . n A 1 218 TYR 218 213 213 TYR TYR A . n A 1 219 LYS 219 214 214 LYS LYS A . n A 1 220 ASP 220 215 215 ASP ASP A . n A 1 221 SER 221 216 216 SER SER A . n A 1 222 THR 222 217 217 THR THR A . n A 1 223 LEU 223 218 218 LEU LEU A . n A 1 224 ILE 224 219 219 ILE ILE A . n A 1 225 MET 225 220 220 MET MET A . n A 1 226 GLN 226 221 221 GLN GLN A . n A 1 227 LEU 227 222 222 LEU LEU A . n A 1 228 LEU 228 223 223 LEU LEU A . n A 1 229 ARG 229 224 224 ARG ARG A . n A 1 230 ASP 230 225 225 ASP ASP A . n A 1 231 ASN 231 226 226 ASN ASN A . n A 1 232 LEU 232 227 227 LEU LEU A . n A 1 233 THR 233 228 228 THR THR A . n A 1 234 LEU 234 229 229 LEU LEU A . n A 1 235 TRP 235 230 230 TRP TRP A . n A 1 236 THR 236 231 231 THR THR A . n B 2 1 ARG 1 124 124 ARG ARG P . n B 2 2 SER 2 125 125 SER SER P . n B 2 3 HIS 3 126 126 HIS HIS P . n B 2 4 SEP 4 127 127 SEP SEP P . n B 2 5 SER 5 128 128 SER SER P . n B 2 6 PRO 6 129 129 PRO PRO P . n B 2 7 ALA 7 130 130 ALA ALA P . n B 2 8 SER 8 131 131 SER SER P . n B 2 9 LEU 9 132 132 LEU LEU P . n B 2 10 GLN 10 133 133 GLN GLN P . n B 2 11 LEU 11 134 ? ? ? P . n B 2 12 GLY 12 135 ? ? ? P . n B 2 13 THR 13 136 ? ? ? P . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 KDK 1 301 1 KDK LIG A . D 4 CA 1 302 1 CA CA A . E 5 NA 1 303 2 NA NA A . F 6 HOH 1 401 67 HOH HOH A . F 6 HOH 2 402 252 HOH HOH A . F 6 HOH 3 403 305 HOH HOH A . F 6 HOH 4 404 303 HOH HOH A . F 6 HOH 5 405 255 HOH HOH A . F 6 HOH 6 406 231 HOH HOH A . F 6 HOH 7 407 319 HOH HOH A . F 6 HOH 8 408 321 HOH HOH A . F 6 HOH 9 409 90 HOH HOH A . F 6 HOH 10 410 58 HOH HOH A . F 6 HOH 11 411 261 HOH HOH A . F 6 HOH 12 412 192 HOH HOH A . F 6 HOH 13 413 49 HOH HOH A . F 6 HOH 14 414 173 HOH HOH A . F 6 HOH 15 415 243 HOH HOH A . F 6 HOH 16 416 246 HOH HOH A . F 6 HOH 17 417 103 HOH HOH A . F 6 HOH 18 418 117 HOH HOH A . F 6 HOH 19 419 175 HOH HOH A . F 6 HOH 20 420 41 HOH HOH A . F 6 HOH 21 421 187 HOH HOH A . F 6 HOH 22 422 141 HOH HOH A . F 6 HOH 23 423 143 HOH HOH A . F 6 HOH 24 424 77 HOH HOH A . F 6 HOH 25 425 20 HOH HOH A . F 6 HOH 26 426 337 HOH HOH A . F 6 HOH 27 427 163 HOH HOH A . F 6 HOH 28 428 17 HOH HOH A . F 6 HOH 29 429 167 HOH HOH A . F 6 HOH 30 430 241 HOH HOH A . F 6 HOH 31 431 33 HOH HOH A . F 6 HOH 32 432 273 HOH HOH A . F 6 HOH 33 433 73 HOH HOH A . F 6 HOH 34 434 64 HOH HOH A . F 6 HOH 35 435 253 HOH HOH A . F 6 HOH 36 436 133 HOH HOH A . F 6 HOH 37 437 247 HOH HOH A . F 6 HOH 38 438 196 HOH HOH A . F 6 HOH 39 439 32 HOH HOH A . F 6 HOH 40 440 314 HOH HOH A . F 6 HOH 41 441 28 HOH HOH A . F 6 HOH 42 442 76 HOH HOH A . F 6 HOH 43 443 296 HOH HOH A . F 6 HOH 44 444 182 HOH HOH A . F 6 HOH 45 445 4 HOH HOH A . F 6 HOH 46 446 105 HOH HOH A . F 6 HOH 47 447 16 HOH HOH A . F 6 HOH 48 448 11 HOH HOH A . F 6 HOH 49 449 158 HOH HOH A . F 6 HOH 50 450 263 HOH HOH A . F 6 HOH 51 451 300 HOH HOH A . F 6 HOH 52 452 276 HOH HOH A . F 6 HOH 53 453 107 HOH HOH A . F 6 HOH 54 454 304 HOH HOH A . F 6 HOH 55 455 211 HOH HOH A . F 6 HOH 56 456 57 HOH HOH A . F 6 HOH 57 457 51 HOH HOH A . F 6 HOH 58 458 9 HOH HOH A . F 6 HOH 59 459 106 HOH HOH A . F 6 HOH 60 460 48 HOH HOH A . F 6 HOH 61 461 202 HOH HOH A . F 6 HOH 62 462 248 HOH HOH A . F 6 HOH 63 463 7 HOH HOH A . F 6 HOH 64 464 219 HOH HOH A . F 6 HOH 65 465 271 HOH HOH A . F 6 HOH 66 466 178 HOH HOH A . F 6 HOH 67 467 6 HOH HOH A . F 6 HOH 68 468 63 HOH HOH A . F 6 HOH 69 469 5 HOH HOH A . F 6 HOH 70 470 26 HOH HOH A . F 6 HOH 71 471 92 HOH HOH A . F 6 HOH 72 472 399 HOH HOH A . F 6 HOH 73 473 115 HOH HOH A . F 6 HOH 74 474 31 HOH HOH A . F 6 HOH 75 475 137 HOH HOH A . F 6 HOH 76 476 292 HOH HOH A . F 6 HOH 77 477 244 HOH HOH A . F 6 HOH 78 478 50 HOH HOH A . F 6 HOH 79 479 13 HOH HOH A . F 6 HOH 80 480 66 HOH HOH A . F 6 HOH 81 481 29 HOH HOH A . F 6 HOH 82 482 38 HOH HOH A . F 6 HOH 83 483 186 HOH HOH A . F 6 HOH 84 484 290 HOH HOH A . F 6 HOH 85 485 134 HOH HOH A . F 6 HOH 86 486 180 HOH HOH A . F 6 HOH 87 487 236 HOH HOH A . F 6 HOH 88 488 312 HOH HOH A . F 6 HOH 89 489 272 HOH HOH A . F 6 HOH 90 490 201 HOH HOH A . F 6 HOH 91 491 346 HOH HOH A . F 6 HOH 92 492 79 HOH HOH A . F 6 HOH 93 493 8 HOH HOH A . F 6 HOH 94 494 19 HOH HOH A . F 6 HOH 95 495 68 HOH HOH A . F 6 HOH 96 496 188 HOH HOH A . F 6 HOH 97 497 308 HOH HOH A . F 6 HOH 98 498 12 HOH HOH A . F 6 HOH 99 499 108 HOH HOH A . F 6 HOH 100 500 27 HOH HOH A . F 6 HOH 101 501 25 HOH HOH A . F 6 HOH 102 502 120 HOH HOH A . F 6 HOH 103 503 47 HOH HOH A . F 6 HOH 104 504 59 HOH HOH A . F 6 HOH 105 505 65 HOH HOH A . F 6 HOH 106 506 71 HOH HOH A . F 6 HOH 107 507 333 HOH HOH A . F 6 HOH 108 508 160 HOH HOH A . F 6 HOH 109 509 81 HOH HOH A . F 6 HOH 110 510 74 HOH HOH A . F 6 HOH 111 511 151 HOH HOH A . F 6 HOH 112 512 267 HOH HOH A . F 6 HOH 113 513 122 HOH HOH A . F 6 HOH 114 514 171 HOH HOH A . F 6 HOH 115 515 155 HOH HOH A . F 6 HOH 116 516 242 HOH HOH A . F 6 HOH 117 517 177 HOH HOH A . F 6 HOH 118 518 100 HOH HOH A . F 6 HOH 119 519 144 HOH HOH A . F 6 HOH 120 520 18 HOH HOH A . F 6 HOH 121 521 306 HOH HOH A . F 6 HOH 122 522 91 HOH HOH A . F 6 HOH 123 523 232 HOH HOH A . F 6 HOH 124 524 135 HOH HOH A . F 6 HOH 125 525 34 HOH HOH A . F 6 HOH 126 526 224 HOH HOH A . F 6 HOH 127 527 55 HOH HOH A . F 6 HOH 128 528 204 HOH HOH A . F 6 HOH 129 529 149 HOH HOH A . F 6 HOH 130 530 3 HOH HOH A . F 6 HOH 131 531 78 HOH HOH A . F 6 HOH 132 532 381 HOH HOH A . F 6 HOH 133 533 87 HOH HOH A . F 6 HOH 134 534 323 HOH HOH A . F 6 HOH 135 535 35 HOH HOH A . F 6 HOH 136 536 104 HOH HOH A . F 6 HOH 137 537 129 HOH HOH A . F 6 HOH 138 538 297 HOH HOH A . F 6 HOH 139 539 80 HOH HOH A . F 6 HOH 140 540 307 HOH HOH A . F 6 HOH 141 541 162 HOH HOH A . F 6 HOH 142 542 37 HOH HOH A . F 6 HOH 143 543 159 HOH HOH A . F 6 HOH 144 544 124 HOH HOH A . F 6 HOH 145 545 44 HOH HOH A . F 6 HOH 146 546 83 HOH HOH A . F 6 HOH 147 547 111 HOH HOH A . F 6 HOH 148 548 24 HOH HOH A . F 6 HOH 149 549 42 HOH HOH A . F 6 HOH 150 550 45 HOH HOH A . F 6 HOH 151 551 179 HOH HOH A . F 6 HOH 152 552 22 HOH HOH A . F 6 HOH 153 553 72 HOH HOH A . F 6 HOH 154 554 14 HOH HOH A . F 6 HOH 155 555 88 HOH HOH A . F 6 HOH 156 556 1 HOH HOH A . F 6 HOH 157 557 154 HOH HOH A . F 6 HOH 158 558 52 HOH HOH A . F 6 HOH 159 559 21 HOH HOH A . F 6 HOH 160 560 23 HOH HOH A . F 6 HOH 161 561 85 HOH HOH A . F 6 HOH 162 562 10 HOH HOH A . F 6 HOH 163 563 298 HOH HOH A . F 6 HOH 164 564 237 HOH HOH A . F 6 HOH 165 565 86 HOH HOH A . F 6 HOH 166 566 172 HOH HOH A . F 6 HOH 167 567 165 HOH HOH A . F 6 HOH 168 568 36 HOH HOH A . F 6 HOH 169 569 121 HOH HOH A . F 6 HOH 170 570 61 HOH HOH A . F 6 HOH 171 571 199 HOH HOH A . F 6 HOH 172 572 39 HOH HOH A . F 6 HOH 173 573 270 HOH HOH A . F 6 HOH 174 574 43 HOH HOH A . F 6 HOH 175 575 54 HOH HOH A . F 6 HOH 176 576 40 HOH HOH A . F 6 HOH 177 577 302 HOH HOH A . F 6 HOH 178 578 225 HOH HOH A . F 6 HOH 179 579 191 HOH HOH A . F 6 HOH 180 580 170 HOH HOH A . F 6 HOH 181 581 30 HOH HOH A . F 6 HOH 182 582 222 HOH HOH A . F 6 HOH 183 583 229 HOH HOH A . F 6 HOH 184 584 119 HOH HOH A . F 6 HOH 185 585 113 HOH HOH A . F 6 HOH 186 586 156 HOH HOH A . F 6 HOH 187 587 116 HOH HOH A . F 6 HOH 188 588 198 HOH HOH A . F 6 HOH 189 589 264 HOH HOH A . F 6 HOH 190 590 166 HOH HOH A . F 6 HOH 191 591 289 HOH HOH A . F 6 HOH 192 592 164 HOH HOH A . F 6 HOH 193 593 278 HOH HOH A . F 6 HOH 194 594 282 HOH HOH A . F 6 HOH 195 595 150 HOH HOH A . F 6 HOH 196 596 62 HOH HOH A . F 6 HOH 197 597 210 HOH HOH A . F 6 HOH 198 598 328 HOH HOH A . F 6 HOH 199 599 153 HOH HOH A . F 6 HOH 200 600 295 HOH HOH A . F 6 HOH 201 601 75 HOH HOH A . F 6 HOH 202 602 139 HOH HOH A . F 6 HOH 203 603 194 HOH HOH A . F 6 HOH 204 604 371 HOH HOH A . F 6 HOH 205 605 279 HOH HOH A . F 6 HOH 206 606 239 HOH HOH A . F 6 HOH 207 607 316 HOH HOH A . F 6 HOH 208 608 185 HOH HOH A . F 6 HOH 209 609 82 HOH HOH A . F 6 HOH 210 610 280 HOH HOH A . F 6 HOH 211 611 327 HOH HOH A . F 6 HOH 212 612 99 HOH HOH A . F 6 HOH 213 613 94 HOH HOH A . F 6 HOH 214 614 286 HOH HOH A . F 6 HOH 215 615 238 HOH HOH A . F 6 HOH 216 616 259 HOH HOH A . F 6 HOH 217 617 96 HOH HOH A . F 6 HOH 218 618 275 HOH HOH A . F 6 HOH 219 619 258 HOH HOH A . F 6 HOH 220 620 390 HOH HOH A . F 6 HOH 221 621 382 HOH HOH A . F 6 HOH 222 622 324 HOH HOH A . F 6 HOH 223 623 373 HOH HOH A . F 6 HOH 224 624 197 HOH HOH A . F 6 HOH 225 625 384 HOH HOH A . F 6 HOH 226 626 226 HOH HOH A . F 6 HOH 227 627 213 HOH HOH A . F 6 HOH 228 628 313 HOH HOH A . F 6 HOH 229 629 70 HOH HOH A . F 6 HOH 230 630 294 HOH HOH A . F 6 HOH 231 631 257 HOH HOH A . F 6 HOH 232 632 342 HOH HOH A . F 6 HOH 233 633 329 HOH HOH A . F 6 HOH 234 634 234 HOH HOH A . F 6 HOH 235 635 132 HOH HOH A . F 6 HOH 236 636 355 HOH HOH A . F 6 HOH 237 637 95 HOH HOH A . F 6 HOH 238 638 140 HOH HOH A . F 6 HOH 239 639 309 HOH HOH A . F 6 HOH 240 640 347 HOH HOH A . F 6 HOH 241 641 148 HOH HOH A . F 6 HOH 242 642 285 HOH HOH A . F 6 HOH 243 643 336 HOH HOH A . F 6 HOH 244 644 364 HOH HOH A . F 6 HOH 245 645 359 HOH HOH A . F 6 HOH 246 646 348 HOH HOH A . F 6 HOH 247 647 123 HOH HOH A . F 6 HOH 248 648 206 HOH HOH A . F 6 HOH 249 649 230 HOH HOH A . F 6 HOH 250 650 365 HOH HOH A . F 6 HOH 251 651 394 HOH HOH A . F 6 HOH 252 652 215 HOH HOH A . F 6 HOH 253 653 274 HOH HOH A . F 6 HOH 254 654 118 HOH HOH A . F 6 HOH 255 655 157 HOH HOH A . F 6 HOH 256 656 130 HOH HOH A . F 6 HOH 257 657 217 HOH HOH A . F 6 HOH 258 658 293 HOH HOH A . F 6 HOH 259 659 250 HOH HOH A . F 6 HOH 260 660 330 HOH HOH A . F 6 HOH 261 661 317 HOH HOH A . F 6 HOH 262 662 350 HOH HOH A . F 6 HOH 263 663 15 HOH HOH A . F 6 HOH 264 664 89 HOH HOH A . F 6 HOH 265 665 284 HOH HOH A . F 6 HOH 266 666 227 HOH HOH A . F 6 HOH 267 667 256 HOH HOH A . F 6 HOH 268 668 195 HOH HOH A . F 6 HOH 269 669 109 HOH HOH A . F 6 HOH 270 670 203 HOH HOH A . F 6 HOH 271 671 168 HOH HOH A . F 6 HOH 272 672 60 HOH HOH A . F 6 HOH 273 673 142 HOH HOH A . F 6 HOH 274 674 69 HOH HOH A . F 6 HOH 275 675 98 HOH HOH A . F 6 HOH 276 676 136 HOH HOH A . F 6 HOH 277 677 145 HOH HOH A . F 6 HOH 278 678 315 HOH HOH A . F 6 HOH 279 679 161 HOH HOH A . F 6 HOH 280 680 169 HOH HOH A . F 6 HOH 281 681 152 HOH HOH A . F 6 HOH 282 682 366 HOH HOH A . F 6 HOH 283 683 146 HOH HOH A . F 6 HOH 284 684 235 HOH HOH A . F 6 HOH 285 685 212 HOH HOH A . F 6 HOH 286 686 349 HOH HOH A . F 6 HOH 287 687 221 HOH HOH A . F 6 HOH 288 688 260 HOH HOH A . F 6 HOH 289 689 97 HOH HOH A . F 6 HOH 290 690 102 HOH HOH A . F 6 HOH 291 691 216 HOH HOH A . F 6 HOH 292 692 131 HOH HOH A . F 6 HOH 293 693 341 HOH HOH A . F 6 HOH 294 694 352 HOH HOH A . F 6 HOH 295 695 218 HOH HOH A . F 6 HOH 296 696 127 HOH HOH A . F 6 HOH 297 697 183 HOH HOH A . F 6 HOH 298 698 114 HOH HOH A . F 6 HOH 299 699 208 HOH HOH A . F 6 HOH 300 700 174 HOH HOH A . F 6 HOH 301 701 268 HOH HOH A . F 6 HOH 302 702 126 HOH HOH A . F 6 HOH 303 703 265 HOH HOH A . F 6 HOH 304 704 386 HOH HOH A . F 6 HOH 305 705 56 HOH HOH A . F 6 HOH 306 706 301 HOH HOH A . F 6 HOH 307 707 406 HOH HOH A . F 6 HOH 308 708 254 HOH HOH A . F 6 HOH 309 709 200 HOH HOH A . F 6 HOH 310 710 233 HOH HOH A . F 6 HOH 311 711 189 HOH HOH A . F 6 HOH 312 712 112 HOH HOH A . F 6 HOH 313 713 385 HOH HOH A . F 6 HOH 314 714 138 HOH HOH A . F 6 HOH 315 715 128 HOH HOH A . F 6 HOH 316 716 46 HOH HOH A . F 6 HOH 317 717 205 HOH HOH A . F 6 HOH 318 718 331 HOH HOH A . F 6 HOH 319 719 318 HOH HOH A . F 6 HOH 320 720 404 HOH HOH A . G 6 HOH 1 201 277 HOH HOH P . G 6 HOH 2 202 345 HOH HOH P . G 6 HOH 3 203 193 HOH HOH P . G 6 HOH 4 204 93 HOH HOH P . G 6 HOH 5 205 184 HOH HOH P . G 6 HOH 6 206 110 HOH HOH P . G 6 HOH 7 207 2 HOH HOH P . G 6 HOH 8 208 176 HOH HOH P . G 6 HOH 9 209 84 HOH HOH P . G 6 HOH 10 210 125 HOH HOH P . G 6 HOH 11 211 291 HOH HOH P . G 6 HOH 12 212 181 HOH HOH P . G 6 HOH 13 213 287 HOH HOH P . G 6 HOH 14 214 411 HOH HOH P . G 6 HOH 15 215 101 HOH HOH P . G 6 HOH 16 216 351 HOH HOH P . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 68 ? CG ? A LYS 73 CG 2 1 Y 1 A LYS 68 ? CD ? A LYS 73 CD 3 1 Y 1 A LYS 68 ? CE ? A LYS 73 CE 4 1 Y 1 A LYS 68 ? NZ ? A LYS 73 NZ 5 1 Y 1 A GLU 71 ? CD ? A GLU 76 CD 6 1 Y 1 A GLU 71 ? OE1 ? A GLU 76 OE1 7 1 Y 1 A GLU 71 ? OE2 ? A GLU 76 OE2 8 1 Y 1 A GLU 72 ? CG ? A GLU 77 CG 9 1 Y 1 A GLU 72 ? CD ? A GLU 77 CD 10 1 Y 1 A GLU 72 ? OE1 ? A GLU 77 OE1 11 1 Y 1 A GLU 72 ? OE2 ? A GLU 77 OE2 12 1 Y 1 A SER 74 ? OG ? A SER 79 OG 13 1 Y 1 A GLU 76 ? CG ? A GLU 81 CG 14 1 Y 1 A GLU 76 ? CD ? A GLU 81 CD 15 1 Y 1 A GLU 76 ? OE1 ? A GLU 81 OE1 16 1 Y 1 A GLU 76 ? OE2 ? A GLU 81 OE2 17 1 Y 1 A LYS 77 ? CG ? A LYS 82 CG 18 1 Y 1 A LYS 77 ? CD ? A LYS 82 CD 19 1 Y 1 A LYS 77 ? CE ? A LYS 82 CE 20 1 Y 1 A LYS 77 ? NZ ? A LYS 82 NZ 21 1 Y 1 A GLU 115 ? CG ? A GLU 120 CG 22 1 Y 1 A GLU 115 ? CD ? A GLU 120 CD 23 1 Y 1 A GLU 115 ? OE1 ? A GLU 120 OE1 24 1 Y 1 A GLU 115 ? OE2 ? A GLU 120 OE2 25 1 Y 1 A ASP 138 ? CG ? A ASP 143 CG 26 1 Y 1 A ASP 138 ? OD1 ? A ASP 143 OD1 27 1 Y 1 A ASP 138 ? OD2 ? A ASP 143 OD2 28 1 Y 1 A ASP 139 ? CG ? A ASP 144 CG 29 1 Y 1 A ASP 139 ? OD1 ? A ASP 144 OD1 30 1 Y 1 A ASP 139 ? OD2 ? A ASP 144 OD2 31 1 Y 1 A LYS 160 ? CE ? A LYS 165 CE 32 1 Y 1 A LYS 160 ? NZ ? A LYS 165 NZ 33 1 Y 1 A GLU 210 ? CD ? A GLU 215 CD 34 1 Y 1 A GLU 210 ? OE1 ? A GLU 215 OE1 35 1 Y 1 A GLU 210 ? OE2 ? A GLU 215 OE2 36 1 Y 1 A LYS 214 ? CE ? A LYS 219 CE 37 1 Y 1 A LYS 214 ? NZ ? A LYS 219 NZ 38 1 Y 1 A ARG 224 ? CZ ? A ARG 229 CZ 39 1 Y 1 A ARG 224 ? NH1 ? A ARG 229 NH1 40 1 Y 1 A ARG 224 ? NH2 ? A ARG 229 NH2 41 1 Y 1 P ARG 124 ? CG ? B ARG 1 CG 42 1 Y 1 P ARG 124 ? CD ? B ARG 1 CD 43 1 Y 1 P ARG 124 ? NE ? B ARG 1 NE 44 1 Y 1 P ARG 124 ? CZ ? B ARG 1 CZ 45 1 Y 1 P ARG 124 ? NH1 ? B ARG 1 NH1 46 1 Y 1 P ARG 124 ? NH2 ? B ARG 1 NH2 47 1 Y 1 P GLN 133 ? CD ? B GLN 10 CD 48 1 Y 1 P GLN 133 ? OE1 ? B GLN 10 OE1 49 1 Y 1 P GLN 133 ? NE2 ? B GLN 10 NE2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.11.1_2575: ???)' 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? . 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? MOSFLM ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 5 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 6RP6 _cell.details ? _cell.formula_units_Z ? _cell.length_a 81.970 _cell.length_a_esd ? _cell.length_b 112.020 _cell.length_b_esd ? _cell.length_c 62.790 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6RP6 _symmetry.cell_setting ? _symmetry.Int_Tables_number 20 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6RP6 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.43 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 49.40 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.1 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.095 M Na-HEPES pH 7.1, 27% PEG400, 0.19 M Calcium chloride, 5% Glycerol' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 200K' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2017-08-02 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.54187 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source 'SEALED TUBE' _diffrn_source.target ? _diffrn_source.type 'RIGAKU MICROMAX-003' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.54187 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_synchrotron_site ? # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6RP6 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.62 _reflns.d_resolution_low 41.86 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 31371 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 83.4 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 5.6 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 14.0 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.082 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.998 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.62 _reflns_shell.d_res_low 1.64 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.1 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 111 _reflns_shell.percent_possible_all 6.1 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 1.2 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 0.391 _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.862 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6RP6 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.885 _refine.ls_d_res_low 25.576 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 23682 _refine.ls_number_reflns_R_free 1180 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.88 _refine.ls_percent_reflns_R_free 4.98 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1598 _refine.ls_R_factor_R_free 0.2201 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1568 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.35 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 3MHR _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 20.73 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.19 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.885 _refine_hist.d_res_low 25.576 _refine_hist.number_atoms_solvent 336 _refine_hist.number_atoms_total 2245 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1886 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 23 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.010 ? 2012 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.953 ? 2724 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 12.646 ? 1242 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.047 ? 299 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.006 ? 357 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.8850 1.9708 . . 141 2761 100.00 . . . 0.2549 . 0.2035 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.9708 2.0746 . . 142 2784 100.00 . . . 0.2729 . 0.1783 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.0746 2.2045 . . 150 2756 100.00 . . . 0.2317 . 0.1579 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.2045 2.3747 . . 164 2766 100.00 . . . 0.2064 . 0.1440 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.3747 2.6134 . . 145 2819 100.00 . . . 0.2037 . 0.1476 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.6134 2.9911 . . 142 2825 100.00 . . . 0.2434 . 0.1589 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.9911 3.7665 . . 151 2830 100.00 . . . 0.2029 . 0.1384 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.7665 25.5787 . . 145 2961 100.00 . . . 0.2019 . 0.1611 . . . . . . . . . . # _struct.entry_id 6RP6 _struct.title 'Fragment AZ-019 binding at the TAZpS89/14-3-3 sigma interface' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6RP6 _struct_keywords.text 'protein protein interaction, fragment soaking, stabilization, PEPTIDE BINDING PROTEIN' _struct_keywords.pdbx_keywords 'PEPTIDE BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? F N N 6 ? G N N 6 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP 1433S_HUMAN P31947 ? 1 ;MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPE VREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKK EMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWT ; 1 2 UNP WWTR1_HUMAN Q9GZV5 ? 2 RSHSSPASLQLGT 86 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 6RP6 A 6 ? 236 ? P31947 1 ? 231 ? 1 231 2 2 6RP6 P 1 ? 13 ? Q9GZV5 86 ? 98 ? 124 136 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6RP6 GLY A 1 ? UNP P31947 ? ? 'expression tag' -4 1 1 6RP6 ALA A 2 ? UNP P31947 ? ? 'expression tag' -3 2 1 6RP6 MET A 3 ? UNP P31947 ? ? 'expression tag' -2 3 1 6RP6 GLY A 4 ? UNP P31947 ? ? 'expression tag' -1 4 1 6RP6 SER A 5 ? UNP P31947 ? ? 'expression tag' 0 5 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 5570 ? 1 MORE -73 ? 1 'SSA (A^2)' 22920 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 4_555 x,-y,-z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLU A 7 ? ALA A 21 ? GLU A 2 ALA A 16 1 ? 15 HELX_P HELX_P2 AA2 ARG A 23 ? GLU A 36 ? ARG A 18 GLU A 31 1 ? 14 HELX_P HELX_P3 AA3 SER A 42 ? SER A 74 ? SER A 37 SER A 69 1 ? 33 HELX_P HELX_P4 AA4 PRO A 84 ? SER A 110 ? PRO A 79 SER A 105 1 ? 27 HELX_P HELX_P5 AA5 HIS A 111 ? ALA A 116 ? HIS A 106 ALA A 111 1 ? 6 HELX_P HELX_P6 AA6 ASP A 118 ? ALA A 140 ? ASP A 113 ALA A 135 1 ? 23 HELX_P HELX_P7 AA7 ASP A 144 ? MET A 167 ? ASP A 139 MET A 162 1 ? 24 HELX_P HELX_P8 AA8 ASN A 171 ? ILE A 188 ? ASN A 166 ILE A 183 1 ? 18 HELX_P HELX_P9 AA9 SER A 191 ? ALA A 208 ? SER A 186 ALA A 203 1 ? 18 HELX_P HELX_P10 AB1 ASP A 209 ? LEU A 213 ? ASP A 204 LEU A 208 5 ? 5 HELX_P HELX_P11 AB2 SER A 214 ? THR A 236 ? SER A 209 THR A 231 1 ? 23 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? B HIS 3 C ? ? ? 1_555 B SEP 4 N ? ? P HIS 126 P SEP 127 1_555 ? ? ? ? ? ? ? 1.327 ? ? covale2 covale both ? B SEP 4 C ? ? ? 1_555 B SER 5 N ? ? P SEP 127 P SER 128 1_555 ? ? ? ? ? ? ? 1.321 ? ? metalc1 metalc ? ? A GLU 40 OE1 ? ? ? 1_555 D CA . CA ? ? A GLU 35 A CA 302 1_555 ? ? ? ? ? ? ? 2.526 ? ? metalc2 metalc ? ? A GLU 40 OE2 ? ? ? 1_555 D CA . CA ? ? A GLU 35 A CA 302 1_555 ? ? ? ? ? ? ? 2.317 ? ? metalc3 metalc ? ? A GLU 91 OE1 ? ? ? 1_555 E NA . NA ? ? A GLU 86 A NA 303 1_555 ? ? ? ? ? ? ? 2.394 ? ? metalc4 metalc ? ? A GLU 91 OE2 ? ? ? 1_555 E NA . NA ? ? A GLU 86 A NA 303 1_555 ? ? ? ? ? ? ? 2.423 ? ? metalc5 metalc ? ? A GLU 94 OE2 ? ? ? 1_555 E NA . NA ? ? A GLU 89 A NA 303 1_555 ? ? ? ? ? ? ? 2.361 ? ? metalc6 metalc ? ? A GLU 115 O A ? ? 1_555 D CA . CA ? ? A GLU 110 A CA 302 1_555 ? ? ? ? ? ? ? 2.241 ? ? metalc7 metalc ? ? A GLU 115 O B ? ? 1_555 D CA . CA ? ? A GLU 110 A CA 302 1_555 ? ? ? ? ? ? ? 2.266 ? ? metalc8 metalc ? ? A GLU 193 OE2 ? ? ? 1_555 D CA . CA ? ? A GLU 188 A CA 302 6_554 ? ? ? ? ? ? ? 2.294 ? ? metalc9 metalc ? ? D CA . CA ? ? ? 1_555 F HOH . O ? ? A CA 302 A HOH 526 6_555 ? ? ? ? ? ? ? 2.335 ? ? metalc10 metalc ? ? D CA . CA ? ? ? 1_555 F HOH . O ? ? A CA 302 A HOH 528 1_555 ? ? ? ? ? ? ? 2.319 ? ? metalc11 metalc ? ? D CA . CA ? ? ? 1_555 F HOH . O ? ? A CA 302 A HOH 602 1_555 ? ? ? ? ? ? ? 2.371 ? ? metalc12 metalc ? ? E NA . NA ? ? ? 1_555 F HOH . O ? ? A NA 303 A HOH 436 1_555 ? ? ? ? ? ? ? 2.197 ? ? metalc13 metalc ? ? E NA . NA ? ? ? 1_555 F HOH . O ? ? A NA 303 A HOH 513 1_555 ? ? ? ? ? ? ? 2.244 ? ? metalc14 metalc ? ? E NA . NA ? ? ? 1_555 F HOH . O ? ? A NA 303 A HOH 607 1_555 ? ? ? ? ? ? ? 2.610 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OE1 ? A GLU 40 ? A GLU 35 ? 1_555 CA ? D CA . ? A CA 302 ? 1_555 OE2 ? A GLU 40 ? A GLU 35 ? 1_555 53.1 ? 2 OE1 ? A GLU 40 ? A GLU 35 ? 1_555 CA ? D CA . ? A CA 302 ? 1_555 O A A GLU 115 ? A GLU 110 ? 1_555 87.0 ? 3 OE2 ? A GLU 40 ? A GLU 35 ? 1_555 CA ? D CA . ? A CA 302 ? 1_555 O A A GLU 115 ? A GLU 110 ? 1_555 88.3 ? 4 OE1 ? A GLU 40 ? A GLU 35 ? 1_555 CA ? D CA . ? A CA 302 ? 1_555 O B A GLU 115 ? A GLU 110 ? 1_555 83.0 ? 5 OE2 ? A GLU 40 ? A GLU 35 ? 1_555 CA ? D CA . ? A CA 302 ? 1_555 O B A GLU 115 ? A GLU 110 ? 1_555 84.7 ? 6 O A A GLU 115 ? A GLU 110 ? 1_555 CA ? D CA . ? A CA 302 ? 1_555 O B A GLU 115 ? A GLU 110 ? 1_555 4.3 ? 7 OE1 ? A GLU 40 ? A GLU 35 ? 1_555 CA ? D CA . ? A CA 302 ? 1_555 OE2 ? A GLU 193 ? A GLU 188 ? 1_555 88.9 ? 8 OE2 ? A GLU 40 ? A GLU 35 ? 1_555 CA ? D CA . ? A CA 302 ? 1_555 OE2 ? A GLU 193 ? A GLU 188 ? 1_555 123.8 ? 9 O A A GLU 115 ? A GLU 110 ? 1_555 CA ? D CA . ? A CA 302 ? 1_555 OE2 ? A GLU 193 ? A GLU 188 ? 1_555 45.2 ? 10 O B A GLU 115 ? A GLU 110 ? 1_555 CA ? D CA . ? A CA 302 ? 1_555 OE2 ? A GLU 193 ? A GLU 188 ? 1_555 46.9 ? 11 OE1 ? A GLU 40 ? A GLU 35 ? 1_555 CA ? D CA . ? A CA 302 ? 1_555 O ? F HOH . ? A HOH 526 ? 6_555 146.5 ? 12 OE2 ? A GLU 40 ? A GLU 35 ? 1_555 CA ? D CA . ? A CA 302 ? 1_555 O ? F HOH . ? A HOH 526 ? 6_555 154.4 ? 13 O A A GLU 115 ? A GLU 110 ? 1_555 CA ? D CA . ? A CA 302 ? 1_555 O ? F HOH . ? A HOH 526 ? 6_555 105.8 ? 14 O B A GLU 115 ? A GLU 110 ? 1_555 CA ? D CA . ? A CA 302 ? 1_555 O ? F HOH . ? A HOH 526 ? 6_555 110.0 ? 15 OE2 ? A GLU 193 ? A GLU 188 ? 1_555 CA ? D CA . ? A CA 302 ? 1_555 O ? F HOH . ? A HOH 526 ? 6_555 79.7 ? 16 OE1 ? A GLU 40 ? A GLU 35 ? 1_555 CA ? D CA . ? A CA 302 ? 1_555 O ? F HOH . ? A HOH 528 ? 1_555 130.3 ? 17 OE2 ? A GLU 40 ? A GLU 35 ? 1_555 CA ? D CA . ? A CA 302 ? 1_555 O ? F HOH . ? A HOH 528 ? 1_555 77.7 ? 18 O A A GLU 115 ? A GLU 110 ? 1_555 CA ? D CA . ? A CA 302 ? 1_555 O ? F HOH . ? A HOH 528 ? 1_555 84.5 ? 19 O B A GLU 115 ? A GLU 110 ? 1_555 CA ? D CA . ? A CA 302 ? 1_555 O ? F HOH . ? A HOH 528 ? 1_555 86.1 ? 20 OE2 ? A GLU 193 ? A GLU 188 ? 1_555 CA ? D CA . ? A CA 302 ? 1_555 O ? F HOH . ? A HOH 528 ? 1_555 117.1 ? 21 O ? F HOH . ? A HOH 526 ? 6_555 CA ? D CA . ? A CA 302 ? 1_555 O ? F HOH . ? A HOH 528 ? 1_555 82.4 ? 22 OE1 ? A GLU 40 ? A GLU 35 ? 1_555 CA ? D CA . ? A CA 302 ? 1_555 O ? F HOH . ? A HOH 602 ? 1_555 90.7 ? 23 OE2 ? A GLU 40 ? A GLU 35 ? 1_555 CA ? D CA . ? A CA 302 ? 1_555 O ? F HOH . ? A HOH 602 ? 1_555 82.4 ? 24 O A A GLU 115 ? A GLU 110 ? 1_555 CA ? D CA . ? A CA 302 ? 1_555 O ? F HOH . ? A HOH 602 ? 1_555 169.8 ? 25 O B A GLU 115 ? A GLU 110 ? 1_555 CA ? D CA . ? A CA 302 ? 1_555 O ? F HOH . ? A HOH 602 ? 1_555 167.0 ? 26 OE2 ? A GLU 193 ? A GLU 188 ? 1_555 CA ? D CA . ? A CA 302 ? 1_555 O ? F HOH . ? A HOH 602 ? 1_555 144.8 ? 27 O ? F HOH . ? A HOH 526 ? 6_555 CA ? D CA . ? A CA 302 ? 1_555 O ? F HOH . ? A HOH 602 ? 1_555 81.5 ? 28 O ? F HOH . ? A HOH 528 ? 1_555 CA ? D CA . ? A CA 302 ? 1_555 O ? F HOH . ? A HOH 602 ? 1_555 89.4 ? 29 OE1 ? A GLU 91 ? A GLU 86 ? 1_555 NA ? E NA . ? A NA 303 ? 1_555 OE2 ? A GLU 91 ? A GLU 86 ? 1_555 54.6 ? 30 OE1 ? A GLU 91 ? A GLU 86 ? 1_555 NA ? E NA . ? A NA 303 ? 1_555 OE2 ? A GLU 94 ? A GLU 89 ? 1_555 101.7 ? 31 OE2 ? A GLU 91 ? A GLU 86 ? 1_555 NA ? E NA . ? A NA 303 ? 1_555 OE2 ? A GLU 94 ? A GLU 89 ? 1_555 91.5 ? 32 OE1 ? A GLU 91 ? A GLU 86 ? 1_555 NA ? E NA . ? A NA 303 ? 1_555 O ? F HOH . ? A HOH 436 ? 1_555 80.1 ? 33 OE2 ? A GLU 91 ? A GLU 86 ? 1_555 NA ? E NA . ? A NA 303 ? 1_555 O ? F HOH . ? A HOH 436 ? 1_555 134.0 ? 34 OE2 ? A GLU 94 ? A GLU 89 ? 1_555 NA ? E NA . ? A NA 303 ? 1_555 O ? F HOH . ? A HOH 436 ? 1_555 90.4 ? 35 OE1 ? A GLU 91 ? A GLU 86 ? 1_555 NA ? E NA . ? A NA 303 ? 1_555 O ? F HOH . ? A HOH 513 ? 1_555 127.5 ? 36 OE2 ? A GLU 91 ? A GLU 86 ? 1_555 NA ? E NA . ? A NA 303 ? 1_555 O ? F HOH . ? A HOH 513 ? 1_555 73.0 ? 37 OE2 ? A GLU 94 ? A GLU 89 ? 1_555 NA ? E NA . ? A NA 303 ? 1_555 O ? F HOH . ? A HOH 513 ? 1_555 81.5 ? 38 O ? F HOH . ? A HOH 436 ? 1_555 NA ? E NA . ? A NA 303 ? 1_555 O ? F HOH . ? A HOH 513 ? 1_555 152.2 ? 39 OE1 ? A GLU 91 ? A GLU 86 ? 1_555 NA ? E NA . ? A NA 303 ? 1_555 O ? F HOH . ? A HOH 607 ? 1_555 147.3 ? 40 OE2 ? A GLU 91 ? A GLU 86 ? 1_555 NA ? E NA . ? A NA 303 ? 1_555 O ? F HOH . ? A HOH 607 ? 1_555 154.4 ? 41 OE2 ? A GLU 94 ? A GLU 89 ? 1_555 NA ? E NA . ? A NA 303 ? 1_555 O ? F HOH . ? A HOH 607 ? 1_555 93.7 ? 42 O ? F HOH . ? A HOH 436 ? 1_555 NA ? E NA . ? A NA 303 ? 1_555 O ? F HOH . ? A HOH 607 ? 1_555 71.1 ? 43 O ? F HOH . ? A HOH 513 ? 1_555 NA ? E NA . ? A NA 303 ? 1_555 O ? F HOH . ? A HOH 607 ? 1_555 83.0 ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id SER _struct_mon_prot_cis.label_seq_id 110 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id SER _struct_mon_prot_cis.auth_seq_id 105 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 HIS _struct_mon_prot_cis.pdbx_label_seq_id_2 111 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 HIS _struct_mon_prot_cis.pdbx_auth_seq_id_2 106 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 8.29 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A KDK 301 ? 7 'binding site for residue KDK A 301' AC2 Software A CA 302 ? 6 'binding site for residue CA A 302' AC3 Software A NA 303 ? 5 'binding site for residue NA A 303' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 7 GLU A 19 ? GLU A 14 . ? 1_555 ? 2 AC1 7 GLU A 44 ? GLU A 39 . ? 1_555 ? 3 AC1 7 LEU A 48 ? LEU A 43 . ? 1_555 ? 4 AC1 7 ASP A 220 ? ASP A 215 . ? 1_555 ? 5 AC1 7 HOH F . ? HOH A 408 . ? 1_555 ? 6 AC1 7 HOH F . ? HOH A 433 . ? 1_555 ? 7 AC1 7 SER B 8 ? SER P 131 . ? 1_555 ? 8 AC2 6 GLU A 40 ? GLU A 35 . ? 1_555 ? 9 AC2 6 GLU A 115 ? GLU A 110 . ? 1_555 ? 10 AC2 6 GLU A 193 ? GLU A 188 . ? 6_555 ? 11 AC2 6 HOH F . ? HOH A 526 . ? 6_555 ? 12 AC2 6 HOH F . ? HOH A 528 . ? 1_555 ? 13 AC2 6 HOH F . ? HOH A 602 . ? 1_555 ? 14 AC3 5 GLU A 91 ? GLU A 86 . ? 1_555 ? 15 AC3 5 GLU A 94 ? GLU A 89 . ? 1_555 ? 16 AC3 5 HOH F . ? HOH A 436 . ? 1_555 ? 17 AC3 5 HOH F . ? HOH A 513 . ? 1_555 ? 18 AC3 5 HOH F . ? HOH A 607 . ? 1_555 ? # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 OE2 _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 GLU _pdbx_validate_symm_contact.auth_seq_id_1 110 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 A _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 OH _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 TYR _pdbx_validate_symm_contact.auth_seq_id_2 213 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 8_455 _pdbx_validate_symm_contact.dist 1.97 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 18 ? ? -107.36 75.86 2 1 LYS A 77 ? ? -67.41 -168.61 3 1 HIS A 106 ? ? -144.83 36.61 # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id B _pdbx_struct_mod_residue.label_comp_id SEP _pdbx_struct_mod_residue.label_seq_id 4 _pdbx_struct_mod_residue.auth_asym_id P _pdbx_struct_mod_residue.auth_comp_id SEP _pdbx_struct_mod_residue.auth_seq_id 127 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id SER _pdbx_struct_mod_residue.details 'modified residue' # loop_ _pdbx_distant_solvent_atoms.id _pdbx_distant_solvent_atoms.PDB_model_num _pdbx_distant_solvent_atoms.auth_atom_id _pdbx_distant_solvent_atoms.label_alt_id _pdbx_distant_solvent_atoms.auth_asym_id _pdbx_distant_solvent_atoms.auth_comp_id _pdbx_distant_solvent_atoms.auth_seq_id _pdbx_distant_solvent_atoms.PDB_ins_code _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance _pdbx_distant_solvent_atoms.neighbor_ligand_distance 1 1 O ? A HOH 719 ? 6.61 . 2 1 O ? A HOH 720 ? 7.77 . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 P LEU 134 ? B LEU 11 2 1 Y 1 P GLY 135 ? B GLY 12 3 1 Y 1 P THR 136 ? B THR 13 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CA CA CA N N 74 CYS N N N N 75 CYS CA C N R 76 CYS C C N N 77 CYS O O N N 78 CYS CB C N N 79 CYS SG S N N 80 CYS OXT O N N 81 CYS H H N N 82 CYS H2 H N N 83 CYS HA H N N 84 CYS HB2 H N N 85 CYS HB3 H N N 86 CYS HG H N N 87 CYS HXT H N N 88 GLN N N N N 89 GLN CA C N S 90 GLN C C N N 91 GLN O O N N 92 GLN CB C N N 93 GLN CG C N N 94 GLN CD C N N 95 GLN OE1 O N N 96 GLN NE2 N N N 97 GLN OXT O N N 98 GLN H H N N 99 GLN H2 H N N 100 GLN HA H N N 101 GLN HB2 H N N 102 GLN HB3 H N N 103 GLN HG2 H N N 104 GLN HG3 H N N 105 GLN HE21 H N N 106 GLN HE22 H N N 107 GLN HXT H N N 108 GLU N N N N 109 GLU CA C N S 110 GLU C C N N 111 GLU O O N N 112 GLU CB C N N 113 GLU CG C N N 114 GLU CD C N N 115 GLU OE1 O N N 116 GLU OE2 O N N 117 GLU OXT O N N 118 GLU H H N N 119 GLU H2 H N N 120 GLU HA H N N 121 GLU HB2 H N N 122 GLU HB3 H N N 123 GLU HG2 H N N 124 GLU HG3 H N N 125 GLU HE2 H N N 126 GLU HXT H N N 127 GLY N N N N 128 GLY CA C N N 129 GLY C C N N 130 GLY O O N N 131 GLY OXT O N N 132 GLY H H N N 133 GLY H2 H N N 134 GLY HA2 H N N 135 GLY HA3 H N N 136 GLY HXT H N N 137 HIS N N N N 138 HIS CA C N S 139 HIS C C N N 140 HIS O O N N 141 HIS CB C N N 142 HIS CG C Y N 143 HIS ND1 N Y N 144 HIS CD2 C Y N 145 HIS CE1 C Y N 146 HIS NE2 N Y N 147 HIS OXT O N N 148 HIS H H N N 149 HIS H2 H N N 150 HIS HA H N N 151 HIS HB2 H N N 152 HIS HB3 H N N 153 HIS HD1 H N N 154 HIS HD2 H N N 155 HIS HE1 H N N 156 HIS HE2 H N N 157 HIS HXT H N N 158 HOH O O N N 159 HOH H1 H N N 160 HOH H2 H N N 161 ILE N N N N 162 ILE CA C N S 163 ILE C C N N 164 ILE O O N N 165 ILE CB C N S 166 ILE CG1 C N N 167 ILE CG2 C N N 168 ILE CD1 C N N 169 ILE OXT O N N 170 ILE H H N N 171 ILE H2 H N N 172 ILE HA H N N 173 ILE HB H N N 174 ILE HG12 H N N 175 ILE HG13 H N N 176 ILE HG21 H N N 177 ILE HG22 H N N 178 ILE HG23 H N N 179 ILE HD11 H N N 180 ILE HD12 H N N 181 ILE HD13 H N N 182 ILE HXT H N N 183 KDK C10 C Y N 184 KDK C13 C Y N 185 KDK C15 C N N 186 KDK C17 C N N 187 KDK C20 C N N 188 KDK C21 C N N 189 KDK C02 C Y N 190 KDK C03 C Y N 191 KDK C04 C Y N 192 KDK C05 C Y N 193 KDK C06 C N N 194 KDK C09 C Y N 195 KDK C11 C Y N 196 KDK C12 C Y N 197 KDK C14 C Y N 198 KDK C16 C N N 199 KDK C18 C N N 200 KDK N07 N N N 201 KDK N08 N N N 202 KDK N19 N N N 203 KDK S01 S Y N 204 KDK H101 H N N 205 KDK H131 H N N 206 KDK H151 H N N 207 KDK H152 H N N 208 KDK H172 H N N 209 KDK H171 H N N 210 KDK H201 H N N 211 KDK H202 H N N 212 KDK H211 H N N 213 KDK H212 H N N 214 KDK H041 H N N 215 KDK H111 H N N 216 KDK H121 H N N 217 KDK H141 H N N 218 KDK H161 H N N 219 KDK H181 H N N 220 KDK H182 H N N 221 KDK H1 H N N 222 KDK H071 H N N 223 KDK H082 H N N 224 KDK H191 H N N 225 LEU N N N N 226 LEU CA C N S 227 LEU C C N N 228 LEU O O N N 229 LEU CB C N N 230 LEU CG C N N 231 LEU CD1 C N N 232 LEU CD2 C N N 233 LEU OXT O N N 234 LEU H H N N 235 LEU H2 H N N 236 LEU HA H N N 237 LEU HB2 H N N 238 LEU HB3 H N N 239 LEU HG H N N 240 LEU HD11 H N N 241 LEU HD12 H N N 242 LEU HD13 H N N 243 LEU HD21 H N N 244 LEU HD22 H N N 245 LEU HD23 H N N 246 LEU HXT H N N 247 LYS N N N N 248 LYS CA C N S 249 LYS C C N N 250 LYS O O N N 251 LYS CB C N N 252 LYS CG C N N 253 LYS CD C N N 254 LYS CE C N N 255 LYS NZ N N N 256 LYS OXT O N N 257 LYS H H N N 258 LYS H2 H N N 259 LYS HA H N N 260 LYS HB2 H N N 261 LYS HB3 H N N 262 LYS HG2 H N N 263 LYS HG3 H N N 264 LYS HD2 H N N 265 LYS HD3 H N N 266 LYS HE2 H N N 267 LYS HE3 H N N 268 LYS HZ1 H N N 269 LYS HZ2 H N N 270 LYS HZ3 H N N 271 LYS HXT H N N 272 MET N N N N 273 MET CA C N S 274 MET C C N N 275 MET O O N N 276 MET CB C N N 277 MET CG C N N 278 MET SD S N N 279 MET CE C N N 280 MET OXT O N N 281 MET H H N N 282 MET H2 H N N 283 MET HA H N N 284 MET HB2 H N N 285 MET HB3 H N N 286 MET HG2 H N N 287 MET HG3 H N N 288 MET HE1 H N N 289 MET HE2 H N N 290 MET HE3 H N N 291 MET HXT H N N 292 NA NA NA N N 293 PHE N N N N 294 PHE CA C N S 295 PHE C C N N 296 PHE O O N N 297 PHE CB C N N 298 PHE CG C Y N 299 PHE CD1 C Y N 300 PHE CD2 C Y N 301 PHE CE1 C Y N 302 PHE CE2 C Y N 303 PHE CZ C Y N 304 PHE OXT O N N 305 PHE H H N N 306 PHE H2 H N N 307 PHE HA H N N 308 PHE HB2 H N N 309 PHE HB3 H N N 310 PHE HD1 H N N 311 PHE HD2 H N N 312 PHE HE1 H N N 313 PHE HE2 H N N 314 PHE HZ H N N 315 PHE HXT H N N 316 PRO N N N N 317 PRO CA C N S 318 PRO C C N N 319 PRO O O N N 320 PRO CB C N N 321 PRO CG C N N 322 PRO CD C N N 323 PRO OXT O N N 324 PRO H H N N 325 PRO HA H N N 326 PRO HB2 H N N 327 PRO HB3 H N N 328 PRO HG2 H N N 329 PRO HG3 H N N 330 PRO HD2 H N N 331 PRO HD3 H N N 332 PRO HXT H N N 333 SEP N N N N 334 SEP CA C N S 335 SEP CB C N N 336 SEP OG O N N 337 SEP C C N N 338 SEP O O N N 339 SEP OXT O N N 340 SEP P P N N 341 SEP O1P O N N 342 SEP O2P O N N 343 SEP O3P O N N 344 SEP H H N N 345 SEP H2 H N N 346 SEP HA H N N 347 SEP HB2 H N N 348 SEP HB3 H N N 349 SEP HXT H N N 350 SEP HOP2 H N N 351 SEP HOP3 H N N 352 SER N N N N 353 SER CA C N S 354 SER C C N N 355 SER O O N N 356 SER CB C N N 357 SER OG O N N 358 SER OXT O N N 359 SER H H N N 360 SER H2 H N N 361 SER HA H N N 362 SER HB2 H N N 363 SER HB3 H N N 364 SER HG H N N 365 SER HXT H N N 366 THR N N N N 367 THR CA C N S 368 THR C C N N 369 THR O O N N 370 THR CB C N R 371 THR OG1 O N N 372 THR CG2 C N N 373 THR OXT O N N 374 THR H H N N 375 THR H2 H N N 376 THR HA H N N 377 THR HB H N N 378 THR HG1 H N N 379 THR HG21 H N N 380 THR HG22 H N N 381 THR HG23 H N N 382 THR HXT H N N 383 TRP N N N N 384 TRP CA C N S 385 TRP C C N N 386 TRP O O N N 387 TRP CB C N N 388 TRP CG C Y N 389 TRP CD1 C Y N 390 TRP CD2 C Y N 391 TRP NE1 N Y N 392 TRP CE2 C Y N 393 TRP CE3 C Y N 394 TRP CZ2 C Y N 395 TRP CZ3 C Y N 396 TRP CH2 C Y N 397 TRP OXT O N N 398 TRP H H N N 399 TRP H2 H N N 400 TRP HA H N N 401 TRP HB2 H N N 402 TRP HB3 H N N 403 TRP HD1 H N N 404 TRP HE1 H N N 405 TRP HE3 H N N 406 TRP HZ2 H N N 407 TRP HZ3 H N N 408 TRP HH2 H N N 409 TRP HXT H N N 410 TYR N N N N 411 TYR CA C N S 412 TYR C C N N 413 TYR O O N N 414 TYR CB C N N 415 TYR CG C Y N 416 TYR CD1 C Y N 417 TYR CD2 C Y N 418 TYR CE1 C Y N 419 TYR CE2 C Y N 420 TYR CZ C Y N 421 TYR OH O N N 422 TYR OXT O N N 423 TYR H H N N 424 TYR H2 H N N 425 TYR HA H N N 426 TYR HB2 H N N 427 TYR HB3 H N N 428 TYR HD1 H N N 429 TYR HD2 H N N 430 TYR HE1 H N N 431 TYR HE2 H N N 432 TYR HH H N N 433 TYR HXT H N N 434 VAL N N N N 435 VAL CA C N S 436 VAL C C N N 437 VAL O O N N 438 VAL CB C N N 439 VAL CG1 C N N 440 VAL CG2 C N N 441 VAL OXT O N N 442 VAL H H N N 443 VAL H2 H N N 444 VAL HA H N N 445 VAL HB H N N 446 VAL HG11 H N N 447 VAL HG12 H N N 448 VAL HG13 H N N 449 VAL HG21 H N N 450 VAL HG22 H N N 451 VAL HG23 H N N 452 VAL HXT H N N 453 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 KDK C15 C02 sing N N 173 KDK C15 C16 sing N N 174 KDK S01 C02 sing Y N 175 KDK S01 C05 sing Y N 176 KDK C21 C20 sing N N 177 KDK C21 C16 sing N N 178 KDK N07 C06 sing N N 179 KDK C02 C03 doub Y N 180 KDK C20 N19 sing N N 181 KDK C16 C17 sing N N 182 KDK N19 C18 sing N N 183 KDK C17 C18 sing N N 184 KDK C05 C06 sing N N 185 KDK C05 C04 doub Y N 186 KDK C06 N08 doub N N 187 KDK C03 C04 sing Y N 188 KDK C03 C09 sing N N 189 KDK C14 C09 doub Y N 190 KDK C14 C13 sing Y N 191 KDK C09 C10 sing Y N 192 KDK C13 C12 doub Y N 193 KDK C10 C11 doub Y N 194 KDK C12 C11 sing Y N 195 KDK C10 H101 sing N N 196 KDK C13 H131 sing N N 197 KDK C15 H151 sing N N 198 KDK C15 H152 sing N N 199 KDK C17 H172 sing N N 200 KDK C17 H171 sing N N 201 KDK C20 H201 sing N N 202 KDK C20 H202 sing N N 203 KDK C21 H211 sing N N 204 KDK C21 H212 sing N N 205 KDK C04 H041 sing N N 206 KDK C11 H111 sing N N 207 KDK C12 H121 sing N N 208 KDK C14 H141 sing N N 209 KDK C16 H161 sing N N 210 KDK C18 H181 sing N N 211 KDK C18 H182 sing N N 212 KDK N07 H1 sing N N 213 KDK N07 H071 sing N N 214 KDK N08 H082 sing N N 215 KDK N19 H191 sing N N 216 LEU N CA sing N N 217 LEU N H sing N N 218 LEU N H2 sing N N 219 LEU CA C sing N N 220 LEU CA CB sing N N 221 LEU CA HA sing N N 222 LEU C O doub N N 223 LEU C OXT sing N N 224 LEU CB CG sing N N 225 LEU CB HB2 sing N N 226 LEU CB HB3 sing N N 227 LEU CG CD1 sing N N 228 LEU CG CD2 sing N N 229 LEU CG HG sing N N 230 LEU CD1 HD11 sing N N 231 LEU CD1 HD12 sing N N 232 LEU CD1 HD13 sing N N 233 LEU CD2 HD21 sing N N 234 LEU CD2 HD22 sing N N 235 LEU CD2 HD23 sing N N 236 LEU OXT HXT sing N N 237 LYS N CA sing N N 238 LYS N H sing N N 239 LYS N H2 sing N N 240 LYS CA C sing N N 241 LYS CA CB sing N N 242 LYS CA HA sing N N 243 LYS C O doub N N 244 LYS C OXT sing N N 245 LYS CB CG sing N N 246 LYS CB HB2 sing N N 247 LYS CB HB3 sing N N 248 LYS CG CD sing N N 249 LYS CG HG2 sing N N 250 LYS CG HG3 sing N N 251 LYS CD CE sing N N 252 LYS CD HD2 sing N N 253 LYS CD HD3 sing N N 254 LYS CE NZ sing N N 255 LYS CE HE2 sing N N 256 LYS CE HE3 sing N N 257 LYS NZ HZ1 sing N N 258 LYS NZ HZ2 sing N N 259 LYS NZ HZ3 sing N N 260 LYS OXT HXT sing N N 261 MET N CA sing N N 262 MET N H sing N N 263 MET N H2 sing N N 264 MET CA C sing N N 265 MET CA CB sing N N 266 MET CA HA sing N N 267 MET C O doub N N 268 MET C OXT sing N N 269 MET CB CG sing N N 270 MET CB HB2 sing N N 271 MET CB HB3 sing N N 272 MET CG SD sing N N 273 MET CG HG2 sing N N 274 MET CG HG3 sing N N 275 MET SD CE sing N N 276 MET CE HE1 sing N N 277 MET CE HE2 sing N N 278 MET CE HE3 sing N N 279 MET OXT HXT sing N N 280 PHE N CA sing N N 281 PHE N H sing N N 282 PHE N H2 sing N N 283 PHE CA C sing N N 284 PHE CA CB sing N N 285 PHE CA HA sing N N 286 PHE C O doub N N 287 PHE C OXT sing N N 288 PHE CB CG sing N N 289 PHE CB HB2 sing N N 290 PHE CB HB3 sing N N 291 PHE CG CD1 doub Y N 292 PHE CG CD2 sing Y N 293 PHE CD1 CE1 sing Y N 294 PHE CD1 HD1 sing N N 295 PHE CD2 CE2 doub Y N 296 PHE CD2 HD2 sing N N 297 PHE CE1 CZ doub Y N 298 PHE CE1 HE1 sing N N 299 PHE CE2 CZ sing Y N 300 PHE CE2 HE2 sing N N 301 PHE CZ HZ sing N N 302 PHE OXT HXT sing N N 303 PRO N CA sing N N 304 PRO N CD sing N N 305 PRO N H sing N N 306 PRO CA C sing N N 307 PRO CA CB sing N N 308 PRO CA HA sing N N 309 PRO C O doub N N 310 PRO C OXT sing N N 311 PRO CB CG sing N N 312 PRO CB HB2 sing N N 313 PRO CB HB3 sing N N 314 PRO CG CD sing N N 315 PRO CG HG2 sing N N 316 PRO CG HG3 sing N N 317 PRO CD HD2 sing N N 318 PRO CD HD3 sing N N 319 PRO OXT HXT sing N N 320 SEP N CA sing N N 321 SEP N H sing N N 322 SEP N H2 sing N N 323 SEP CA CB sing N N 324 SEP CA C sing N N 325 SEP CA HA sing N N 326 SEP CB OG sing N N 327 SEP CB HB2 sing N N 328 SEP CB HB3 sing N N 329 SEP OG P sing N N 330 SEP C O doub N N 331 SEP C OXT sing N N 332 SEP OXT HXT sing N N 333 SEP P O1P doub N N 334 SEP P O2P sing N N 335 SEP P O3P sing N N 336 SEP O2P HOP2 sing N N 337 SEP O3P HOP3 sing N N 338 SER N CA sing N N 339 SER N H sing N N 340 SER N H2 sing N N 341 SER CA C sing N N 342 SER CA CB sing N N 343 SER CA HA sing N N 344 SER C O doub N N 345 SER C OXT sing N N 346 SER CB OG sing N N 347 SER CB HB2 sing N N 348 SER CB HB3 sing N N 349 SER OG HG sing N N 350 SER OXT HXT sing N N 351 THR N CA sing N N 352 THR N H sing N N 353 THR N H2 sing N N 354 THR CA C sing N N 355 THR CA CB sing N N 356 THR CA HA sing N N 357 THR C O doub N N 358 THR C OXT sing N N 359 THR CB OG1 sing N N 360 THR CB CG2 sing N N 361 THR CB HB sing N N 362 THR OG1 HG1 sing N N 363 THR CG2 HG21 sing N N 364 THR CG2 HG22 sing N N 365 THR CG2 HG23 sing N N 366 THR OXT HXT sing N N 367 TRP N CA sing N N 368 TRP N H sing N N 369 TRP N H2 sing N N 370 TRP CA C sing N N 371 TRP CA CB sing N N 372 TRP CA HA sing N N 373 TRP C O doub N N 374 TRP C OXT sing N N 375 TRP CB CG sing N N 376 TRP CB HB2 sing N N 377 TRP CB HB3 sing N N 378 TRP CG CD1 doub Y N 379 TRP CG CD2 sing Y N 380 TRP CD1 NE1 sing Y N 381 TRP CD1 HD1 sing N N 382 TRP CD2 CE2 doub Y N 383 TRP CD2 CE3 sing Y N 384 TRP NE1 CE2 sing Y N 385 TRP NE1 HE1 sing N N 386 TRP CE2 CZ2 sing Y N 387 TRP CE3 CZ3 doub Y N 388 TRP CE3 HE3 sing N N 389 TRP CZ2 CH2 doub Y N 390 TRP CZ2 HZ2 sing N N 391 TRP CZ3 CH2 sing Y N 392 TRP CZ3 HZ3 sing N N 393 TRP CH2 HH2 sing N N 394 TRP OXT HXT sing N N 395 TYR N CA sing N N 396 TYR N H sing N N 397 TYR N H2 sing N N 398 TYR CA C sing N N 399 TYR CA CB sing N N 400 TYR CA HA sing N N 401 TYR C O doub N N 402 TYR C OXT sing N N 403 TYR CB CG sing N N 404 TYR CB HB2 sing N N 405 TYR CB HB3 sing N N 406 TYR CG CD1 doub Y N 407 TYR CG CD2 sing Y N 408 TYR CD1 CE1 sing Y N 409 TYR CD1 HD1 sing N N 410 TYR CD2 CE2 doub Y N 411 TYR CD2 HD2 sing N N 412 TYR CE1 CZ doub Y N 413 TYR CE1 HE1 sing N N 414 TYR CE2 CZ sing Y N 415 TYR CE2 HE2 sing N N 416 TYR CZ OH sing N N 417 TYR OH HH sing N N 418 TYR OXT HXT sing N N 419 VAL N CA sing N N 420 VAL N H sing N N 421 VAL N H2 sing N N 422 VAL CA C sing N N 423 VAL CA CB sing N N 424 VAL CA HA sing N N 425 VAL C O doub N N 426 VAL C OXT sing N N 427 VAL CB CG1 sing N N 428 VAL CB CG2 sing N N 429 VAL CB HB sing N N 430 VAL CG1 HG11 sing N N 431 VAL CG1 HG12 sing N N 432 VAL CG1 HG13 sing N N 433 VAL CG2 HG21 sing N N 434 VAL CG2 HG22 sing N N 435 VAL CG2 HG23 sing N N 436 VAL OXT HXT sing N N 437 # _pdbx_audit_support.funding_organization 'European Commission' _pdbx_audit_support.country Netherlands _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id KDK _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id KDK _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3MHR _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 6RP6 _atom_sites.fract_transf_matrix[1][1] 0.012200 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.008927 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.015926 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CA H N NA O P S # loop_