data_6RS9 # _entry.id 6RS9 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6RS9 pdb_00006rs9 10.2210/pdb6rs9/pdb WWPDB D_1292102420 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-09-11 2 'Structure model' 1 1 2019-11-20 3 'Structure model' 2 0 2020-07-29 4 'Structure model' 3 0 2021-11-10 5 'Structure model' 3 1 2024-01-24 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 3 'Structure model' repository Remediation 'Carbohydrate remediation' ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Atomic model' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' 'Structure summary' 6 4 'Structure model' Advisory 7 4 'Structure model' 'Atomic model' 8 4 'Structure model' 'Data collection' 9 4 'Structure model' 'Database references' 10 4 'Structure model' 'Derived calculations' 11 4 'Structure model' 'Source and taxonomy' 12 4 'Structure model' 'Structure summary' 13 5 'Structure model' 'Data collection' 14 5 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' atom_site 4 3 'Structure model' atom_site_anisotrop 5 3 'Structure model' chem_comp 6 3 'Structure model' entity 7 3 'Structure model' pdbx_branch_scheme 8 3 'Structure model' pdbx_chem_comp_identifier 9 3 'Structure model' pdbx_entity_branch 10 3 'Structure model' pdbx_entity_branch_descriptor 11 3 'Structure model' pdbx_entity_branch_link 12 3 'Structure model' pdbx_entity_branch_list 13 3 'Structure model' pdbx_entity_nonpoly 14 3 'Structure model' pdbx_nonpoly_scheme 15 3 'Structure model' pdbx_struct_assembly_gen 16 3 'Structure model' struct_asym 17 3 'Structure model' struct_conn 18 3 'Structure model' struct_site 19 3 'Structure model' struct_site_gen 20 4 'Structure model' atom_site 21 4 'Structure model' atom_site_anisotrop 22 4 'Structure model' chem_comp 23 4 'Structure model' database_2 24 4 'Structure model' entity_src_gen 25 4 'Structure model' pdbx_nonpoly_scheme 26 4 'Structure model' pdbx_solvent_atom_site_mapping 27 4 'Structure model' pdbx_validate_close_contact 28 4 'Structure model' pdbx_validate_symm_contact 29 4 'Structure model' struct_conn 30 5 'Structure model' chem_comp_atom 31 5 'Structure model' chem_comp_bond 32 5 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation_author.identifier_ORCID' 5 3 'Structure model' '_atom_site.B_iso_or_equiv' 6 3 'Structure model' '_atom_site.Cartn_x' 7 3 'Structure model' '_atom_site.Cartn_y' 8 3 'Structure model' '_atom_site.Cartn_z' 9 3 'Structure model' '_atom_site.auth_asym_id' 10 3 'Structure model' '_atom_site.auth_atom_id' 11 3 'Structure model' '_atom_site.auth_comp_id' 12 3 'Structure model' '_atom_site.auth_seq_id' 13 3 'Structure model' '_atom_site.label_asym_id' 14 3 'Structure model' '_atom_site.label_atom_id' 15 3 'Structure model' '_atom_site.label_comp_id' 16 3 'Structure model' '_atom_site.label_entity_id' 17 3 'Structure model' '_atom_site.occupancy' 18 3 'Structure model' '_atom_site.type_symbol' 19 3 'Structure model' '_atom_site_anisotrop.U[1][1]' 20 3 'Structure model' '_atom_site_anisotrop.U[1][2]' 21 3 'Structure model' '_atom_site_anisotrop.U[1][3]' 22 3 'Structure model' '_atom_site_anisotrop.U[2][2]' 23 3 'Structure model' '_atom_site_anisotrop.U[2][3]' 24 3 'Structure model' '_atom_site_anisotrop.U[3][3]' 25 3 'Structure model' '_atom_site_anisotrop.pdbx_auth_asym_id' 26 3 'Structure model' '_atom_site_anisotrop.pdbx_auth_atom_id' 27 3 'Structure model' '_atom_site_anisotrop.pdbx_auth_comp_id' 28 3 'Structure model' '_atom_site_anisotrop.pdbx_auth_seq_id' 29 3 'Structure model' '_atom_site_anisotrop.pdbx_label_asym_id' 30 3 'Structure model' '_atom_site_anisotrop.pdbx_label_atom_id' 31 3 'Structure model' '_atom_site_anisotrop.pdbx_label_comp_id' 32 3 'Structure model' '_atom_site_anisotrop.type_symbol' 33 3 'Structure model' '_chem_comp.name' 34 3 'Structure model' '_chem_comp.type' 35 3 'Structure model' '_entity.formula_weight' 36 3 'Structure model' '_entity.pdbx_description' 37 3 'Structure model' '_entity.pdbx_number_of_molecules' 38 3 'Structure model' '_entity.type' 39 3 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list' 40 3 'Structure model' '_struct_conn.pdbx_dist_value' 41 3 'Structure model' '_struct_conn.pdbx_role' 42 3 'Structure model' '_struct_conn.ptnr1_auth_asym_id' 43 3 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 44 3 'Structure model' '_struct_conn.ptnr1_label_asym_id' 45 3 'Structure model' '_struct_conn.ptnr1_label_atom_id' 46 3 'Structure model' '_struct_conn.ptnr2_auth_asym_id' 47 3 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 48 3 'Structure model' '_struct_conn.ptnr2_label_asym_id' 49 3 'Structure model' '_struct_conn.ptnr2_label_atom_id' 50 4 'Structure model' '_atom_site.B_iso_or_equiv' 51 4 'Structure model' '_atom_site.Cartn_x' 52 4 'Structure model' '_atom_site.Cartn_y' 53 4 'Structure model' '_atom_site.Cartn_z' 54 4 'Structure model' '_atom_site.auth_seq_id' 55 4 'Structure model' '_atom_site.label_alt_id' 56 4 'Structure model' '_atom_site.occupancy' 57 4 'Structure model' '_atom_site.pdbx_auth_seq_id' 58 4 'Structure model' '_atom_site_anisotrop.id' 59 4 'Structure model' '_atom_site_anisotrop.pdbx_auth_seq_id' 60 4 'Structure model' '_chem_comp.pdbx_synonyms' 61 4 'Structure model' '_database_2.pdbx_DOI' 62 4 'Structure model' '_database_2.pdbx_database_accession' 63 4 'Structure model' '_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id' 64 4 'Structure model' '_pdbx_nonpoly_scheme.auth_seq_num' 65 4 'Structure model' '_pdbx_nonpoly_scheme.pdb_seq_num' 66 4 'Structure model' '_pdbx_validate_close_contact.auth_seq_id_1' 67 4 'Structure model' '_pdbx_validate_close_contact.auth_seq_id_2' 68 4 'Structure model' '_pdbx_validate_symm_contact.auth_seq_id_1' 69 4 'Structure model' '_pdbx_validate_symm_contact.auth_seq_id_2' 70 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 71 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6RS9 _pdbx_database_status.recvd_initial_deposition_date 2019-05-21 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Frandsen, K.E.H.' 1 0000-0002-7136-9820 'Tovborg, M.' 2 ? 'Poulsen, J.C.N.' 3 0000-0002-3553-0015 'Johansen, K.S.' 4 0000-0002-7587-5990 'Lo Leggio, L.' 5 0000-0002-5135-0882 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Biol.Chem. _citation.journal_id_ASTM JBCHA3 _citation.journal_id_CSD 0071 _citation.journal_id_ISSN 1083-351X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 294 _citation.language ? _citation.page_first 17117 _citation.page_last 17130 _citation.title ;Insights into an unusual Auxiliary Activity 9 family member lacking the histidine brace motif of lytic polysaccharide monooxygenases. ; _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1074/jbc.RA119.009223 _citation.pdbx_database_id_PubMed 31471321 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Frandsen, K.E.H.' 1 ? primary 'Tovborg, M.' 2 ? primary 'Jorgensen, C.I.' 3 ? primary 'Spodsberg, N.' 4 ? primary 'Rosso, M.N.' 5 ? primary 'Hemsworth, G.R.' 6 ? primary 'Garman, E.F.' 7 ? primary 'Grime, G.W.' 8 ? primary 'Poulsen, J.N.' 9 ? primary 'Batth, T.S.' 10 ? primary 'Miyauchi, S.' 11 ? primary 'Lipzen, A.' 12 ? primary 'Daum, C.' 13 ? primary 'Grigoriev, I.V.' 14 ? primary 'Johansen, K.S.' 15 ? primary 'Henrissat, B.' 16 ? primary 'Berrin, J.G.' 17 ? primary 'Lo Leggio, L.' 18 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man AA9 23238.924 1 ? ? ? ? 2 branched man '2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose' 424.401 1 ? ? ? ? 3 branched man 'beta-D-xylopyranose-(1-4)-beta-D-xylopyranose-(1-4)-beta-D-xylopyranose-(1-4)-beta-D-xylopyranose' 546.474 1 ? ? ? ? 4 non-polymer man alpha-D-mannopyranose 180.156 1 ? ? ? ? 5 non-polymer syn BICINE 163.172 1 ? ? ? ? 6 water nat water 18.015 228 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;RTVFSSLTVNGVDLGQGVAVRVPSSNAPVTDIESDDIICNTGFIQPVSKTVAAVPAGGTVIAHFHHTSAGYVGPDPSDPL DPTNKGPVLAYLAKVPDATQSDVTGLKWFKIWQDGYTPATRQWGSDKLFINGGNATFTIPSCLQAGQYLLRVESISLLNA EQYPGAQFFLSCGQINITGGNKVQPVGVDFPGAYTSTDPGIVTDIYEVGTYTPPGPAVFSC ; _entity_poly.pdbx_seq_one_letter_code_can ;RTVFSSLTVNGVDLGQGVAVRVPSSNAPVTDIESDDIICNTGFIQPVSKTVAAVPAGGTVIAHFHHTSAGYVGPDPSDPL DPTNKGPVLAYLAKVPDATQSDVTGLKWFKIWQDGYTPATRQWGSDKLFINGGNATFTIPSCLQAGQYLLRVESISLLNA EQYPGAQFFLSCGQINITGGNKVQPVGVDFPGAYTSTDPGIVTDIYEVGTYTPPGPAVFSC ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 4 alpha-D-mannopyranose MAN 5 BICINE BCN 6 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ARG n 1 2 THR n 1 3 VAL n 1 4 PHE n 1 5 SER n 1 6 SER n 1 7 LEU n 1 8 THR n 1 9 VAL n 1 10 ASN n 1 11 GLY n 1 12 VAL n 1 13 ASP n 1 14 LEU n 1 15 GLY n 1 16 GLN n 1 17 GLY n 1 18 VAL n 1 19 ALA n 1 20 VAL n 1 21 ARG n 1 22 VAL n 1 23 PRO n 1 24 SER n 1 25 SER n 1 26 ASN n 1 27 ALA n 1 28 PRO n 1 29 VAL n 1 30 THR n 1 31 ASP n 1 32 ILE n 1 33 GLU n 1 34 SER n 1 35 ASP n 1 36 ASP n 1 37 ILE n 1 38 ILE n 1 39 CYS n 1 40 ASN n 1 41 THR n 1 42 GLY n 1 43 PHE n 1 44 ILE n 1 45 GLN n 1 46 PRO n 1 47 VAL n 1 48 SER n 1 49 LYS n 1 50 THR n 1 51 VAL n 1 52 ALA n 1 53 ALA n 1 54 VAL n 1 55 PRO n 1 56 ALA n 1 57 GLY n 1 58 GLY n 1 59 THR n 1 60 VAL n 1 61 ILE n 1 62 ALA n 1 63 HIS n 1 64 PHE n 1 65 HIS n 1 66 HIS n 1 67 THR n 1 68 SER n 1 69 ALA n 1 70 GLY n 1 71 TYR n 1 72 VAL n 1 73 GLY n 1 74 PRO n 1 75 ASP n 1 76 PRO n 1 77 SER n 1 78 ASP n 1 79 PRO n 1 80 LEU n 1 81 ASP n 1 82 PRO n 1 83 THR n 1 84 ASN n 1 85 LYS n 1 86 GLY n 1 87 PRO n 1 88 VAL n 1 89 LEU n 1 90 ALA n 1 91 TYR n 1 92 LEU n 1 93 ALA n 1 94 LYS n 1 95 VAL n 1 96 PRO n 1 97 ASP n 1 98 ALA n 1 99 THR n 1 100 GLN n 1 101 SER n 1 102 ASP n 1 103 VAL n 1 104 THR n 1 105 GLY n 1 106 LEU n 1 107 LYS n 1 108 TRP n 1 109 PHE n 1 110 LYS n 1 111 ILE n 1 112 TRP n 1 113 GLN n 1 114 ASP n 1 115 GLY n 1 116 TYR n 1 117 THR n 1 118 PRO n 1 119 ALA n 1 120 THR n 1 121 ARG n 1 122 GLN n 1 123 TRP n 1 124 GLY n 1 125 SER n 1 126 ASP n 1 127 LYS n 1 128 LEU n 1 129 PHE n 1 130 ILE n 1 131 ASN n 1 132 GLY n 1 133 GLY n 1 134 ASN n 1 135 ALA n 1 136 THR n 1 137 PHE n 1 138 THR n 1 139 ILE n 1 140 PRO n 1 141 SER n 1 142 CYS n 1 143 LEU n 1 144 GLN n 1 145 ALA n 1 146 GLY n 1 147 GLN n 1 148 TYR n 1 149 LEU n 1 150 LEU n 1 151 ARG n 1 152 VAL n 1 153 GLU n 1 154 SER n 1 155 ILE n 1 156 SER n 1 157 LEU n 1 158 LEU n 1 159 ASN n 1 160 ALA n 1 161 GLU n 1 162 GLN n 1 163 TYR n 1 164 PRO n 1 165 GLY n 1 166 ALA n 1 167 GLN n 1 168 PHE n 1 169 PHE n 1 170 LEU n 1 171 SER n 1 172 CYS n 1 173 GLY n 1 174 GLN n 1 175 ILE n 1 176 ASN n 1 177 ILE n 1 178 THR n 1 179 GLY n 1 180 GLY n 1 181 ASN n 1 182 LYS n 1 183 VAL n 1 184 GLN n 1 185 PRO n 1 186 VAL n 1 187 GLY n 1 188 VAL n 1 189 ASP n 1 190 PHE n 1 191 PRO n 1 192 GLY n 1 193 ALA n 1 194 TYR n 1 195 THR n 1 196 SER n 1 197 THR n 1 198 ASP n 1 199 PRO n 1 200 GLY n 1 201 ILE n 1 202 VAL n 1 203 THR n 1 204 ASP n 1 205 ILE n 1 206 TYR n 1 207 GLU n 1 208 VAL n 1 209 GLY n 1 210 THR n 1 211 TYR n 1 212 THR n 1 213 PRO n 1 214 PRO n 1 215 GLY n 1 216 PRO n 1 217 ALA n 1 218 VAL n 1 219 PHE n 1 220 SER n 1 221 CYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 221 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Lentinus similis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 292560 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Aspergillus oryzae' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 5062 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _pdbx_entity_branch.entity_id _pdbx_entity_branch.type 2 oligosaccharide 3 oligosaccharide # loop_ _pdbx_entity_branch_descriptor.ordinal _pdbx_entity_branch_descriptor.entity_id _pdbx_entity_branch_descriptor.descriptor _pdbx_entity_branch_descriptor.type _pdbx_entity_branch_descriptor.program _pdbx_entity_branch_descriptor.program_version 1 2 DGlcpNAcb1-4DGlcpNAcb1- 'Glycam Condensed Sequence' GMML 1.0 2 2 'WURCS=2.0/1,2,1/[a2122h-1b_1-5_2*NCC/3=O]/1-1/a4-b1' WURCS PDB2Glycan 1.1.0 3 2 '[]{[(4+1)][b-D-GlcpNAc]{[(4+1)][b-D-GlcpNAc]{}}}' LINUCS PDB-CARE ? 4 3 DXylpb1-4DXylpb1-4DXylpb1-4DXylpb1-ROH 'Glycam Condensed Sequence' GMML 1.0 5 3 'WURCS=2.0/1,4,3/[a212h-1b_1-5]/1-1-1-1/a4-b1_b4-c1_c4-d1' WURCS PDB2Glycan 1.1.0 6 3 '[][b-D-Xylp]{[(4+1)][b-D-Xylp]{[(4+1)][b-D-Xylp]{[(4+1)][b-D-Xylp]{}}}}' LINUCS PDB-CARE ? # loop_ _pdbx_entity_branch_link.link_id _pdbx_entity_branch_link.entity_id _pdbx_entity_branch_link.entity_branch_list_num_1 _pdbx_entity_branch_link.comp_id_1 _pdbx_entity_branch_link.atom_id_1 _pdbx_entity_branch_link.leaving_atom_id_1 _pdbx_entity_branch_link.entity_branch_list_num_2 _pdbx_entity_branch_link.comp_id_2 _pdbx_entity_branch_link.atom_id_2 _pdbx_entity_branch_link.leaving_atom_id_2 _pdbx_entity_branch_link.value_order _pdbx_entity_branch_link.details 1 2 2 NAG C1 O1 1 NAG O4 HO4 sing ? 2 3 2 XYP C1 O1 1 XYP O4 HO4 sing ? 3 3 3 XYP C1 O1 2 XYP O4 HO4 sing ? 4 3 4 XYP C1 O1 3 XYP O4 HO4 sing ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 BCN non-polymer . BICINE ? 'C6 H13 N O4' 163.172 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MAN 'D-saccharide, alpha linking' . alpha-D-mannopyranose 'alpha-D-mannose; D-mannose; mannose' 'C6 H12 O6' 180.156 NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose ;N-acetyl-beta-D-glucosamine; 2-acetamido-2-deoxy-beta-D-glucose; 2-acetamido-2-deoxy-D-glucose; 2-acetamido-2-deoxy-glucose; N-ACETYL-D-GLUCOSAMINE ; 'C8 H15 N O6' 221.208 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 XYP 'D-saccharide, beta linking' . beta-D-xylopyranose 'beta-D-xylose; D-xylose; xylose' 'C5 H10 O5' 150.130 # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier MAN 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DManpa MAN 'COMMON NAME' GMML 1.0 a-D-mannopyranose MAN 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 a-D-Manp MAN 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 Man NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DGlcpNAcb NAG 'COMMON NAME' GMML 1.0 N-acetyl-b-D-glucopyranosamine NAG 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 b-D-GlcpNAc NAG 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 GlcNAc XYP 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DXylpb XYP 'COMMON NAME' GMML 1.0 b-D-xylopyranose XYP 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 b-D-Xylp XYP 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 Xyl # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ARG 1 1 1 ARG ARG A . n A 1 2 THR 2 2 2 THR THR A . n A 1 3 VAL 3 3 3 VAL VAL A . n A 1 4 PHE 4 4 4 PHE PHE A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 ASN 10 10 10 ASN ASN A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 ASP 13 13 13 ASP ASP A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 GLN 16 16 16 GLN GLN A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 PRO 23 23 23 PRO PRO A . n A 1 24 SER 24 24 24 SER SER A . n A 1 25 SER 25 25 25 SER SER A . n A 1 26 ASN 26 26 26 ASN ASN A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 PRO 28 28 28 PRO PRO A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 THR 30 30 30 THR THR A . n A 1 31 ASP 31 31 31 ASP ASP A . n A 1 32 ILE 32 32 32 ILE ILE A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 SER 34 34 34 SER SER A . n A 1 35 ASP 35 35 35 ASP ASP A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 ILE 37 37 37 ILE ILE A . n A 1 38 ILE 38 38 38 ILE ILE A . n A 1 39 CYS 39 39 39 CYS CYS A . n A 1 40 ASN 40 40 40 ASN ASN A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 PHE 43 43 43 PHE PHE A . n A 1 44 ILE 44 44 44 ILE ILE A . n A 1 45 GLN 45 45 45 GLN GLN A . n A 1 46 PRO 46 46 46 PRO PRO A . n A 1 47 VAL 47 47 47 VAL VAL A . n A 1 48 SER 48 48 48 SER SER A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 THR 50 50 50 THR THR A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 PRO 55 55 55 PRO PRO A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 GLY 57 57 57 GLY GLY A . n A 1 58 GLY 58 58 58 GLY GLY A . n A 1 59 THR 59 59 59 THR THR A . n A 1 60 VAL 60 60 60 VAL VAL A . n A 1 61 ILE 61 61 61 ILE ILE A . n A 1 62 ALA 62 62 62 ALA ALA A . n A 1 63 HIS 63 63 63 HIS HIS A . n A 1 64 PHE 64 64 64 PHE PHE A . n A 1 65 HIS 65 65 65 HIS HIS A . n A 1 66 HIS 66 66 66 HIS HIS A . n A 1 67 THR 67 67 67 THR THR A . n A 1 68 SER 68 68 68 SER SER A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 GLY 70 70 70 GLY GLY A . n A 1 71 TYR 71 71 71 TYR TYR A . n A 1 72 VAL 72 72 72 VAL VAL A . n A 1 73 GLY 73 73 73 GLY GLY A . n A 1 74 PRO 74 74 74 PRO PRO A . n A 1 75 ASP 75 75 75 ASP ASP A . n A 1 76 PRO 76 76 76 PRO PRO A . n A 1 77 SER 77 77 77 SER SER A . n A 1 78 ASP 78 78 78 ASP ASP A . n A 1 79 PRO 79 79 79 PRO PRO A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 ASP 81 81 81 ASP ASP A . n A 1 82 PRO 82 82 82 PRO PRO A . n A 1 83 THR 83 83 83 THR THR A . n A 1 84 ASN 84 84 84 ASN ASN A . n A 1 85 LYS 85 85 85 LYS LYS A . n A 1 86 GLY 86 86 86 GLY GLY A . n A 1 87 PRO 87 87 87 PRO PRO A . n A 1 88 VAL 88 88 88 VAL VAL A . n A 1 89 LEU 89 89 89 LEU LEU A . n A 1 90 ALA 90 90 90 ALA ALA A . n A 1 91 TYR 91 91 91 TYR TYR A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 ALA 93 93 93 ALA ALA A . n A 1 94 LYS 94 94 94 LYS LYS A . n A 1 95 VAL 95 95 95 VAL VAL A . n A 1 96 PRO 96 96 96 PRO PRO A . n A 1 97 ASP 97 97 97 ASP ASP A . n A 1 98 ALA 98 98 98 ALA ALA A . n A 1 99 THR 99 99 99 THR THR A . n A 1 100 GLN 100 100 100 GLN GLN A . n A 1 101 SER 101 101 101 SER SER A . n A 1 102 ASP 102 102 102 ASP ASP A . n A 1 103 VAL 103 103 103 VAL VAL A . n A 1 104 THR 104 104 104 THR THR A . n A 1 105 GLY 105 105 105 GLY GLY A . n A 1 106 LEU 106 106 106 LEU LEU A . n A 1 107 LYS 107 107 107 LYS LYS A . n A 1 108 TRP 108 108 108 TRP TRP A . n A 1 109 PHE 109 109 109 PHE PHE A . n A 1 110 LYS 110 110 110 LYS LYS A . n A 1 111 ILE 111 111 111 ILE ILE A . n A 1 112 TRP 112 112 112 TRP TRP A . n A 1 113 GLN 113 113 113 GLN GLN A . n A 1 114 ASP 114 114 114 ASP ASP A . n A 1 115 GLY 115 115 115 GLY GLY A . n A 1 116 TYR 116 116 116 TYR TYR A . n A 1 117 THR 117 117 117 THR THR A . n A 1 118 PRO 118 118 118 PRO PRO A . n A 1 119 ALA 119 119 119 ALA ALA A . n A 1 120 THR 120 120 120 THR THR A . n A 1 121 ARG 121 121 121 ARG ARG A . n A 1 122 GLN 122 122 122 GLN GLN A . n A 1 123 TRP 123 123 123 TRP TRP A . n A 1 124 GLY 124 124 124 GLY GLY A . n A 1 125 SER 125 125 125 SER SER A . n A 1 126 ASP 126 126 126 ASP ASP A . n A 1 127 LYS 127 127 127 LYS LYS A . n A 1 128 LEU 128 128 128 LEU LEU A . n A 1 129 PHE 129 129 129 PHE PHE A . n A 1 130 ILE 130 130 130 ILE ILE A . n A 1 131 ASN 131 131 131 ASN ASN A . n A 1 132 GLY 132 132 132 GLY GLY A . n A 1 133 GLY 133 133 133 GLY GLY A . n A 1 134 ASN 134 134 134 ASN ASN A . n A 1 135 ALA 135 135 135 ALA ALA A . n A 1 136 THR 136 136 136 THR THR A . n A 1 137 PHE 137 137 137 PHE PHE A . n A 1 138 THR 138 138 138 THR THR A . n A 1 139 ILE 139 139 139 ILE ILE A . n A 1 140 PRO 140 140 140 PRO PRO A . n A 1 141 SER 141 141 141 SER SER A . n A 1 142 CYS 142 142 142 CYS CYS A . n A 1 143 LEU 143 143 143 LEU LEU A . n A 1 144 GLN 144 144 144 GLN GLN A . n A 1 145 ALA 145 145 145 ALA ALA A . n A 1 146 GLY 146 146 146 GLY GLY A . n A 1 147 GLN 147 147 147 GLN GLN A . n A 1 148 TYR 148 148 148 TYR TYR A . n A 1 149 LEU 149 149 149 LEU LEU A . n A 1 150 LEU 150 150 150 LEU LEU A . n A 1 151 ARG 151 151 151 ARG ARG A . n A 1 152 VAL 152 152 152 VAL VAL A . n A 1 153 GLU 153 153 153 GLU GLU A . n A 1 154 SER 154 154 154 SER SER A . n A 1 155 ILE 155 155 155 ILE ILE A . n A 1 156 SER 156 156 156 SER SER A . n A 1 157 LEU 157 157 157 LEU LEU A . n A 1 158 LEU 158 158 158 LEU LEU A . n A 1 159 ASN 159 159 159 ASN ASN A . n A 1 160 ALA 160 160 160 ALA ALA A . n A 1 161 GLU 161 161 161 GLU GLU A . n A 1 162 GLN 162 162 162 GLN GLN A . n A 1 163 TYR 163 163 163 TYR TYR A . n A 1 164 PRO 164 164 164 PRO PRO A . n A 1 165 GLY 165 165 165 GLY GLY A . n A 1 166 ALA 166 166 166 ALA ALA A . n A 1 167 GLN 167 167 167 GLN GLN A . n A 1 168 PHE 168 168 168 PHE PHE A . n A 1 169 PHE 169 169 169 PHE PHE A . n A 1 170 LEU 170 170 170 LEU LEU A . n A 1 171 SER 171 171 171 SER SER A . n A 1 172 CYS 172 172 172 CYS CYS A . n A 1 173 GLY 173 173 173 GLY GLY A . n A 1 174 GLN 174 174 174 GLN GLN A . n A 1 175 ILE 175 175 175 ILE ILE A . n A 1 176 ASN 176 176 176 ASN ASN A . n A 1 177 ILE 177 177 177 ILE ILE A . n A 1 178 THR 178 178 178 THR THR A . n A 1 179 GLY 179 179 179 GLY GLY A . n A 1 180 GLY 180 180 180 GLY GLY A . n A 1 181 ASN 181 181 181 ASN ASN A . n A 1 182 LYS 182 182 182 LYS LYS A . n A 1 183 VAL 183 183 183 VAL VAL A . n A 1 184 GLN 184 184 184 GLN GLN A . n A 1 185 PRO 185 185 185 PRO PRO A . n A 1 186 VAL 186 186 186 VAL VAL A . n A 1 187 GLY 187 187 187 GLY GLY A . n A 1 188 VAL 188 188 188 VAL VAL A . n A 1 189 ASP 189 189 189 ASP ASP A . n A 1 190 PHE 190 190 190 PHE PHE A . n A 1 191 PRO 191 191 191 PRO PRO A . n A 1 192 GLY 192 192 192 GLY GLY A . n A 1 193 ALA 193 193 193 ALA ALA A . n A 1 194 TYR 194 194 194 TYR TYR A . n A 1 195 THR 195 195 195 THR THR A . n A 1 196 SER 196 196 196 SER SER A . n A 1 197 THR 197 197 197 THR THR A . n A 1 198 ASP 198 198 198 ASP ASP A . n A 1 199 PRO 199 199 199 PRO PRO A . n A 1 200 GLY 200 200 200 GLY GLY A . n A 1 201 ILE 201 201 201 ILE ILE A . n A 1 202 VAL 202 202 202 VAL VAL A . n A 1 203 THR 203 203 203 THR THR A . n A 1 204 ASP 204 204 204 ASP ASP A . n A 1 205 ILE 205 205 205 ILE ILE A . n A 1 206 TYR 206 206 206 TYR TYR A . n A 1 207 GLU 207 207 207 GLU GLU A . n A 1 208 VAL 208 208 208 VAL VAL A . n A 1 209 GLY 209 209 209 GLY GLY A . n A 1 210 THR 210 210 210 THR THR A . n A 1 211 TYR 211 211 211 TYR TYR A . n A 1 212 THR 212 212 212 THR THR A . n A 1 213 PRO 213 213 213 PRO PRO A . n A 1 214 PRO 214 214 214 PRO PRO A . n A 1 215 GLY 215 215 215 GLY GLY A . n A 1 216 PRO 216 216 216 PRO PRO A . n A 1 217 ALA 217 217 217 ALA ALA A . n A 1 218 VAL 218 218 218 VAL VAL A . n A 1 219 PHE 219 219 219 PHE PHE A . n A 1 220 SER 220 220 220 SER SER A . n A 1 221 CYS 221 221 221 CYS CYS A . n # loop_ _pdbx_branch_scheme.asym_id _pdbx_branch_scheme.entity_id _pdbx_branch_scheme.mon_id _pdbx_branch_scheme.num _pdbx_branch_scheme.pdb_asym_id _pdbx_branch_scheme.pdb_mon_id _pdbx_branch_scheme.pdb_seq_num _pdbx_branch_scheme.auth_asym_id _pdbx_branch_scheme.auth_mon_id _pdbx_branch_scheme.auth_seq_num _pdbx_branch_scheme.hetero B 2 NAG 1 B NAG 1 A NAG 301 n B 2 NAG 2 B NAG 2 A NAG 302 n C 3 XYP 1 C XYP 1 A XYP 701 n C 3 XYP 2 C XYP 2 A XYP 601 n C 3 XYP 3 C XYP 3 A XYP 501 n C 3 XYP 4 C XYP 4 A XYP 401 n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code D 4 MAN 1 301 304 MAN MAN A . E 5 BCN 1 302 801 BCN BCN A . F 6 HOH 1 401 233 HOH HOH A . F 6 HOH 2 402 213 HOH HOH A . F 6 HOH 3 403 102 HOH HOH A . F 6 HOH 4 404 172 HOH HOH A . F 6 HOH 5 405 201 HOH HOH A . F 6 HOH 6 406 151 HOH HOH A . F 6 HOH 7 407 207 HOH HOH A . F 6 HOH 8 408 130 HOH HOH A . F 6 HOH 9 409 138 HOH HOH A . F 6 HOH 10 410 88 HOH HOH A . F 6 HOH 11 411 193 HOH HOH A . F 6 HOH 12 412 166 HOH HOH A . F 6 HOH 13 413 44 HOH HOH A . F 6 HOH 14 414 132 HOH HOH A . F 6 HOH 15 415 87 HOH HOH A . F 6 HOH 16 416 231 HOH HOH A . F 6 HOH 17 417 46 HOH HOH A . F 6 HOH 18 418 35 HOH HOH A . F 6 HOH 19 419 29 HOH HOH A . F 6 HOH 20 420 203 HOH HOH A . F 6 HOH 21 421 109 HOH HOH A . F 6 HOH 22 422 177 HOH HOH A . F 6 HOH 23 423 86 HOH HOH A . F 6 HOH 24 424 49 HOH HOH A . F 6 HOH 25 425 3 HOH HOH A . F 6 HOH 26 426 30 HOH HOH A . F 6 HOH 27 427 34 HOH HOH A . F 6 HOH 28 428 128 HOH HOH A . F 6 HOH 29 429 137 HOH HOH A . F 6 HOH 30 430 180 HOH HOH A . F 6 HOH 31 431 106 HOH HOH A . F 6 HOH 32 432 4 HOH HOH A . F 6 HOH 33 433 7 HOH HOH A . F 6 HOH 34 434 85 HOH HOH A . F 6 HOH 35 435 117 HOH HOH A . F 6 HOH 36 436 101 HOH HOH A . F 6 HOH 37 437 62 HOH HOH A . F 6 HOH 38 438 57 HOH HOH A . F 6 HOH 39 439 71 HOH HOH A . F 6 HOH 40 440 19 HOH HOH A . F 6 HOH 41 441 89 HOH HOH A . F 6 HOH 42 442 113 HOH HOH A . F 6 HOH 43 443 41 HOH HOH A . F 6 HOH 44 444 60 HOH HOH A . F 6 HOH 45 445 186 HOH HOH A . F 6 HOH 46 446 5 HOH HOH A . F 6 HOH 47 447 74 HOH HOH A . F 6 HOH 48 448 8 HOH HOH A . F 6 HOH 49 449 95 HOH HOH A . F 6 HOH 50 450 111 HOH HOH A . F 6 HOH 51 451 105 HOH HOH A . F 6 HOH 52 452 175 HOH HOH A . F 6 HOH 53 453 16 HOH HOH A . F 6 HOH 54 454 43 HOH HOH A . F 6 HOH 55 455 24 HOH HOH A . F 6 HOH 56 456 78 HOH HOH A . F 6 HOH 57 457 23 HOH HOH A . F 6 HOH 58 458 144 HOH HOH A . F 6 HOH 59 459 47 HOH HOH A . F 6 HOH 60 460 10 HOH HOH A . F 6 HOH 61 461 26 HOH HOH A . F 6 HOH 62 462 108 HOH HOH A . F 6 HOH 63 463 165 HOH HOH A . F 6 HOH 64 464 200 HOH HOH A . F 6 HOH 65 465 58 HOH HOH A . F 6 HOH 66 466 15 HOH HOH A . F 6 HOH 67 467 33 HOH HOH A . F 6 HOH 68 468 66 HOH HOH A . F 6 HOH 69 469 94 HOH HOH A . F 6 HOH 70 470 77 HOH HOH A . F 6 HOH 71 471 224 HOH HOH A . F 6 HOH 72 472 13 HOH HOH A . F 6 HOH 73 473 45 HOH HOH A . F 6 HOH 74 474 114 HOH HOH A . F 6 HOH 75 475 38 HOH HOH A . F 6 HOH 76 476 183 HOH HOH A . F 6 HOH 77 477 2 HOH HOH A . F 6 HOH 78 478 31 HOH HOH A . F 6 HOH 79 479 173 HOH HOH A . F 6 HOH 80 480 52 HOH HOH A . F 6 HOH 81 481 148 HOH HOH A . F 6 HOH 82 482 42 HOH HOH A . F 6 HOH 83 483 11 HOH HOH A . F 6 HOH 84 484 6 HOH HOH A . F 6 HOH 85 485 18 HOH HOH A . F 6 HOH 86 486 17 HOH HOH A . F 6 HOH 87 487 22 HOH HOH A . F 6 HOH 88 488 116 HOH HOH A . F 6 HOH 89 489 134 HOH HOH A . F 6 HOH 90 490 91 HOH HOH A . F 6 HOH 91 491 39 HOH HOH A . F 6 HOH 92 492 226 HOH HOH A . F 6 HOH 93 493 40 HOH HOH A . F 6 HOH 94 494 84 HOH HOH A . F 6 HOH 95 495 155 HOH HOH A . F 6 HOH 96 496 115 HOH HOH A . F 6 HOH 97 497 73 HOH HOH A . F 6 HOH 98 498 27 HOH HOH A . F 6 HOH 99 499 191 HOH HOH A . F 6 HOH 100 500 154 HOH HOH A . F 6 HOH 101 501 161 HOH HOH A . F 6 HOH 102 502 158 HOH HOH A . F 6 HOH 103 503 20 HOH HOH A . F 6 HOH 104 504 225 HOH HOH A . F 6 HOH 105 505 21 HOH HOH A . F 6 HOH 106 506 12 HOH HOH A . F 6 HOH 107 507 50 HOH HOH A . F 6 HOH 108 508 212 HOH HOH A . F 6 HOH 109 509 170 HOH HOH A . F 6 HOH 110 510 169 HOH HOH A . F 6 HOH 111 511 110 HOH HOH A . F 6 HOH 112 512 53 HOH HOH A . F 6 HOH 113 513 1 HOH HOH A . F 6 HOH 114 514 157 HOH HOH A . F 6 HOH 115 515 9 HOH HOH A . F 6 HOH 116 516 100 HOH HOH A . F 6 HOH 117 517 82 HOH HOH A . F 6 HOH 118 518 36 HOH HOH A . F 6 HOH 119 519 126 HOH HOH A . F 6 HOH 120 520 121 HOH HOH A . F 6 HOH 121 521 90 HOH HOH A . F 6 HOH 122 522 72 HOH HOH A . F 6 HOH 123 523 96 HOH HOH A . F 6 HOH 124 524 64 HOH HOH A . F 6 HOH 125 525 232 HOH HOH A . F 6 HOH 126 526 79 HOH HOH A . F 6 HOH 127 527 32 HOH HOH A . F 6 HOH 128 528 131 HOH HOH A . F 6 HOH 129 529 97 HOH HOH A . F 6 HOH 130 530 152 HOH HOH A . F 6 HOH 131 531 222 HOH HOH A . F 6 HOH 132 532 118 HOH HOH A . F 6 HOH 133 533 56 HOH HOH A . F 6 HOH 134 534 81 HOH HOH A . F 6 HOH 135 535 25 HOH HOH A . F 6 HOH 136 536 190 HOH HOH A . F 6 HOH 137 537 156 HOH HOH A . F 6 HOH 138 538 107 HOH HOH A . F 6 HOH 139 539 168 HOH HOH A . F 6 HOH 140 540 135 HOH HOH A . F 6 HOH 141 541 181 HOH HOH A . F 6 HOH 142 542 99 HOH HOH A . F 6 HOH 143 543 160 HOH HOH A . F 6 HOH 144 544 188 HOH HOH A . F 6 HOH 145 545 14 HOH HOH A . F 6 HOH 146 546 143 HOH HOH A . F 6 HOH 147 547 112 HOH HOH A . F 6 HOH 148 548 59 HOH HOH A . F 6 HOH 149 549 139 HOH HOH A . F 6 HOH 150 550 145 HOH HOH A . F 6 HOH 151 551 125 HOH HOH A . F 6 HOH 152 552 69 HOH HOH A . F 6 HOH 153 553 68 HOH HOH A . F 6 HOH 154 554 122 HOH HOH A . F 6 HOH 155 555 28 HOH HOH A . F 6 HOH 156 556 104 HOH HOH A . F 6 HOH 157 557 98 HOH HOH A . F 6 HOH 158 558 76 HOH HOH A . F 6 HOH 159 559 124 HOH HOH A . F 6 HOH 160 560 146 HOH HOH A . F 6 HOH 161 561 48 HOH HOH A . F 6 HOH 162 562 136 HOH HOH A . F 6 HOH 163 563 167 HOH HOH A . F 6 HOH 164 564 149 HOH HOH A . F 6 HOH 165 565 67 HOH HOH A . F 6 HOH 166 566 176 HOH HOH A . F 6 HOH 167 567 51 HOH HOH A . F 6 HOH 168 568 54 HOH HOH A . F 6 HOH 169 569 70 HOH HOH A . F 6 HOH 170 570 142 HOH HOH A . F 6 HOH 171 571 55 HOH HOH A . F 6 HOH 172 572 61 HOH HOH A . F 6 HOH 173 573 37 HOH HOH A . F 6 HOH 174 574 80 HOH HOH A . F 6 HOH 175 575 202 HOH HOH A . F 6 HOH 176 576 159 HOH HOH A . F 6 HOH 177 577 63 HOH HOH A . F 6 HOH 178 578 103 HOH HOH A . F 6 HOH 179 579 178 HOH HOH A . F 6 HOH 180 580 83 HOH HOH A . F 6 HOH 181 581 217 HOH HOH A . F 6 HOH 182 582 120 HOH HOH A . F 6 HOH 183 583 185 HOH HOH A . F 6 HOH 184 584 65 HOH HOH A . F 6 HOH 185 585 162 HOH HOH A . F 6 HOH 186 586 210 HOH HOH A . F 6 HOH 187 587 93 HOH HOH A . F 6 HOH 188 588 216 HOH HOH A . F 6 HOH 189 589 189 HOH HOH A . F 6 HOH 190 590 221 HOH HOH A . F 6 HOH 191 591 208 HOH HOH A . F 6 HOH 192 592 205 HOH HOH A . F 6 HOH 193 593 227 HOH HOH A . F 6 HOH 194 594 133 HOH HOH A . F 6 HOH 195 595 204 HOH HOH A . F 6 HOH 196 596 197 HOH HOH A . F 6 HOH 197 597 182 HOH HOH A . F 6 HOH 198 598 147 HOH HOH A . F 6 HOH 199 599 140 HOH HOH A . F 6 HOH 200 600 187 HOH HOH A . F 6 HOH 201 601 228 HOH HOH A . F 6 HOH 202 602 164 HOH HOH A . F 6 HOH 203 603 209 HOH HOH A . F 6 HOH 204 604 220 HOH HOH A . F 6 HOH 205 605 123 HOH HOH A . F 6 HOH 206 606 75 HOH HOH A . F 6 HOH 207 607 127 HOH HOH A . F 6 HOH 208 608 141 HOH HOH A . F 6 HOH 209 609 184 HOH HOH A . F 6 HOH 210 610 153 HOH HOH A . F 6 HOH 211 611 179 HOH HOH A . F 6 HOH 212 612 218 HOH HOH A . F 6 HOH 213 613 150 HOH HOH A . F 6 HOH 214 614 129 HOH HOH A . F 6 HOH 215 615 215 HOH HOH A . F 6 HOH 216 616 192 HOH HOH A . F 6 HOH 217 617 206 HOH HOH A . F 6 HOH 218 618 92 HOH HOH A . F 6 HOH 219 619 194 HOH HOH A . F 6 HOH 220 620 163 HOH HOH A . F 6 HOH 221 621 119 HOH HOH A . F 6 HOH 222 622 223 HOH HOH A . F 6 HOH 223 623 174 HOH HOH A . F 6 HOH 224 624 199 HOH HOH A . F 6 HOH 225 625 171 HOH HOH A . F 6 HOH 226 626 229 HOH HOH A . F 6 HOH 227 627 195 HOH HOH A . F 6 HOH 228 628 196 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0230 1 ? 'data collection' ? ? ? ? ? ? ? ? ? ? ? MxCuBE ? ? ? . 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 5 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot ? ? ? . 6 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 6RS9 _cell.details ? _cell.formula_units_Z ? _cell.length_a 35.410 _cell.length_a_esd ? _cell.length_b 72.790 _cell.length_b_esd ? _cell.length_c 78.590 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6RS9 _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6RS9 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.18 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 43.56 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 294 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;0.1M HEPES/MOPS pH 7.5 24 %(w/v) PEGMME 500 12 %(w/v) PEG 20000 0.03 M CaCl2 0.03 M MgCl2 Crystal soaked with a 0.8 M Xylotetraose solution for 1 hour and 20 min. ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2015-09-09 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'SI(111)' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9760 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE ID23-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9760 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ID23-1 _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6RS9 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.40 _reflns.d_resolution_low 40.0 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 40817 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 7.17 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 13.57 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.100 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.40 _reflns_shell.d_res_low 1.44 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.36 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 2961 _reflns_shell.percent_possible_all 100 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 7.27 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 1.56 _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.454 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] -0.56 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][2] 2.80 _refine.aniso_B[2][3] -0.00 _refine.aniso_B[3][3] -2.24 _refine.B_iso_max ? _refine.B_iso_mean 19.084 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.982 _refine.correlation_coeff_Fo_to_Fc_free 0.972 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6RS9 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.40 _refine.ls_d_res_low 39.33 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 38750 _refine.ls_number_reflns_R_free 2067 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.93 _refine.ls_percent_reflns_R_free 5.1 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.13519 _refine.ls_R_factor_R_free 0.17513 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.13306 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 3EJA _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.057 _refine.pdbx_overall_ESU_R_Free 0.056 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 3.097 _refine.overall_SU_ML 0.052 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.40 _refine_hist.d_res_low 39.33 _refine_hist.number_atoms_solvent 228 _refine_hist.number_atoms_total 1956 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1641 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 87 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.013 0.014 1797 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.017 1568 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.811 1.727 2479 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.091 1.696 3697 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 6.521 5.000 228 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 35.819 24.286 70 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 11.218 15.000 235 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 23.198 15.000 4 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.084 0.200 264 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.006 0.020 1968 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 319 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? 2.379 1.573 891 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 2.388 ? 890 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 3.078 2.376 1114 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 3.079 ? 1115 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 4.617 2.120 906 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 4.617 2.120 906 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 5.532 3.050 1362 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 5.828 ? 1938 ? r_long_range_B_refined ? ? 'X-RAY DIFFRACTION' ? 5.734 ? 1894 ? r_long_range_B_other ? ? 'X-RAY DIFFRACTION' ? 10.793 3.000 1787 ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? 20.121 5.000 23 ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? 22.841 5.000 1747 ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.400 _refine_ls_shell.d_res_low 1.436 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 132 _refine_ls_shell.number_reflns_R_work 2826 _refine_ls_shell.percent_reflns_obs 99.93 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.349 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.299 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 6RS9 _struct.title 'X-ray crystal structure of LsAA9B (xylotetraose soak)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6RS9 _struct_keywords.text 'Fungal, family AA9, UNKNOWN FUNCTION' _struct_keywords.pdbx_keywords 'UNKNOWN FUNCTION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? F N N 6 ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 6RS9 _struct_ref.pdbx_db_accession 6RS9 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6RS9 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 221 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 6RS9 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 221 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 221 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1880 ? 1 MORE -4 ? 1 'SSA (A^2)' 9850 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 35 ? ASN A 40 ? ASP A 35 ASN A 40 1 ? 6 HELX_P HELX_P2 AA2 GLY A 124 ? ASN A 131 ? GLY A 124 ASN A 131 1 ? 8 HELX_P HELX_P3 AA3 ASP A 204 ? VAL A 208 ? ASP A 204 VAL A 208 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 39 SG ? ? ? 1_555 A CYS 172 SG ? ? A CYS 39 A CYS 172 1_555 ? ? ? ? ? ? ? 2.035 ? ? disulf2 disulf ? ? A CYS 142 SG ? ? ? 1_555 A CYS 221 SG ? ? A CYS 142 A CYS 221 1_555 ? ? ? ? ? ? ? 2.059 ? ? covale1 covale one ? A THR 59 OG1 ? ? ? 1_555 D MAN . C1 ? ? A THR 59 A MAN 301 1_555 ? ? ? ? ? ? ? 1.452 ? O-Glycosylation covale2 covale one ? A ASN 134 ND2 ? ? ? 1_555 B NAG . C1 ? ? A ASN 134 B NAG 1 1_555 ? ? ? ? ? ? ? 1.400 ? N-Glycosylation covale3 covale both ? B NAG . O4 ? ? ? 1_555 B NAG . C1 ? ? B NAG 1 B NAG 2 1_555 ? ? ? ? ? ? ? 1.426 ? ? covale4 covale both ? C XYP . O4 ? ? ? 1_555 C XYP . C1 ? ? C XYP 1 C XYP 2 1_555 ? ? ? ? ? ? ? 1.406 ? ? covale5 covale both ? C XYP . O4 ? ? ? 1_555 C XYP . C1 ? ? C XYP 2 C XYP 3 1_555 ? ? ? ? ? ? ? 1.444 ? ? covale6 covale both ? C XYP . O4 ? ? ? 1_555 C XYP . C1 ? ? C XYP 3 C XYP 4 1_555 ? ? ? ? ? ? ? 1.443 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 GLN 45 A . ? GLN 45 A PRO 46 A ? PRO 46 A 1 -1.28 2 ASP 78 A . ? ASP 78 A PRO 79 A ? PRO 79 A 1 9.07 3 TYR 163 A . ? TYR 163 A PRO 164 A ? PRO 164 A 1 -5.75 4 PHE 190 A . ? PHE 190 A PRO 191 A ? PRO 191 A 1 -9.71 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 3 ? AA3 ? 5 ? AA4 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel AA3 4 5 ? anti-parallel AA4 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 12 ? ASP A 13 ? VAL A 12 ASP A 13 AA1 2 VAL A 3 ? VAL A 9 ? VAL A 3 VAL A 9 AA1 3 THR A 59 ? HIS A 65 ? THR A 59 HIS A 65 AA1 4 ASN A 134 ? THR A 138 ? ASN A 134 THR A 138 AA2 1 VAL A 20 ? ARG A 21 ? VAL A 20 ARG A 21 AA2 2 GLN A 167 ? GLY A 180 ? GLN A 167 GLY A 180 AA2 3 ALA A 52 ? PRO A 55 ? ALA A 52 PRO A 55 AA3 1 VAL A 20 ? ARG A 21 ? VAL A 20 ARG A 21 AA3 2 GLN A 167 ? GLY A 180 ? GLN A 167 GLY A 180 AA3 3 GLN A 144 ? SER A 156 ? GLN A 144 SER A 156 AA3 4 VAL A 88 ? LYS A 94 ? VAL A 88 LYS A 94 AA3 5 TRP A 108 ? ASP A 114 ? TRP A 108 ASP A 114 AA4 1 TYR A 116 ? THR A 117 ? TYR A 116 THR A 117 AA4 2 GLN A 122 ? TRP A 123 ? GLN A 122 TRP A 123 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O VAL A 12 ? O VAL A 12 N VAL A 9 ? N VAL A 9 AA1 2 3 N SER A 6 ? N SER A 6 O HIS A 63 ? O HIS A 63 AA1 3 4 N VAL A 60 ? N VAL A 60 O PHE A 137 ? O PHE A 137 AA2 1 2 N ARG A 21 ? N ARG A 21 O CYS A 172 ? O CYS A 172 AA2 2 3 O ASN A 176 ? O ASN A 176 N ALA A 52 ? N ALA A 52 AA3 1 2 N ARG A 21 ? N ARG A 21 O CYS A 172 ? O CYS A 172 AA3 2 3 O GLY A 173 ? O GLY A 173 N LEU A 150 ? N LEU A 150 AA3 3 4 O GLU A 153 ? O GLU A 153 N LEU A 89 ? N LEU A 89 AA3 4 5 N LEU A 92 ? N LEU A 92 O PHE A 109 ? O PHE A 109 AA4 1 2 N THR A 117 ? N THR A 117 O GLN A 122 ? O GLN A 122 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 HOH _pdbx_validate_close_contact.auth_seq_id_1 489 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 614 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.19 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 HOH _pdbx_validate_symm_contact.auth_seq_id_1 593 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 HOH _pdbx_validate_symm_contact.auth_seq_id_2 601 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 1_655 _pdbx_validate_symm_contact.dist 2.08 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 40 ? ? 70.45 -163.75 2 1 ASN A 181 ? ? -140.49 -133.40 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 BCN N1 N N N 74 BCN C1 C N N 75 BCN C2 C N N 76 BCN O21 O N N 77 BCN O22 O N N 78 BCN C3 C N N 79 BCN C4 C N N 80 BCN O4 O N N 81 BCN C5 C N N 82 BCN C6 C N N 83 BCN O6 O N N 84 BCN H11 H N N 85 BCN H12 H N N 86 BCN HO2 H N N 87 BCN H31 H N N 88 BCN H32 H N N 89 BCN H41 H N N 90 BCN H42 H N N 91 BCN HO4 H N N 92 BCN H51 H N N 93 BCN H52 H N N 94 BCN H61 H N N 95 BCN H62 H N N 96 BCN HO6 H N N 97 CYS N N N N 98 CYS CA C N R 99 CYS C C N N 100 CYS O O N N 101 CYS CB C N N 102 CYS SG S N N 103 CYS OXT O N N 104 CYS H H N N 105 CYS H2 H N N 106 CYS HA H N N 107 CYS HB2 H N N 108 CYS HB3 H N N 109 CYS HG H N N 110 CYS HXT H N N 111 GLN N N N N 112 GLN CA C N S 113 GLN C C N N 114 GLN O O N N 115 GLN CB C N N 116 GLN CG C N N 117 GLN CD C N N 118 GLN OE1 O N N 119 GLN NE2 N N N 120 GLN OXT O N N 121 GLN H H N N 122 GLN H2 H N N 123 GLN HA H N N 124 GLN HB2 H N N 125 GLN HB3 H N N 126 GLN HG2 H N N 127 GLN HG3 H N N 128 GLN HE21 H N N 129 GLN HE22 H N N 130 GLN HXT H N N 131 GLU N N N N 132 GLU CA C N S 133 GLU C C N N 134 GLU O O N N 135 GLU CB C N N 136 GLU CG C N N 137 GLU CD C N N 138 GLU OE1 O N N 139 GLU OE2 O N N 140 GLU OXT O N N 141 GLU H H N N 142 GLU H2 H N N 143 GLU HA H N N 144 GLU HB2 H N N 145 GLU HB3 H N N 146 GLU HG2 H N N 147 GLU HG3 H N N 148 GLU HE2 H N N 149 GLU HXT H N N 150 GLY N N N N 151 GLY CA C N N 152 GLY C C N N 153 GLY O O N N 154 GLY OXT O N N 155 GLY H H N N 156 GLY H2 H N N 157 GLY HA2 H N N 158 GLY HA3 H N N 159 GLY HXT H N N 160 HIS N N N N 161 HIS CA C N S 162 HIS C C N N 163 HIS O O N N 164 HIS CB C N N 165 HIS CG C Y N 166 HIS ND1 N Y N 167 HIS CD2 C Y N 168 HIS CE1 C Y N 169 HIS NE2 N Y N 170 HIS OXT O N N 171 HIS H H N N 172 HIS H2 H N N 173 HIS HA H N N 174 HIS HB2 H N N 175 HIS HB3 H N N 176 HIS HD1 H N N 177 HIS HD2 H N N 178 HIS HE1 H N N 179 HIS HE2 H N N 180 HIS HXT H N N 181 HOH O O N N 182 HOH H1 H N N 183 HOH H2 H N N 184 ILE N N N N 185 ILE CA C N S 186 ILE C C N N 187 ILE O O N N 188 ILE CB C N S 189 ILE CG1 C N N 190 ILE CG2 C N N 191 ILE CD1 C N N 192 ILE OXT O N N 193 ILE H H N N 194 ILE H2 H N N 195 ILE HA H N N 196 ILE HB H N N 197 ILE HG12 H N N 198 ILE HG13 H N N 199 ILE HG21 H N N 200 ILE HG22 H N N 201 ILE HG23 H N N 202 ILE HD11 H N N 203 ILE HD12 H N N 204 ILE HD13 H N N 205 ILE HXT H N N 206 LEU N N N N 207 LEU CA C N S 208 LEU C C N N 209 LEU O O N N 210 LEU CB C N N 211 LEU CG C N N 212 LEU CD1 C N N 213 LEU CD2 C N N 214 LEU OXT O N N 215 LEU H H N N 216 LEU H2 H N N 217 LEU HA H N N 218 LEU HB2 H N N 219 LEU HB3 H N N 220 LEU HG H N N 221 LEU HD11 H N N 222 LEU HD12 H N N 223 LEU HD13 H N N 224 LEU HD21 H N N 225 LEU HD22 H N N 226 LEU HD23 H N N 227 LEU HXT H N N 228 LYS N N N N 229 LYS CA C N S 230 LYS C C N N 231 LYS O O N N 232 LYS CB C N N 233 LYS CG C N N 234 LYS CD C N N 235 LYS CE C N N 236 LYS NZ N N N 237 LYS OXT O N N 238 LYS H H N N 239 LYS H2 H N N 240 LYS HA H N N 241 LYS HB2 H N N 242 LYS HB3 H N N 243 LYS HG2 H N N 244 LYS HG3 H N N 245 LYS HD2 H N N 246 LYS HD3 H N N 247 LYS HE2 H N N 248 LYS HE3 H N N 249 LYS HZ1 H N N 250 LYS HZ2 H N N 251 LYS HZ3 H N N 252 LYS HXT H N N 253 MAN C1 C N S 254 MAN C2 C N S 255 MAN C3 C N S 256 MAN C4 C N S 257 MAN C5 C N R 258 MAN C6 C N N 259 MAN O1 O N N 260 MAN O2 O N N 261 MAN O3 O N N 262 MAN O4 O N N 263 MAN O5 O N N 264 MAN O6 O N N 265 MAN H1 H N N 266 MAN H2 H N N 267 MAN H3 H N N 268 MAN H4 H N N 269 MAN H5 H N N 270 MAN H61 H N N 271 MAN H62 H N N 272 MAN HO1 H N N 273 MAN HO2 H N N 274 MAN HO3 H N N 275 MAN HO4 H N N 276 MAN HO6 H N N 277 NAG C1 C N R 278 NAG C2 C N R 279 NAG C3 C N R 280 NAG C4 C N S 281 NAG C5 C N R 282 NAG C6 C N N 283 NAG C7 C N N 284 NAG C8 C N N 285 NAG N2 N N N 286 NAG O1 O N N 287 NAG O3 O N N 288 NAG O4 O N N 289 NAG O5 O N N 290 NAG O6 O N N 291 NAG O7 O N N 292 NAG H1 H N N 293 NAG H2 H N N 294 NAG H3 H N N 295 NAG H4 H N N 296 NAG H5 H N N 297 NAG H61 H N N 298 NAG H62 H N N 299 NAG H81 H N N 300 NAG H82 H N N 301 NAG H83 H N N 302 NAG HN2 H N N 303 NAG HO1 H N N 304 NAG HO3 H N N 305 NAG HO4 H N N 306 NAG HO6 H N N 307 PHE N N N N 308 PHE CA C N S 309 PHE C C N N 310 PHE O O N N 311 PHE CB C N N 312 PHE CG C Y N 313 PHE CD1 C Y N 314 PHE CD2 C Y N 315 PHE CE1 C Y N 316 PHE CE2 C Y N 317 PHE CZ C Y N 318 PHE OXT O N N 319 PHE H H N N 320 PHE H2 H N N 321 PHE HA H N N 322 PHE HB2 H N N 323 PHE HB3 H N N 324 PHE HD1 H N N 325 PHE HD2 H N N 326 PHE HE1 H N N 327 PHE HE2 H N N 328 PHE HZ H N N 329 PHE HXT H N N 330 PRO N N N N 331 PRO CA C N S 332 PRO C C N N 333 PRO O O N N 334 PRO CB C N N 335 PRO CG C N N 336 PRO CD C N N 337 PRO OXT O N N 338 PRO H H N N 339 PRO HA H N N 340 PRO HB2 H N N 341 PRO HB3 H N N 342 PRO HG2 H N N 343 PRO HG3 H N N 344 PRO HD2 H N N 345 PRO HD3 H N N 346 PRO HXT H N N 347 SER N N N N 348 SER CA C N S 349 SER C C N N 350 SER O O N N 351 SER CB C N N 352 SER OG O N N 353 SER OXT O N N 354 SER H H N N 355 SER H2 H N N 356 SER HA H N N 357 SER HB2 H N N 358 SER HB3 H N N 359 SER HG H N N 360 SER HXT H N N 361 THR N N N N 362 THR CA C N S 363 THR C C N N 364 THR O O N N 365 THR CB C N R 366 THR OG1 O N N 367 THR CG2 C N N 368 THR OXT O N N 369 THR H H N N 370 THR H2 H N N 371 THR HA H N N 372 THR HB H N N 373 THR HG1 H N N 374 THR HG21 H N N 375 THR HG22 H N N 376 THR HG23 H N N 377 THR HXT H N N 378 TRP N N N N 379 TRP CA C N S 380 TRP C C N N 381 TRP O O N N 382 TRP CB C N N 383 TRP CG C Y N 384 TRP CD1 C Y N 385 TRP CD2 C Y N 386 TRP NE1 N Y N 387 TRP CE2 C Y N 388 TRP CE3 C Y N 389 TRP CZ2 C Y N 390 TRP CZ3 C Y N 391 TRP CH2 C Y N 392 TRP OXT O N N 393 TRP H H N N 394 TRP H2 H N N 395 TRP HA H N N 396 TRP HB2 H N N 397 TRP HB3 H N N 398 TRP HD1 H N N 399 TRP HE1 H N N 400 TRP HE3 H N N 401 TRP HZ2 H N N 402 TRP HZ3 H N N 403 TRP HH2 H N N 404 TRP HXT H N N 405 TYR N N N N 406 TYR CA C N S 407 TYR C C N N 408 TYR O O N N 409 TYR CB C N N 410 TYR CG C Y N 411 TYR CD1 C Y N 412 TYR CD2 C Y N 413 TYR CE1 C Y N 414 TYR CE2 C Y N 415 TYR CZ C Y N 416 TYR OH O N N 417 TYR OXT O N N 418 TYR H H N N 419 TYR H2 H N N 420 TYR HA H N N 421 TYR HB2 H N N 422 TYR HB3 H N N 423 TYR HD1 H N N 424 TYR HD2 H N N 425 TYR HE1 H N N 426 TYR HE2 H N N 427 TYR HH H N N 428 TYR HXT H N N 429 VAL N N N N 430 VAL CA C N S 431 VAL C C N N 432 VAL O O N N 433 VAL CB C N N 434 VAL CG1 C N N 435 VAL CG2 C N N 436 VAL OXT O N N 437 VAL H H N N 438 VAL H2 H N N 439 VAL HA H N N 440 VAL HB H N N 441 VAL HG11 H N N 442 VAL HG12 H N N 443 VAL HG13 H N N 444 VAL HG21 H N N 445 VAL HG22 H N N 446 VAL HG23 H N N 447 VAL HXT H N N 448 XYP O1 O N N 449 XYP C1 C N R 450 XYP C2 C N R 451 XYP C3 C N S 452 XYP C4 C N R 453 XYP C5 C N N 454 XYP O2 O N N 455 XYP O3 O N N 456 XYP O4 O N N 457 XYP O5 O N N 458 XYP HO1 H N N 459 XYP H1 H N N 460 XYP H2 H N N 461 XYP H3 H N N 462 XYP H4 H N N 463 XYP H51 H N N 464 XYP H52 H N N 465 XYP HO2 H N N 466 XYP HO3 H N N 467 XYP HO4 H N N 468 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 BCN N1 C1 sing N N 70 BCN N1 C3 sing N N 71 BCN N1 C5 sing N N 72 BCN C1 C2 sing N N 73 BCN C1 H11 sing N N 74 BCN C1 H12 sing N N 75 BCN C2 O21 doub N N 76 BCN C2 O22 sing N N 77 BCN O22 HO2 sing N N 78 BCN C3 C4 sing N N 79 BCN C3 H31 sing N N 80 BCN C3 H32 sing N N 81 BCN C4 O4 sing N N 82 BCN C4 H41 sing N N 83 BCN C4 H42 sing N N 84 BCN O4 HO4 sing N N 85 BCN C5 C6 sing N N 86 BCN C5 H51 sing N N 87 BCN C5 H52 sing N N 88 BCN C6 O6 sing N N 89 BCN C6 H61 sing N N 90 BCN C6 H62 sing N N 91 BCN O6 HO6 sing N N 92 CYS N CA sing N N 93 CYS N H sing N N 94 CYS N H2 sing N N 95 CYS CA C sing N N 96 CYS CA CB sing N N 97 CYS CA HA sing N N 98 CYS C O doub N N 99 CYS C OXT sing N N 100 CYS CB SG sing N N 101 CYS CB HB2 sing N N 102 CYS CB HB3 sing N N 103 CYS SG HG sing N N 104 CYS OXT HXT sing N N 105 GLN N CA sing N N 106 GLN N H sing N N 107 GLN N H2 sing N N 108 GLN CA C sing N N 109 GLN CA CB sing N N 110 GLN CA HA sing N N 111 GLN C O doub N N 112 GLN C OXT sing N N 113 GLN CB CG sing N N 114 GLN CB HB2 sing N N 115 GLN CB HB3 sing N N 116 GLN CG CD sing N N 117 GLN CG HG2 sing N N 118 GLN CG HG3 sing N N 119 GLN CD OE1 doub N N 120 GLN CD NE2 sing N N 121 GLN NE2 HE21 sing N N 122 GLN NE2 HE22 sing N N 123 GLN OXT HXT sing N N 124 GLU N CA sing N N 125 GLU N H sing N N 126 GLU N H2 sing N N 127 GLU CA C sing N N 128 GLU CA CB sing N N 129 GLU CA HA sing N N 130 GLU C O doub N N 131 GLU C OXT sing N N 132 GLU CB CG sing N N 133 GLU CB HB2 sing N N 134 GLU CB HB3 sing N N 135 GLU CG CD sing N N 136 GLU CG HG2 sing N N 137 GLU CG HG3 sing N N 138 GLU CD OE1 doub N N 139 GLU CD OE2 sing N N 140 GLU OE2 HE2 sing N N 141 GLU OXT HXT sing N N 142 GLY N CA sing N N 143 GLY N H sing N N 144 GLY N H2 sing N N 145 GLY CA C sing N N 146 GLY CA HA2 sing N N 147 GLY CA HA3 sing N N 148 GLY C O doub N N 149 GLY C OXT sing N N 150 GLY OXT HXT sing N N 151 HIS N CA sing N N 152 HIS N H sing N N 153 HIS N H2 sing N N 154 HIS CA C sing N N 155 HIS CA CB sing N N 156 HIS CA HA sing N N 157 HIS C O doub N N 158 HIS C OXT sing N N 159 HIS CB CG sing N N 160 HIS CB HB2 sing N N 161 HIS CB HB3 sing N N 162 HIS CG ND1 sing Y N 163 HIS CG CD2 doub Y N 164 HIS ND1 CE1 doub Y N 165 HIS ND1 HD1 sing N N 166 HIS CD2 NE2 sing Y N 167 HIS CD2 HD2 sing N N 168 HIS CE1 NE2 sing Y N 169 HIS CE1 HE1 sing N N 170 HIS NE2 HE2 sing N N 171 HIS OXT HXT sing N N 172 HOH O H1 sing N N 173 HOH O H2 sing N N 174 ILE N CA sing N N 175 ILE N H sing N N 176 ILE N H2 sing N N 177 ILE CA C sing N N 178 ILE CA CB sing N N 179 ILE CA HA sing N N 180 ILE C O doub N N 181 ILE C OXT sing N N 182 ILE CB CG1 sing N N 183 ILE CB CG2 sing N N 184 ILE CB HB sing N N 185 ILE CG1 CD1 sing N N 186 ILE CG1 HG12 sing N N 187 ILE CG1 HG13 sing N N 188 ILE CG2 HG21 sing N N 189 ILE CG2 HG22 sing N N 190 ILE CG2 HG23 sing N N 191 ILE CD1 HD11 sing N N 192 ILE CD1 HD12 sing N N 193 ILE CD1 HD13 sing N N 194 ILE OXT HXT sing N N 195 LEU N CA sing N N 196 LEU N H sing N N 197 LEU N H2 sing N N 198 LEU CA C sing N N 199 LEU CA CB sing N N 200 LEU CA HA sing N N 201 LEU C O doub N N 202 LEU C OXT sing N N 203 LEU CB CG sing N N 204 LEU CB HB2 sing N N 205 LEU CB HB3 sing N N 206 LEU CG CD1 sing N N 207 LEU CG CD2 sing N N 208 LEU CG HG sing N N 209 LEU CD1 HD11 sing N N 210 LEU CD1 HD12 sing N N 211 LEU CD1 HD13 sing N N 212 LEU CD2 HD21 sing N N 213 LEU CD2 HD22 sing N N 214 LEU CD2 HD23 sing N N 215 LEU OXT HXT sing N N 216 LYS N CA sing N N 217 LYS N H sing N N 218 LYS N H2 sing N N 219 LYS CA C sing N N 220 LYS CA CB sing N N 221 LYS CA HA sing N N 222 LYS C O doub N N 223 LYS C OXT sing N N 224 LYS CB CG sing N N 225 LYS CB HB2 sing N N 226 LYS CB HB3 sing N N 227 LYS CG CD sing N N 228 LYS CG HG2 sing N N 229 LYS CG HG3 sing N N 230 LYS CD CE sing N N 231 LYS CD HD2 sing N N 232 LYS CD HD3 sing N N 233 LYS CE NZ sing N N 234 LYS CE HE2 sing N N 235 LYS CE HE3 sing N N 236 LYS NZ HZ1 sing N N 237 LYS NZ HZ2 sing N N 238 LYS NZ HZ3 sing N N 239 LYS OXT HXT sing N N 240 MAN C1 C2 sing N N 241 MAN C1 O1 sing N N 242 MAN C1 O5 sing N N 243 MAN C1 H1 sing N N 244 MAN C2 C3 sing N N 245 MAN C2 O2 sing N N 246 MAN C2 H2 sing N N 247 MAN C3 C4 sing N N 248 MAN C3 O3 sing N N 249 MAN C3 H3 sing N N 250 MAN C4 C5 sing N N 251 MAN C4 O4 sing N N 252 MAN C4 H4 sing N N 253 MAN C5 C6 sing N N 254 MAN C5 O5 sing N N 255 MAN C5 H5 sing N N 256 MAN C6 O6 sing N N 257 MAN C6 H61 sing N N 258 MAN C6 H62 sing N N 259 MAN O1 HO1 sing N N 260 MAN O2 HO2 sing N N 261 MAN O3 HO3 sing N N 262 MAN O4 HO4 sing N N 263 MAN O6 HO6 sing N N 264 NAG C1 C2 sing N N 265 NAG C1 O1 sing N N 266 NAG C1 O5 sing N N 267 NAG C1 H1 sing N N 268 NAG C2 C3 sing N N 269 NAG C2 N2 sing N N 270 NAG C2 H2 sing N N 271 NAG C3 C4 sing N N 272 NAG C3 O3 sing N N 273 NAG C3 H3 sing N N 274 NAG C4 C5 sing N N 275 NAG C4 O4 sing N N 276 NAG C4 H4 sing N N 277 NAG C5 C6 sing N N 278 NAG C5 O5 sing N N 279 NAG C5 H5 sing N N 280 NAG C6 O6 sing N N 281 NAG C6 H61 sing N N 282 NAG C6 H62 sing N N 283 NAG C7 C8 sing N N 284 NAG C7 N2 sing N N 285 NAG C7 O7 doub N N 286 NAG C8 H81 sing N N 287 NAG C8 H82 sing N N 288 NAG C8 H83 sing N N 289 NAG N2 HN2 sing N N 290 NAG O1 HO1 sing N N 291 NAG O3 HO3 sing N N 292 NAG O4 HO4 sing N N 293 NAG O6 HO6 sing N N 294 PHE N CA sing N N 295 PHE N H sing N N 296 PHE N H2 sing N N 297 PHE CA C sing N N 298 PHE CA CB sing N N 299 PHE CA HA sing N N 300 PHE C O doub N N 301 PHE C OXT sing N N 302 PHE CB CG sing N N 303 PHE CB HB2 sing N N 304 PHE CB HB3 sing N N 305 PHE CG CD1 doub Y N 306 PHE CG CD2 sing Y N 307 PHE CD1 CE1 sing Y N 308 PHE CD1 HD1 sing N N 309 PHE CD2 CE2 doub Y N 310 PHE CD2 HD2 sing N N 311 PHE CE1 CZ doub Y N 312 PHE CE1 HE1 sing N N 313 PHE CE2 CZ sing Y N 314 PHE CE2 HE2 sing N N 315 PHE CZ HZ sing N N 316 PHE OXT HXT sing N N 317 PRO N CA sing N N 318 PRO N CD sing N N 319 PRO N H sing N N 320 PRO CA C sing N N 321 PRO CA CB sing N N 322 PRO CA HA sing N N 323 PRO C O doub N N 324 PRO C OXT sing N N 325 PRO CB CG sing N N 326 PRO CB HB2 sing N N 327 PRO CB HB3 sing N N 328 PRO CG CD sing N N 329 PRO CG HG2 sing N N 330 PRO CG HG3 sing N N 331 PRO CD HD2 sing N N 332 PRO CD HD3 sing N N 333 PRO OXT HXT sing N N 334 SER N CA sing N N 335 SER N H sing N N 336 SER N H2 sing N N 337 SER CA C sing N N 338 SER CA CB sing N N 339 SER CA HA sing N N 340 SER C O doub N N 341 SER C OXT sing N N 342 SER CB OG sing N N 343 SER CB HB2 sing N N 344 SER CB HB3 sing N N 345 SER OG HG sing N N 346 SER OXT HXT sing N N 347 THR N CA sing N N 348 THR N H sing N N 349 THR N H2 sing N N 350 THR CA C sing N N 351 THR CA CB sing N N 352 THR CA HA sing N N 353 THR C O doub N N 354 THR C OXT sing N N 355 THR CB OG1 sing N N 356 THR CB CG2 sing N N 357 THR CB HB sing N N 358 THR OG1 HG1 sing N N 359 THR CG2 HG21 sing N N 360 THR CG2 HG22 sing N N 361 THR CG2 HG23 sing N N 362 THR OXT HXT sing N N 363 TRP N CA sing N N 364 TRP N H sing N N 365 TRP N H2 sing N N 366 TRP CA C sing N N 367 TRP CA CB sing N N 368 TRP CA HA sing N N 369 TRP C O doub N N 370 TRP C OXT sing N N 371 TRP CB CG sing N N 372 TRP CB HB2 sing N N 373 TRP CB HB3 sing N N 374 TRP CG CD1 doub Y N 375 TRP CG CD2 sing Y N 376 TRP CD1 NE1 sing Y N 377 TRP CD1 HD1 sing N N 378 TRP CD2 CE2 doub Y N 379 TRP CD2 CE3 sing Y N 380 TRP NE1 CE2 sing Y N 381 TRP NE1 HE1 sing N N 382 TRP CE2 CZ2 sing Y N 383 TRP CE3 CZ3 doub Y N 384 TRP CE3 HE3 sing N N 385 TRP CZ2 CH2 doub Y N 386 TRP CZ2 HZ2 sing N N 387 TRP CZ3 CH2 sing Y N 388 TRP CZ3 HZ3 sing N N 389 TRP CH2 HH2 sing N N 390 TRP OXT HXT sing N N 391 TYR N CA sing N N 392 TYR N H sing N N 393 TYR N H2 sing N N 394 TYR CA C sing N N 395 TYR CA CB sing N N 396 TYR CA HA sing N N 397 TYR C O doub N N 398 TYR C OXT sing N N 399 TYR CB CG sing N N 400 TYR CB HB2 sing N N 401 TYR CB HB3 sing N N 402 TYR CG CD1 doub Y N 403 TYR CG CD2 sing Y N 404 TYR CD1 CE1 sing Y N 405 TYR CD1 HD1 sing N N 406 TYR CD2 CE2 doub Y N 407 TYR CD2 HD2 sing N N 408 TYR CE1 CZ doub Y N 409 TYR CE1 HE1 sing N N 410 TYR CE2 CZ sing Y N 411 TYR CE2 HE2 sing N N 412 TYR CZ OH sing N N 413 TYR OH HH sing N N 414 TYR OXT HXT sing N N 415 VAL N CA sing N N 416 VAL N H sing N N 417 VAL N H2 sing N N 418 VAL CA C sing N N 419 VAL CA CB sing N N 420 VAL CA HA sing N N 421 VAL C O doub N N 422 VAL C OXT sing N N 423 VAL CB CG1 sing N N 424 VAL CB CG2 sing N N 425 VAL CB HB sing N N 426 VAL CG1 HG11 sing N N 427 VAL CG1 HG12 sing N N 428 VAL CG1 HG13 sing N N 429 VAL CG2 HG21 sing N N 430 VAL CG2 HG22 sing N N 431 VAL CG2 HG23 sing N N 432 VAL OXT HXT sing N N 433 XYP O1 C1 sing N N 434 XYP O1 HO1 sing N N 435 XYP C1 C2 sing N N 436 XYP C1 O5 sing N N 437 XYP C1 H1 sing N N 438 XYP C2 C3 sing N N 439 XYP C2 O2 sing N N 440 XYP C2 H2 sing N N 441 XYP C3 C4 sing N N 442 XYP C3 O3 sing N N 443 XYP C3 H3 sing N N 444 XYP C4 C5 sing N N 445 XYP C4 O4 sing N N 446 XYP C4 H4 sing N N 447 XYP C5 O5 sing N N 448 XYP C5 H51 sing N N 449 XYP C5 H52 sing N N 450 XYP O2 HO2 sing N N 451 XYP O3 HO3 sing N N 452 XYP O4 HO4 sing N N 453 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Danish Agency for Science Technology and Innovation' Denmark 12-134922 1 'Danish Agency for Science Technology and Innovation' Denmark 12-134923 2 'Novo Nordisk Foundation' Denmark NNF17SA0027704 3 'European Communitys Seventh Framework Programme' Denmark 'BioStruct-X (grant agreement N283570)' 4 'European Commission' Denmark 'CF16-0673 - The Carlsberg Foundation' 5 'European Commission' Denmark 'CF17-0533 - The Carlsberg Foundation' 6 'European Commission' France 'AgreenSkills+ (Marie-Curie FP7 COFUND People Programme under grant agreement 609398)' 7 # loop_ _pdbx_entity_branch_list.entity_id _pdbx_entity_branch_list.comp_id _pdbx_entity_branch_list.num _pdbx_entity_branch_list.hetero 2 NAG 1 n 2 NAG 2 n 3 XYP 1 n 3 XYP 2 n 3 XYP 3 n 3 XYP 4 n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id XYP _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id XYP _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3EJA _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 6RS9 _atom_sites.fract_transf_matrix[1][1] 0.028241 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013738 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012724 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_