data_6RUL # _entry.id 6RUL # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6RUL pdb_00006rul 10.2210/pdb6rul/pdb WWPDB D_1292102567 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-02-12 2 'Structure model' 1 1 2020-02-26 3 'Structure model' 1 2 2020-03-18 4 'Structure model' 1 3 2024-01-24 5 'Structure model' 1 4 2024-11-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Refinement description' 6 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 3 'Structure model' citation_author 5 4 'Structure model' chem_comp_atom 6 4 'Structure model' chem_comp_bond 7 4 'Structure model' database_2 8 4 'Structure model' pdbx_initial_refinement_model 9 5 'Structure model' pdbx_entry_details 10 5 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.pdbx_database_id_DOI' 6 2 'Structure model' '_citation.pdbx_database_id_PubMed' 7 2 'Structure model' '_citation.title' 8 2 'Structure model' '_citation.year' 9 2 'Structure model' '_citation_author.identifier_ORCID' 10 2 'Structure model' '_citation_author.name' 11 3 'Structure model' '_citation.journal_volume' 12 3 'Structure model' '_citation.page_first' 13 3 'Structure model' '_citation.page_last' 14 3 'Structure model' '_citation_author.identifier_ORCID' 15 4 'Structure model' '_database_2.pdbx_DOI' 16 4 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6RUL _pdbx_database_status.recvd_initial_deposition_date 2019-05-28 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # _pdbx_database_related.db_name PDB _pdbx_database_related.details . _pdbx_database_related.db_id 6RUM _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Farrants, H.' 1 ? 'Tarnawski, M.' 2 ? 'Mueller, T.G.' 3 ? 'Otsuka, S.' 4 ? 'Hiblot, J.' 5 ? 'Koch, B.' 6 ? 'Kueblbeck, M.' 7 ? 'Kraeusslich, H.-G.' 8 ? 'Ellenberg, J.' 9 ? 'Johnsson, K.' 10 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Nat.Methods _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1548-7105 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 17 _citation.language ? _citation.page_first 279 _citation.page_last 282 _citation.title 'Chemogenetic Control of Nanobodies.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41592-020-0746-7 _citation.pdbx_database_id_PubMed 32066961 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Farrants, H.' 1 ? primary 'Tarnawski, M.' 2 ? primary 'Muller, T.G.' 3 ? primary 'Otsuka, S.' 4 ? primary 'Hiblot, J.' 5 ? primary 'Koch, B.' 6 ? primary 'Kueblbeck, M.' 7 ? primary 'Krausslich, H.G.' 8 ? primary 'Ellenberg, J.' 9 ? primary 'Johnsson, K.' 10 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man ;GFP-LAMA-F98 a GFP enhancer nanobody with cpDHFR insertion,Dihydrofolate reductase,GFP-LAMA-F98 a GFP enhancer nanobody with cpDHFR insertion,Dihydrofolate reductase,Dihydrofolate reductase,GFP-LAMA-F98 a GFP enhancer nanobody with cpDHFR insertion,Dihydrofolate reductase,GFP-LAMA-F98 a GFP enhancer nanobody with cpDHFR insertion ; 30984.646 1 1.5.1.3,1.5.1.3,1.5.1.3,1.5.1.3 ? ? ? 2 non-polymer syn TRIMETHOPRIM 290.318 1 ? ? ? ? 3 non-polymer syn 'NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE' 745.421 1 ? ? ? ? 4 non-polymer syn 'TRIETHYLENE GLYCOL' 150.173 1 ? ? ? ? 5 water nat water 18.015 52 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GQVQLVESGGALVQPGGSLRLSCAASGFPVNRYSMRWYRQAPGKEREWVAGMSSAGDRSSYEDSVKGRFTISRDDARNTV YLQMNSLKPEDTAVYYCNVNVGFLPADLAWFKRNTLNKPVIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDE AIAACGDVPEIMVIGGGRVYEQFLPKAQKLYLTHIDAEVEGDTHFPDYEPDDWESVFSEFHDADAQNSHSYCFEILERRG GGGGMISLIAALAVDRVIGMENAMPWNEYWGQGTQVTVS ; _entity_poly.pdbx_seq_one_letter_code_can ;GQVQLVESGGALVQPGGSLRLSCAASGFPVNRYSMRWYRQAPGKEREWVAGMSSAGDRSSYEDSVKGRFTISRDDARNTV YLQMNSLKPEDTAVYYCNVNVGFLPADLAWFKRNTLNKPVIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDE AIAACGDVPEIMVIGGGRVYEQFLPKAQKLYLTHIDAEVEGDTHFPDYEPDDWESVFSEFHDADAQNSHSYCFEILERRG GGGGMISLIAALAVDRVIGMENAMPWNEYWGQGTQVTVS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 TRIMETHOPRIM TOP 3 'NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE' NDP 4 'TRIETHYLENE GLYCOL' PGE 5 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 GLN n 1 3 VAL n 1 4 GLN n 1 5 LEU n 1 6 VAL n 1 7 GLU n 1 8 SER n 1 9 GLY n 1 10 GLY n 1 11 ALA n 1 12 LEU n 1 13 VAL n 1 14 GLN n 1 15 PRO n 1 16 GLY n 1 17 GLY n 1 18 SER n 1 19 LEU n 1 20 ARG n 1 21 LEU n 1 22 SER n 1 23 CYS n 1 24 ALA n 1 25 ALA n 1 26 SER n 1 27 GLY n 1 28 PHE n 1 29 PRO n 1 30 VAL n 1 31 ASN n 1 32 ARG n 1 33 TYR n 1 34 SER n 1 35 MET n 1 36 ARG n 1 37 TRP n 1 38 TYR n 1 39 ARG n 1 40 GLN n 1 41 ALA n 1 42 PRO n 1 43 GLY n 1 44 LYS n 1 45 GLU n 1 46 ARG n 1 47 GLU n 1 48 TRP n 1 49 VAL n 1 50 ALA n 1 51 GLY n 1 52 MET n 1 53 SER n 1 54 SER n 1 55 ALA n 1 56 GLY n 1 57 ASP n 1 58 ARG n 1 59 SER n 1 60 SER n 1 61 TYR n 1 62 GLU n 1 63 ASP n 1 64 SER n 1 65 VAL n 1 66 LYS n 1 67 GLY n 1 68 ARG n 1 69 PHE n 1 70 THR n 1 71 ILE n 1 72 SER n 1 73 ARG n 1 74 ASP n 1 75 ASP n 1 76 ALA n 1 77 ARG n 1 78 ASN n 1 79 THR n 1 80 VAL n 1 81 TYR n 1 82 LEU n 1 83 GLN n 1 84 MET n 1 85 ASN n 1 86 SER n 1 87 LEU n 1 88 LYS n 1 89 PRO n 1 90 GLU n 1 91 ASP n 1 92 THR n 1 93 ALA n 1 94 VAL n 1 95 TYR n 1 96 TYR n 1 97 CYS n 1 98 ASN n 1 99 VAL n 1 100 ASN n 1 101 VAL n 1 102 GLY n 1 103 PHE n 1 104 LEU n 1 105 PRO n 1 106 ALA n 1 107 ASP n 1 108 LEU n 1 109 ALA n 1 110 TRP n 1 111 PHE n 1 112 LYS n 1 113 ARG n 1 114 ASN n 1 115 THR n 1 116 LEU n 1 117 ASN n 1 118 LYS n 1 119 PRO n 1 120 VAL n 1 121 ILE n 1 122 MET n 1 123 GLY n 1 124 ARG n 1 125 HIS n 1 126 THR n 1 127 TRP n 1 128 GLU n 1 129 SER n 1 130 ILE n 1 131 GLY n 1 132 ARG n 1 133 PRO n 1 134 LEU n 1 135 PRO n 1 136 GLY n 1 137 ARG n 1 138 LYS n 1 139 ASN n 1 140 ILE n 1 141 ILE n 1 142 LEU n 1 143 SER n 1 144 SER n 1 145 GLN n 1 146 PRO n 1 147 GLY n 1 148 THR n 1 149 ASP n 1 150 ASP n 1 151 ARG n 1 152 VAL n 1 153 THR n 1 154 TRP n 1 155 VAL n 1 156 LYS n 1 157 SER n 1 158 VAL n 1 159 ASP n 1 160 GLU n 1 161 ALA n 1 162 ILE n 1 163 ALA n 1 164 ALA n 1 165 CYS n 1 166 GLY n 1 167 ASP n 1 168 VAL n 1 169 PRO n 1 170 GLU n 1 171 ILE n 1 172 MET n 1 173 VAL n 1 174 ILE n 1 175 GLY n 1 176 GLY n 1 177 GLY n 1 178 ARG n 1 179 VAL n 1 180 TYR n 1 181 GLU n 1 182 GLN n 1 183 PHE n 1 184 LEU n 1 185 PRO n 1 186 LYS n 1 187 ALA n 1 188 GLN n 1 189 LYS n 1 190 LEU n 1 191 TYR n 1 192 LEU n 1 193 THR n 1 194 HIS n 1 195 ILE n 1 196 ASP n 1 197 ALA n 1 198 GLU n 1 199 VAL n 1 200 GLU n 1 201 GLY n 1 202 ASP n 1 203 THR n 1 204 HIS n 1 205 PHE n 1 206 PRO n 1 207 ASP n 1 208 TYR n 1 209 GLU n 1 210 PRO n 1 211 ASP n 1 212 ASP n 1 213 TRP n 1 214 GLU n 1 215 SER n 1 216 VAL n 1 217 PHE n 1 218 SER n 1 219 GLU n 1 220 PHE n 1 221 HIS n 1 222 ASP n 1 223 ALA n 1 224 ASP n 1 225 ALA n 1 226 GLN n 1 227 ASN n 1 228 SER n 1 229 HIS n 1 230 SER n 1 231 TYR n 1 232 CYS n 1 233 PHE n 1 234 GLU n 1 235 ILE n 1 236 LEU n 1 237 GLU n 1 238 ARG n 1 239 ARG n 1 240 GLY n 1 241 GLY n 1 242 GLY n 1 243 GLY n 1 244 GLY n 1 245 MET n 1 246 ILE n 1 247 SER n 1 248 LEU n 1 249 ILE n 1 250 ALA n 1 251 ALA n 1 252 LEU n 1 253 ALA n 1 254 VAL n 1 255 ASP n 1 256 ARG n 1 257 VAL n 1 258 ILE n 1 259 GLY n 1 260 MET n 1 261 GLU n 1 262 ASN n 1 263 ALA n 1 264 MET n 1 265 PRO n 1 266 TRP n 1 267 ASN n 1 268 GLU n 1 269 TYR n 1 270 TRP n 1 271 GLY n 1 272 GLN n 1 273 GLY n 1 274 THR n 1 275 GLN n 1 276 VAL n 1 277 THR n 1 278 VAL n 1 279 SER n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 103 ? ? ? ? ? ? ? ? ? 'Lama glama' 9844 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 1 2 sample 'Biological sequence' 104 239 ? ? 'folA, tmrA, b0048, JW0047' ? ? ? ? ? ? 'Escherichia coli (strain K12)' 83333 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 1 3 sample 'Biological sequence' 240 267 ? ? 'folA, tmrA, b0048, JW0047' ? ? ? ? ? ? 'Escherichia coli (strain K12)' 83333 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 1 4 sample 'Biological sequence' 268 279 ? ? ? ? ? ? ? ? ? 'Lama glama' 9844 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NDP non-polymer . 'NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE' ? 'C21 H30 N7 O17 P3' 745.421 PGE non-polymer . 'TRIETHYLENE GLYCOL' ? 'C6 H14 O4' 150.173 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TOP non-polymer . TRIMETHOPRIM ? 'C14 H18 N4 O3' 290.318 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 0 ? ? ? A . n A 1 2 GLN 2 1 1 GLN GLN A . n A 1 3 VAL 3 2 2 VAL VAL A . n A 1 4 GLN 4 3 3 GLN GLN A . n A 1 5 LEU 5 4 4 LEU LEU A . n A 1 6 VAL 6 5 5 VAL VAL A . n A 1 7 GLU 7 6 6 GLU GLU A . n A 1 8 SER 8 7 7 SER SER A . n A 1 9 GLY 9 8 8 GLY GLY A . n A 1 10 GLY 10 9 9 GLY GLY A . n A 1 11 ALA 11 10 10 ALA ALA A . n A 1 12 LEU 12 11 11 LEU LEU A . n A 1 13 VAL 13 12 12 VAL VAL A . n A 1 14 GLN 14 13 13 GLN GLN A . n A 1 15 PRO 15 14 14 PRO PRO A . n A 1 16 GLY 16 15 15 GLY GLY A . n A 1 17 GLY 17 16 16 GLY GLY A . n A 1 18 SER 18 17 17 SER SER A . n A 1 19 LEU 19 18 18 LEU LEU A . n A 1 20 ARG 20 19 19 ARG ARG A . n A 1 21 LEU 21 20 20 LEU LEU A . n A 1 22 SER 22 21 21 SER SER A . n A 1 23 CYS 23 22 22 CYS CYS A . n A 1 24 ALA 24 23 23 ALA ALA A . n A 1 25 ALA 25 24 24 ALA ALA A . n A 1 26 SER 26 25 25 SER SER A . n A 1 27 GLY 27 26 26 GLY GLY A . n A 1 28 PHE 28 27 27 PHE PHE A . n A 1 29 PRO 29 28 28 PRO PRO A . n A 1 30 VAL 30 29 29 VAL VAL A . n A 1 31 ASN 31 30 30 ASN ASN A . n A 1 32 ARG 32 31 31 ARG ARG A . n A 1 33 TYR 33 32 32 TYR TYR A . n A 1 34 SER 34 33 33 SER SER A . n A 1 35 MET 35 34 34 MET MET A . n A 1 36 ARG 36 35 35 ARG ARG A . n A 1 37 TRP 37 36 36 TRP TRP A . n A 1 38 TYR 38 37 37 TYR TYR A . n A 1 39 ARG 39 38 38 ARG ARG A . n A 1 40 GLN 40 39 39 GLN GLN A . n A 1 41 ALA 41 40 40 ALA ALA A . n A 1 42 PRO 42 41 41 PRO PRO A . n A 1 43 GLY 43 42 42 GLY GLY A . n A 1 44 LYS 44 43 43 LYS LYS A . n A 1 45 GLU 45 44 44 GLU GLU A . n A 1 46 ARG 46 45 45 ARG ARG A . n A 1 47 GLU 47 46 46 GLU GLU A . n A 1 48 TRP 48 47 47 TRP TRP A . n A 1 49 VAL 49 48 48 VAL VAL A . n A 1 50 ALA 50 49 49 ALA ALA A . n A 1 51 GLY 51 50 50 GLY GLY A . n A 1 52 MET 52 51 51 MET MET A . n A 1 53 SER 53 52 52 SER SER A . n A 1 54 SER 54 52 52 SER SER A A n A 1 55 ALA 55 53 53 ALA ALA A . n A 1 56 GLY 56 54 54 GLY GLY A . n A 1 57 ASP 57 55 55 ASP ASP A . n A 1 58 ARG 58 56 56 ARG ARG A . n A 1 59 SER 59 57 57 SER SER A . n A 1 60 SER 60 58 58 SER SER A . n A 1 61 TYR 61 59 59 TYR TYR A . n A 1 62 GLU 62 60 60 GLU GLU A . n A 1 63 ASP 63 61 61 ASP ASP A . n A 1 64 SER 64 62 62 SER SER A . n A 1 65 VAL 65 63 63 VAL VAL A . n A 1 66 LYS 66 64 64 LYS LYS A . n A 1 67 GLY 67 65 65 GLY GLY A . n A 1 68 ARG 68 66 66 ARG ARG A . n A 1 69 PHE 69 67 67 PHE PHE A . n A 1 70 THR 70 68 68 THR THR A . n A 1 71 ILE 71 69 69 ILE ILE A . n A 1 72 SER 72 70 70 SER SER A . n A 1 73 ARG 73 71 71 ARG ARG A . n A 1 74 ASP 74 72 72 ASP ASP A . n A 1 75 ASP 75 73 73 ASP ASP A . n A 1 76 ALA 76 74 74 ALA ALA A . n A 1 77 ARG 77 75 75 ARG ARG A . n A 1 78 ASN 78 76 76 ASN ASN A . n A 1 79 THR 79 77 77 THR THR A . n A 1 80 VAL 80 78 78 VAL VAL A . n A 1 81 TYR 81 79 79 TYR TYR A . n A 1 82 LEU 82 80 80 LEU LEU A . n A 1 83 GLN 83 81 81 GLN GLN A . n A 1 84 MET 84 82 82 MET MET A . n A 1 85 ASN 85 82 82 ASN ASN A A n A 1 86 SER 86 82 82 SER SER A B n A 1 87 LEU 87 82 82 LEU LEU A C n A 1 88 LYS 88 83 83 LYS LYS A . n A 1 89 PRO 89 84 84 PRO PRO A . n A 1 90 GLU 90 85 85 GLU GLU A . n A 1 91 ASP 91 86 86 ASP ASP A . n A 1 92 THR 92 87 87 THR THR A . n A 1 93 ALA 93 88 88 ALA ALA A . n A 1 94 VAL 94 89 89 VAL VAL A . n A 1 95 TYR 95 90 90 TYR TYR A . n A 1 96 TYR 96 91 91 TYR TYR A . n A 1 97 CYS 97 92 92 CYS CYS A . n A 1 98 ASN 98 93 93 ASN ASN A . n A 1 99 VAL 99 94 94 VAL VAL A . n A 1 100 ASN 100 95 95 ASN ASN A . n A 1 101 VAL 101 96 96 VAL VAL A . n A 1 102 GLY 102 97 97 GLY GLY A . n A 1 103 PHE 103 98 98 PHE PHE A . n A 1 104 LEU 104 99 99 LEU LEU A . n A 1 105 PRO 105 100 100 PRO PRO A . n A 1 106 ALA 106 101 101 ALA ALA A . n A 1 107 ASP 107 102 102 ASP ASP A . n A 1 108 LEU 108 103 103 LEU LEU A . n A 1 109 ALA 109 104 104 ALA ALA A . n A 1 110 TRP 110 105 105 TRP TRP A . n A 1 111 PHE 111 106 106 PHE PHE A . n A 1 112 LYS 112 107 107 LYS LYS A . n A 1 113 ARG 113 108 108 ARG ARG A . n A 1 114 ASN 114 109 109 ASN ASN A . n A 1 115 THR 115 110 110 THR THR A . n A 1 116 LEU 116 111 111 LEU LEU A . n A 1 117 ASN 117 112 112 ASN ASN A . n A 1 118 LYS 118 113 113 LYS LYS A . n A 1 119 PRO 119 114 114 PRO PRO A . n A 1 120 VAL 120 115 115 VAL VAL A . n A 1 121 ILE 121 116 116 ILE ILE A . n A 1 122 MET 122 117 117 MET MET A . n A 1 123 GLY 123 118 118 GLY GLY A . n A 1 124 ARG 124 119 119 ARG ARG A . n A 1 125 HIS 125 120 120 HIS HIS A . n A 1 126 THR 126 121 121 THR THR A . n A 1 127 TRP 127 122 122 TRP TRP A . n A 1 128 GLU 128 123 123 GLU GLU A . n A 1 129 SER 129 124 124 SER SER A . n A 1 130 ILE 130 125 125 ILE ILE A . n A 1 131 GLY 131 126 126 GLY GLY A . n A 1 132 ARG 132 127 127 ARG ARG A . n A 1 133 PRO 133 128 128 PRO PRO A . n A 1 134 LEU 134 129 129 LEU LEU A . n A 1 135 PRO 135 130 130 PRO PRO A . n A 1 136 GLY 136 131 131 GLY GLY A . n A 1 137 ARG 137 132 132 ARG ARG A . n A 1 138 LYS 138 133 133 LYS LYS A . n A 1 139 ASN 139 134 134 ASN ASN A . n A 1 140 ILE 140 135 135 ILE ILE A . n A 1 141 ILE 141 136 136 ILE ILE A . n A 1 142 LEU 142 137 137 LEU LEU A . n A 1 143 SER 143 138 138 SER SER A . n A 1 144 SER 144 139 139 SER SER A . n A 1 145 GLN 145 140 140 GLN GLN A . n A 1 146 PRO 146 141 141 PRO PRO A . n A 1 147 GLY 147 142 142 GLY GLY A . n A 1 148 THR 148 143 143 THR THR A . n A 1 149 ASP 149 144 144 ASP ASP A . n A 1 150 ASP 150 145 145 ASP ASP A . n A 1 151 ARG 151 146 146 ARG ARG A . n A 1 152 VAL 152 147 147 VAL VAL A . n A 1 153 THR 153 148 148 THR THR A . n A 1 154 TRP 154 149 149 TRP TRP A . n A 1 155 VAL 155 150 150 VAL VAL A . n A 1 156 LYS 156 151 151 LYS LYS A . n A 1 157 SER 157 152 152 SER SER A . n A 1 158 VAL 158 153 153 VAL VAL A . n A 1 159 ASP 159 154 154 ASP ASP A . n A 1 160 GLU 160 155 155 GLU GLU A . n A 1 161 ALA 161 156 156 ALA ALA A . n A 1 162 ILE 162 157 157 ILE ILE A . n A 1 163 ALA 163 158 158 ALA ALA A . n A 1 164 ALA 164 159 159 ALA ALA A . n A 1 165 CYS 165 160 160 CYS CYS A . n A 1 166 GLY 166 161 161 GLY GLY A . n A 1 167 ASP 167 162 162 ASP ASP A . n A 1 168 VAL 168 163 163 VAL VAL A . n A 1 169 PRO 169 164 164 PRO PRO A . n A 1 170 GLU 170 165 165 GLU GLU A . n A 1 171 ILE 171 166 166 ILE ILE A . n A 1 172 MET 172 167 167 MET MET A . n A 1 173 VAL 173 168 168 VAL VAL A . n A 1 174 ILE 174 169 169 ILE ILE A . n A 1 175 GLY 175 170 170 GLY GLY A . n A 1 176 GLY 176 171 171 GLY GLY A . n A 1 177 GLY 177 172 172 GLY GLY A . n A 1 178 ARG 178 173 173 ARG ARG A . n A 1 179 VAL 179 174 174 VAL VAL A . n A 1 180 TYR 180 175 175 TYR TYR A . n A 1 181 GLU 181 176 176 GLU GLU A . n A 1 182 GLN 182 177 177 GLN GLN A . n A 1 183 PHE 183 178 178 PHE PHE A . n A 1 184 LEU 184 179 179 LEU LEU A . n A 1 185 PRO 185 180 180 PRO PRO A . n A 1 186 LYS 186 181 181 LYS LYS A . n A 1 187 ALA 187 182 182 ALA ALA A . n A 1 188 GLN 188 183 183 GLN GLN A . n A 1 189 LYS 189 184 184 LYS LYS A . n A 1 190 LEU 190 185 185 LEU LEU A . n A 1 191 TYR 191 186 186 TYR TYR A . n A 1 192 LEU 192 187 187 LEU LEU A . n A 1 193 THR 193 188 188 THR THR A . n A 1 194 HIS 194 189 189 HIS HIS A . n A 1 195 ILE 195 190 190 ILE ILE A . n A 1 196 ASP 196 191 191 ASP ASP A . n A 1 197 ALA 197 192 192 ALA ALA A . n A 1 198 GLU 198 193 193 GLU GLU A . n A 1 199 VAL 199 194 194 VAL VAL A . n A 1 200 GLU 200 195 195 GLU GLU A . n A 1 201 GLY 201 196 196 GLY GLY A . n A 1 202 ASP 202 197 197 ASP ASP A . n A 1 203 THR 203 198 198 THR THR A . n A 1 204 HIS 204 199 199 HIS HIS A . n A 1 205 PHE 205 200 200 PHE PHE A . n A 1 206 PRO 206 201 201 PRO PRO A . n A 1 207 ASP 207 202 202 ASP ASP A . n A 1 208 TYR 208 203 203 TYR TYR A . n A 1 209 GLU 209 204 204 GLU GLU A . n A 1 210 PRO 210 205 205 PRO PRO A . n A 1 211 ASP 211 206 206 ASP ASP A . n A 1 212 ASP 212 207 207 ASP ASP A . n A 1 213 TRP 213 208 208 TRP TRP A . n A 1 214 GLU 214 209 209 GLU GLU A . n A 1 215 SER 215 210 210 SER SER A . n A 1 216 VAL 216 211 211 VAL VAL A . n A 1 217 PHE 217 212 212 PHE PHE A . n A 1 218 SER 218 213 213 SER SER A . n A 1 219 GLU 219 214 214 GLU GLU A . n A 1 220 PHE 220 215 215 PHE PHE A . n A 1 221 HIS 221 216 216 HIS HIS A . n A 1 222 ASP 222 217 217 ASP ASP A . n A 1 223 ALA 223 218 218 ALA ALA A . n A 1 224 ASP 224 219 219 ASP ASP A . n A 1 225 ALA 225 220 220 ALA ALA A . n A 1 226 GLN 226 221 221 GLN GLN A . n A 1 227 ASN 227 222 222 ASN ASN A . n A 1 228 SER 228 223 223 SER SER A . n A 1 229 HIS 229 224 224 HIS HIS A . n A 1 230 SER 230 225 225 SER SER A . n A 1 231 TYR 231 226 226 TYR TYR A . n A 1 232 CYS 232 227 227 CYS CYS A . n A 1 233 PHE 233 228 228 PHE PHE A . n A 1 234 GLU 234 229 229 GLU GLU A . n A 1 235 ILE 235 230 230 ILE ILE A . n A 1 236 LEU 236 231 231 LEU LEU A . n A 1 237 GLU 237 232 232 GLU GLU A . n A 1 238 ARG 238 233 233 ARG ARG A . n A 1 239 ARG 239 234 234 ARG ARG A . n A 1 240 GLY 240 235 235 GLY GLY A . n A 1 241 GLY 241 236 236 GLY GLY A . n A 1 242 GLY 242 237 ? ? ? A . n A 1 243 GLY 243 238 ? ? ? A . n A 1 244 GLY 244 239 239 GLY GLY A . n A 1 245 MET 245 240 240 MET MET A . n A 1 246 ILE 246 241 241 ILE ILE A . n A 1 247 SER 247 242 242 SER SER A . n A 1 248 LEU 248 243 243 LEU LEU A . n A 1 249 ILE 249 244 244 ILE ILE A . n A 1 250 ALA 250 245 245 ALA ALA A . n A 1 251 ALA 251 246 246 ALA ALA A . n A 1 252 LEU 252 247 247 LEU LEU A . n A 1 253 ALA 253 248 248 ALA ALA A . n A 1 254 VAL 254 249 249 VAL VAL A . n A 1 255 ASP 255 250 250 ASP ASP A . n A 1 256 ARG 256 251 251 ARG ARG A . n A 1 257 VAL 257 252 252 VAL VAL A . n A 1 258 ILE 258 253 253 ILE ILE A . n A 1 259 GLY 259 254 254 GLY GLY A . n A 1 260 MET 260 255 255 MET MET A . n A 1 261 GLU 261 256 256 GLU GLU A . n A 1 262 ASN 262 257 257 ASN ASN A . n A 1 263 ALA 263 258 258 ALA ALA A . n A 1 264 MET 264 259 259 MET MET A . n A 1 265 PRO 265 260 260 PRO PRO A . n A 1 266 TRP 266 261 261 TRP TRP A . n A 1 267 ASN 267 262 262 ASN ASN A . n A 1 268 GLU 268 263 263 GLU GLU A . n A 1 269 TYR 269 264 264 TYR TYR A . n A 1 270 TRP 270 265 265 TRP TRP A . n A 1 271 GLY 271 266 266 GLY GLY A . n A 1 272 GLN 272 267 267 GLN GLN A . n A 1 273 GLY 273 268 268 GLY GLY A . n A 1 274 THR 274 269 269 THR THR A . n A 1 275 GLN 275 270 270 GLN GLN A . n A 1 276 VAL 276 271 271 VAL VAL A . n A 1 277 THR 277 272 272 THR THR A . n A 1 278 VAL 278 273 273 VAL VAL A . n A 1 279 SER 279 274 274 SER SER A . n # loop_ _pdbx_entity_instance_feature.ordinal _pdbx_entity_instance_feature.comp_id _pdbx_entity_instance_feature.asym_id _pdbx_entity_instance_feature.seq_num _pdbx_entity_instance_feature.auth_comp_id _pdbx_entity_instance_feature.auth_asym_id _pdbx_entity_instance_feature.auth_seq_num _pdbx_entity_instance_feature.feature_type _pdbx_entity_instance_feature.details 1 NDP ? ? NDP ? ? 'SUBJECT OF INVESTIGATION' ? 2 TOP ? ? TOP ? ? 'SUBJECT OF INVESTIGATION' ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 TOP 1 301 1 TOP TOP A . C 3 NDP 1 302 2 NDP NDP A . D 4 PGE 1 303 11 PGE PGE A . E 5 HOH 1 401 31 HOH HOH A . E 5 HOH 2 402 47 HOH HOH A . E 5 HOH 3 403 46 HOH HOH A . E 5 HOH 4 404 26 HOH HOH A . E 5 HOH 5 405 38 HOH HOH A . E 5 HOH 6 406 18 HOH HOH A . E 5 HOH 7 407 35 HOH HOH A . E 5 HOH 8 408 72 HOH HOH A . E 5 HOH 9 409 37 HOH HOH A . E 5 HOH 10 410 9 HOH HOH A . E 5 HOH 11 411 2 HOH HOH A . E 5 HOH 12 412 3 HOH HOH A . E 5 HOH 13 413 73 HOH HOH A . E 5 HOH 14 414 15 HOH HOH A . E 5 HOH 15 415 8 HOH HOH A . E 5 HOH 16 416 7 HOH HOH A . E 5 HOH 17 417 56 HOH HOH A . E 5 HOH 18 418 28 HOH HOH A . E 5 HOH 19 419 25 HOH HOH A . E 5 HOH 20 420 59 HOH HOH A . E 5 HOH 21 421 75 HOH HOH A . E 5 HOH 22 422 41 HOH HOH A . E 5 HOH 23 423 14 HOH HOH A . E 5 HOH 24 424 4 HOH HOH A . E 5 HOH 25 425 27 HOH HOH A . E 5 HOH 26 426 44 HOH HOH A . E 5 HOH 27 427 5 HOH HOH A . E 5 HOH 28 428 19 HOH HOH A . E 5 HOH 29 429 45 HOH HOH A . E 5 HOH 30 430 12 HOH HOH A . E 5 HOH 31 431 6 HOH HOH A . E 5 HOH 32 432 61 HOH HOH A . E 5 HOH 33 433 24 HOH HOH A . E 5 HOH 34 434 10 HOH HOH A . E 5 HOH 35 435 36 HOH HOH A . E 5 HOH 36 436 57 HOH HOH A . E 5 HOH 37 437 71 HOH HOH A . E 5 HOH 38 438 22 HOH HOH A . E 5 HOH 39 439 62 HOH HOH A . E 5 HOH 40 440 54 HOH HOH A . E 5 HOH 41 441 1 HOH HOH A . E 5 HOH 42 442 67 HOH HOH A . E 5 HOH 43 443 16 HOH HOH A . E 5 HOH 44 444 55 HOH HOH A . E 5 HOH 45 445 23 HOH HOH A . E 5 HOH 46 446 50 HOH HOH A . E 5 HOH 47 447 53 HOH HOH A . E 5 HOH 48 448 11 HOH HOH A . E 5 HOH 49 449 58 HOH HOH A . E 5 HOH 50 450 51 HOH HOH A . E 5 HOH 51 451 33 HOH HOH A . E 5 HOH 52 452 42 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.14rc1_3177: ???)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 6RUL _cell.details ? _cell.formula_units_Z ? _cell.length_a 86.610 _cell.length_a_esd ? _cell.length_b 86.610 _cell.length_b_esd ? _cell.length_c 73.040 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6RUL _symmetry.cell_setting ? _symmetry.Int_Tables_number 171 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 62' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6RUL _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.55 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 51.81 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M MES pH 6.0, 30% (v/v) PEG 600, 5% (w/v) PEG 1000, 10% (v/v) glycerol' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-02-10 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'Si(111)' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97797 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SLS BEAMLINE X10SA' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97797 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline X10SA _diffrn_source.pdbx_synchrotron_site SLS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6RUL _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.2 _reflns.d_resolution_low 50.0 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 15911 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 10.1 _reflns.pdbx_Rmerge_I_obs 0.058 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 22.62 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.2 _reflns_shell.d_res_low 2.3 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 5.32 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1970 _reflns_shell.percent_possible_all 99.9 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.453 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 10.4 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6RUL _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.200 _refine.ls_d_res_low 43.305 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 15910 _refine.ls_number_reflns_R_free 796 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.95 _refine.ls_percent_reflns_R_free 5.00 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1770 _refine.ls_R_factor_R_free 0.2195 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1747 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.39 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model '5UII, 5H8D' _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 24.27 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.26 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2167 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 79 _refine_hist.number_atoms_solvent 52 _refine_hist.number_atoms_total 2298 _refine_hist.d_res_high 2.200 _refine_hist.d_res_low 43.305 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.008 ? 2304 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.068 ? 3133 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 6.166 ? 1331 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.058 ? 323 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.006 ? 405 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.2001 2.3379 . . 131 2497 100.00 . . . 0.3001 . 0.2246 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.3379 2.5184 . . 133 2518 100.00 . . . 0.2748 . 0.2072 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.5184 2.7718 . . 131 2498 100.00 . . . 0.2387 . 0.2024 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.7718 3.1728 . . 133 2514 100.00 . . . 0.2640 . 0.2078 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.1728 3.9970 . . 133 2525 100.00 . . . 0.2466 . 0.1676 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.9970 43.3134 . . 135 2562 100.00 . . . 0.1646 . 0.1501 . . . . . . . . . . # _struct.entry_id 6RUL _struct.title 'Crystal structure of GFP-LAMA-F98 - a GFP enhancer nanobody with cpDHFR insertion and TMP and NADPH' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6RUL _struct_keywords.text 'LAMA, nanobody, circular permutant of DHFR, TMP, NADPH, PROTEIN BINDING' _struct_keywords.pdbx_keywords 'PROTEIN BINDING' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 PDB 6RUL 6RUL ? 1 ? 1 2 UNP DYR_ECOLI P0ABQ4 ? 1 ;LPADLAWFKRNTLNKPVIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPEIMVIGGGRVYEQF LPKAQKLYLTHIDAEVEGDTHFPDYEPDDWESVFSEFHDADAQNSHSYCFEILERR ; 24 3 UNP DYR_ECOLI P0ABQ4 ? 1 MISLIAALAVDRVIGMENAMPWN 1 4 PDB 6RUL 6RUL ? 1 ? 268 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 6RUL A 1 ? 103 ? 6RUL 0 ? 98 ? 0 98 2 2 6RUL A 104 ? 239 ? P0ABQ4 24 ? 159 ? 99 234 3 3 6RUL A 245 ? 267 ? P0ABQ4 1 ? 23 ? 240 262 4 4 6RUL A 268 ? 279 ? 6RUL 263 ? 274 ? 263 274 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 2 6RUL GLY A 240 ? UNP P0ABQ4 ? ? linker 235 1 2 6RUL GLY A 241 ? UNP P0ABQ4 ? ? linker 236 2 2 6RUL GLY A 242 ? UNP P0ABQ4 ? ? linker 237 3 2 6RUL GLY A 243 ? UNP P0ABQ4 ? ? linker 238 4 2 6RUL GLY A 244 ? UNP P0ABQ4 ? ? linker 239 5 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2530 ? 1 MORE 1 ? 1 'SSA (A^2)' 12940 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 PRO A 29 ? TYR A 33 ? PRO A 28 TYR A 32 5 ? 5 HELX_P HELX_P2 AA2 ASP A 63 ? LYS A 66 ? ASP A 61 LYS A 64 5 ? 4 HELX_P HELX_P3 AA3 LYS A 88 ? THR A 92 ? LYS A 83 THR A 87 5 ? 5 HELX_P HELX_P4 AA4 LEU A 104 ? LEU A 116 ? LEU A 99 LEU A 111 1 ? 13 HELX_P HELX_P5 AA5 ARG A 124 ? GLY A 131 ? ARG A 119 GLY A 126 1 ? 8 HELX_P HELX_P6 AA6 SER A 157 ? GLY A 166 ? SER A 152 GLY A 161 1 ? 10 HELX_P HELX_P7 AA7 GLY A 176 ? LEU A 184 ? GLY A 171 LEU A 179 1 ? 9 HELX_P HELX_P8 AA8 PRO A 185 ? ALA A 187 ? PRO A 180 ALA A 182 5 ? 3 HELX_P HELX_P9 AA9 GLU A 209 ? ASP A 211 ? GLU A 204 ASP A 206 5 ? 3 HELX_P HELX_P10 AB1 ALA A 253 ? ASP A 255 ? ALA A 248 ASP A 250 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 23 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 97 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 22 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 92 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.051 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id CYS _pdbx_modification_feature.label_asym_id A _pdbx_modification_feature.label_seq_id 23 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id CYS _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 97 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id CYS _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 22 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id CYS _pdbx_modification_feature.modified_residue_auth_asym_id A _pdbx_modification_feature.modified_residue_auth_seq_id 92 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom SG _pdbx_modification_feature.modified_residue_id_linking_atom SG _pdbx_modification_feature.modified_residue_id . _pdbx_modification_feature.ref_pcm_id . _pdbx_modification_feature.ref_comp_id . _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Disulfide bridge' # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id GLY _struct_mon_prot_cis.label_seq_id 175 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id GLY _struct_mon_prot_cis.auth_seq_id 170 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 GLY _struct_mon_prot_cis.pdbx_label_seq_id_2 176 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 GLY _struct_mon_prot_cis.pdbx_auth_seq_id_2 171 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 0.30 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 6 ? AA3 ? 4 ? AA4 ? 8 ? AA5 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA2 1 2 ? parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA2 5 6 ? anti-parallel AA3 1 2 ? parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel AA4 1 2 ? parallel AA4 2 3 ? parallel AA4 3 4 ? parallel AA4 4 5 ? parallel AA4 5 6 ? parallel AA4 6 7 ? anti-parallel AA4 7 8 ? anti-parallel AA5 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLN A 4 ? SER A 8 ? GLN A 3 SER A 7 AA1 2 LEU A 19 ? SER A 26 ? LEU A 18 SER A 25 AA1 3 THR A 79 ? MET A 84 ? THR A 77 MET A 82 AA1 4 PHE A 69 ? ASP A 74 ? PHE A 67 ASP A 72 AA2 1 LEU A 12 ? VAL A 13 ? LEU A 11 VAL A 12 AA2 2 THR A 274 ? VAL A 278 ? THR A 269 VAL A 273 AA2 3 ALA A 93 ? ASN A 100 ? ALA A 88 ASN A 95 AA2 4 SER A 34 ? GLN A 40 ? SER A 33 GLN A 39 AA2 5 GLU A 47 ? MET A 52 ? GLU A 46 MET A 51 AA2 6 SER A 59 ? TYR A 61 ? SER A 57 TYR A 59 AA3 1 LEU A 12 ? VAL A 13 ? LEU A 11 VAL A 12 AA3 2 THR A 274 ? VAL A 278 ? THR A 269 VAL A 273 AA3 3 ALA A 93 ? ASN A 100 ? ALA A 88 ASN A 95 AA3 4 GLU A 268 ? TRP A 270 ? GLU A 263 TRP A 265 AA4 1 THR A 153 ? VAL A 155 ? THR A 148 VAL A 150 AA4 2 ASN A 139 ? LEU A 142 ? ASN A 134 LEU A 137 AA4 3 VAL A 120 ? GLY A 123 ? VAL A 115 GLY A 118 AA4 4 ILE A 171 ? VAL A 173 ? ILE A 166 VAL A 168 AA4 5 ILE A 246 ? LEU A 252 ? ILE A 241 LEU A 247 AA4 6 LYS A 189 ? ILE A 195 ? LYS A 184 ILE A 190 AA4 7 TYR A 231 ? ARG A 238 ? TYR A 226 ARG A 233 AA4 8 TRP A 213 ? HIS A 221 ? TRP A 208 HIS A 216 AA5 1 THR A 203 ? HIS A 204 ? THR A 198 HIS A 199 AA5 2 VAL A 257 ? GLY A 259 ? VAL A 252 GLY A 254 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N SER A 8 ? N SER A 7 O SER A 22 ? O SER A 21 AA1 2 3 N LEU A 19 ? N LEU A 18 O MET A 84 ? O MET A 82 AA1 3 4 O TYR A 81 ? O TYR A 79 N SER A 72 ? N SER A 70 AA2 1 2 N VAL A 13 ? N VAL A 12 O THR A 277 ? O THR A 272 AA2 2 3 O THR A 274 ? O THR A 269 N TYR A 95 ? N TYR A 90 AA2 3 4 O ASN A 98 ? O ASN A 93 N ARG A 36 ? N ARG A 35 AA2 4 5 N TRP A 37 ? N TRP A 36 O ALA A 50 ? O ALA A 49 AA2 5 6 N GLY A 51 ? N GLY A 50 O SER A 60 ? O SER A 58 AA3 1 2 N VAL A 13 ? N VAL A 12 O THR A 277 ? O THR A 272 AA3 2 3 O THR A 274 ? O THR A 269 N TYR A 95 ? N TYR A 90 AA3 3 4 N VAL A 99 ? N VAL A 94 O TYR A 269 ? O TYR A 264 AA4 1 2 O VAL A 155 ? O VAL A 150 N ILE A 141 ? N ILE A 136 AA4 2 3 O ILE A 140 ? O ILE A 135 N VAL A 120 ? N VAL A 115 AA4 3 4 N ILE A 121 ? N ILE A 116 O MET A 172 ? O MET A 167 AA4 4 5 N ILE A 171 ? N ILE A 166 O SER A 247 ? O SER A 242 AA4 5 6 O LEU A 252 ? O LEU A 247 N THR A 193 ? N THR A 188 AA4 6 7 N HIS A 194 ? N HIS A 189 O CYS A 232 ? O CYS A 227 AA4 7 8 O GLU A 237 ? O GLU A 232 N GLU A 214 ? N GLU A 209 AA5 1 2 N THR A 203 ? N THR A 198 O ILE A 258 ? O ILE A 253 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A TOP 301 ? 12 'binding site for residue TOP A 301' AC2 Software A NDP 302 ? 28 'binding site for residue NDP A 302' AC3 Software A PGE 303 ? 5 'binding site for residue PGE A 303' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 12 ASP A 107 ? ASP A 102 . ? 1_555 ? 2 AC1 12 PHE A 111 ? PHE A 106 . ? 1_555 ? 3 AC1 12 ILE A 174 ? ILE A 169 . ? 1_555 ? 4 AC1 12 TYR A 180 ? TYR A 175 . ? 1_555 ? 5 AC1 12 THR A 193 ? THR A 188 . ? 1_555 ? 6 AC1 12 ILE A 249 ? ILE A 244 . ? 1_555 ? 7 AC1 12 ALA A 250 ? ALA A 245 . ? 1_555 ? 8 AC1 12 ALA A 251 ? ALA A 246 . ? 1_555 ? 9 AC1 12 MET A 264 ? MET A 259 . ? 1_555 ? 10 AC1 12 NDP C . ? NDP A 302 . ? 1_555 ? 11 AC1 12 HOH E . ? HOH A 411 . ? 1_555 ? 12 AC1 12 HOH E . ? HOH A 424 . ? 1_555 ? 13 AC2 28 GLY A 123 ? GLY A 118 . ? 1_555 ? 14 AC2 28 ARG A 124 ? ARG A 119 . ? 1_555 ? 15 AC2 28 HIS A 125 ? HIS A 120 . ? 1_555 ? 16 AC2 28 THR A 126 ? THR A 121 . ? 1_555 ? 17 AC2 28 SER A 129 ? SER A 124 . ? 1_555 ? 18 AC2 28 LEU A 142 ? LEU A 137 . ? 1_555 ? 19 AC2 28 SER A 143 ? SER A 138 . ? 1_555 ? 20 AC2 28 SER A 144 ? SER A 139 . ? 1_555 ? 21 AC2 28 GLN A 145 ? GLN A 140 . ? 1_555 ? 22 AC2 28 LYS A 156 ? LYS A 151 . ? 1_555 ? 23 AC2 28 ILE A 174 ? ILE A 169 . ? 1_555 ? 24 AC2 28 GLY A 176 ? GLY A 171 . ? 1_555 ? 25 AC2 28 GLY A 177 ? GLY A 172 . ? 1_555 ? 26 AC2 28 ARG A 178 ? ARG A 173 . ? 1_555 ? 27 AC2 28 VAL A 179 ? VAL A 174 . ? 1_555 ? 28 AC2 28 TYR A 180 ? TYR A 175 . ? 1_555 ? 29 AC2 28 GLN A 182 ? GLN A 177 . ? 1_555 ? 30 AC2 28 THR A 203 ? THR A 198 . ? 1_555 ? 31 AC2 28 ALA A 250 ? ALA A 245 . ? 1_555 ? 32 AC2 28 ALA A 251 ? ALA A 246 . ? 1_555 ? 33 AC2 28 ILE A 258 ? ILE A 253 . ? 1_555 ? 34 AC2 28 GLY A 259 ? GLY A 254 . ? 1_555 ? 35 AC2 28 ASN A 262 ? ASN A 257 . ? 1_555 ? 36 AC2 28 ALA A 263 ? ALA A 258 . ? 1_555 ? 37 AC2 28 TRP A 266 ? TRP A 261 . ? 1_555 ? 38 AC2 28 TOP B . ? TOP A 301 . ? 1_555 ? 39 AC2 28 HOH E . ? HOH A 412 . ? 1_555 ? 40 AC2 28 HOH E . ? HOH A 428 . ? 1_555 ? 41 AC3 5 ARG A 46 ? ARG A 45 . ? 1_555 ? 42 AC3 5 TYR A 96 ? TYR A 91 . ? 1_555 ? 43 AC3 5 GLU A 128 ? GLU A 123 . ? 1_555 ? 44 AC3 5 GLU A 261 ? GLU A 256 . ? 1_555 ? 45 AC3 5 TRP A 270 ? TRP A 265 . ? 1_555 ? # _pdbx_entry_details.entry_id 6RUL _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 144 ? ? -160.68 112.10 2 1 GLU A 214 ? ? -163.12 113.96 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 0 ? A GLY 1 2 1 Y 1 A GLY 237 ? A GLY 242 3 1 Y 1 A GLY 238 ? A GLY 243 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 NDP PA P N S 250 NDP O1A O N N 251 NDP O2A O N N 252 NDP O5B O N N 253 NDP C5B C N N 254 NDP C4B C N R 255 NDP O4B O N N 256 NDP C3B C N R 257 NDP O3B O N N 258 NDP C2B C N R 259 NDP O2B O N N 260 NDP C1B C N R 261 NDP N9A N Y N 262 NDP C8A C Y N 263 NDP N7A N Y N 264 NDP C5A C Y N 265 NDP C6A C Y N 266 NDP N6A N N N 267 NDP N1A N Y N 268 NDP C2A C Y N 269 NDP N3A N Y N 270 NDP C4A C Y N 271 NDP O3 O N N 272 NDP PN P N S 273 NDP O1N O N N 274 NDP O2N O N N 275 NDP O5D O N N 276 NDP C5D C N N 277 NDP C4D C N R 278 NDP O4D O N N 279 NDP C3D C N S 280 NDP O3D O N N 281 NDP C2D C N R 282 NDP O2D O N N 283 NDP C1D C N R 284 NDP N1N N N N 285 NDP C2N C N N 286 NDP C3N C N N 287 NDP C7N C N N 288 NDP O7N O N N 289 NDP N7N N N N 290 NDP C4N C N N 291 NDP C5N C N N 292 NDP C6N C N N 293 NDP P2B P N N 294 NDP O1X O N N 295 NDP O2X O N N 296 NDP O3X O N N 297 NDP HOA2 H N N 298 NDP H51A H N N 299 NDP H52A H N N 300 NDP H4B H N N 301 NDP H3B H N N 302 NDP HO3A H N N 303 NDP H2B H N N 304 NDP H1B H N N 305 NDP H8A H N N 306 NDP H61A H N N 307 NDP H62A H N N 308 NDP H2A H N N 309 NDP H21N H N N 310 NDP H51N H N N 311 NDP H52N H N N 312 NDP H4D H N N 313 NDP H3D H N N 314 NDP HO3N H N N 315 NDP H2D H N N 316 NDP HO2N H N N 317 NDP H1D H N N 318 NDP H2N H N N 319 NDP H71N H N N 320 NDP H72N H N N 321 NDP H41N H N N 322 NDP H42N H N N 323 NDP H5N H N N 324 NDP H6N H N N 325 NDP HOP2 H N N 326 NDP HOP3 H N N 327 PGE C1 C N N 328 PGE O1 O N N 329 PGE C2 C N N 330 PGE O2 O N N 331 PGE C3 C N N 332 PGE C4 C N N 333 PGE O4 O N N 334 PGE C6 C N N 335 PGE C5 C N N 336 PGE O3 O N N 337 PGE H1 H N N 338 PGE H12 H N N 339 PGE HO1 H N N 340 PGE H2 H N N 341 PGE H22 H N N 342 PGE H3 H N N 343 PGE H32 H N N 344 PGE H4 H N N 345 PGE H42 H N N 346 PGE HO4 H N N 347 PGE H6 H N N 348 PGE H62 H N N 349 PGE H5 H N N 350 PGE H52 H N N 351 PHE N N N N 352 PHE CA C N S 353 PHE C C N N 354 PHE O O N N 355 PHE CB C N N 356 PHE CG C Y N 357 PHE CD1 C Y N 358 PHE CD2 C Y N 359 PHE CE1 C Y N 360 PHE CE2 C Y N 361 PHE CZ C Y N 362 PHE OXT O N N 363 PHE H H N N 364 PHE H2 H N N 365 PHE HA H N N 366 PHE HB2 H N N 367 PHE HB3 H N N 368 PHE HD1 H N N 369 PHE HD2 H N N 370 PHE HE1 H N N 371 PHE HE2 H N N 372 PHE HZ H N N 373 PHE HXT H N N 374 PRO N N N N 375 PRO CA C N S 376 PRO C C N N 377 PRO O O N N 378 PRO CB C N N 379 PRO CG C N N 380 PRO CD C N N 381 PRO OXT O N N 382 PRO H H N N 383 PRO HA H N N 384 PRO HB2 H N N 385 PRO HB3 H N N 386 PRO HG2 H N N 387 PRO HG3 H N N 388 PRO HD2 H N N 389 PRO HD3 H N N 390 PRO HXT H N N 391 SER N N N N 392 SER CA C N S 393 SER C C N N 394 SER O O N N 395 SER CB C N N 396 SER OG O N N 397 SER OXT O N N 398 SER H H N N 399 SER H2 H N N 400 SER HA H N N 401 SER HB2 H N N 402 SER HB3 H N N 403 SER HG H N N 404 SER HXT H N N 405 THR N N N N 406 THR CA C N S 407 THR C C N N 408 THR O O N N 409 THR CB C N R 410 THR OG1 O N N 411 THR CG2 C N N 412 THR OXT O N N 413 THR H H N N 414 THR H2 H N N 415 THR HA H N N 416 THR HB H N N 417 THR HG1 H N N 418 THR HG21 H N N 419 THR HG22 H N N 420 THR HG23 H N N 421 THR HXT H N N 422 TOP C1 C Y N 423 TOP N2 N Y N 424 TOP C3 C Y N 425 TOP N4 N N N 426 TOP N5 N Y N 427 TOP C6 C Y N 428 TOP N7 N N N 429 TOP C8 C Y N 430 TOP C9 C N N 431 TOP C10 C Y N 432 TOP C11 C Y N 433 TOP C12 C Y N 434 TOP O13 O N N 435 TOP C14 C N N 436 TOP C15 C Y N 437 TOP O16 O N N 438 TOP C17 C N N 439 TOP C18 C Y N 440 TOP O19 O N N 441 TOP C20 C N N 442 TOP C21 C Y N 443 TOP H1 H N N 444 TOP HN41 H N N 445 TOP HN42 H N N 446 TOP HN71 H N N 447 TOP HN72 H N N 448 TOP H91 H N N 449 TOP H92 H N N 450 TOP H11 H N N 451 TOP H141 H N N 452 TOP H142 H N N 453 TOP H143 H N N 454 TOP H171 H N N 455 TOP H172 H N N 456 TOP H173 H N N 457 TOP H201 H N N 458 TOP H202 H N N 459 TOP H203 H N N 460 TOP H21 H N N 461 TRP N N N N 462 TRP CA C N S 463 TRP C C N N 464 TRP O O N N 465 TRP CB C N N 466 TRP CG C Y N 467 TRP CD1 C Y N 468 TRP CD2 C Y N 469 TRP NE1 N Y N 470 TRP CE2 C Y N 471 TRP CE3 C Y N 472 TRP CZ2 C Y N 473 TRP CZ3 C Y N 474 TRP CH2 C Y N 475 TRP OXT O N N 476 TRP H H N N 477 TRP H2 H N N 478 TRP HA H N N 479 TRP HB2 H N N 480 TRP HB3 H N N 481 TRP HD1 H N N 482 TRP HE1 H N N 483 TRP HE3 H N N 484 TRP HZ2 H N N 485 TRP HZ3 H N N 486 TRP HH2 H N N 487 TRP HXT H N N 488 TYR N N N N 489 TYR CA C N S 490 TYR C C N N 491 TYR O O N N 492 TYR CB C N N 493 TYR CG C Y N 494 TYR CD1 C Y N 495 TYR CD2 C Y N 496 TYR CE1 C Y N 497 TYR CE2 C Y N 498 TYR CZ C Y N 499 TYR OH O N N 500 TYR OXT O N N 501 TYR H H N N 502 TYR H2 H N N 503 TYR HA H N N 504 TYR HB2 H N N 505 TYR HB3 H N N 506 TYR HD1 H N N 507 TYR HD2 H N N 508 TYR HE1 H N N 509 TYR HE2 H N N 510 TYR HH H N N 511 TYR HXT H N N 512 VAL N N N N 513 VAL CA C N S 514 VAL C C N N 515 VAL O O N N 516 VAL CB C N N 517 VAL CG1 C N N 518 VAL CG2 C N N 519 VAL OXT O N N 520 VAL H H N N 521 VAL H2 H N N 522 VAL HA H N N 523 VAL HB H N N 524 VAL HG11 H N N 525 VAL HG12 H N N 526 VAL HG13 H N N 527 VAL HG21 H N N 528 VAL HG22 H N N 529 VAL HG23 H N N 530 VAL HXT H N N 531 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 NDP PA O1A doub N N 237 NDP PA O2A sing N N 238 NDP PA O5B sing N N 239 NDP PA O3 sing N N 240 NDP O2A HOA2 sing N N 241 NDP O5B C5B sing N N 242 NDP C5B C4B sing N N 243 NDP C5B H51A sing N N 244 NDP C5B H52A sing N N 245 NDP C4B O4B sing N N 246 NDP C4B C3B sing N N 247 NDP C4B H4B sing N N 248 NDP O4B C1B sing N N 249 NDP C3B O3B sing N N 250 NDP C3B C2B sing N N 251 NDP C3B H3B sing N N 252 NDP O3B HO3A sing N N 253 NDP C2B O2B sing N N 254 NDP C2B C1B sing N N 255 NDP C2B H2B sing N N 256 NDP O2B P2B sing N N 257 NDP C1B N9A sing N N 258 NDP C1B H1B sing N N 259 NDP N9A C8A sing Y N 260 NDP N9A C4A sing Y N 261 NDP C8A N7A doub Y N 262 NDP C8A H8A sing N N 263 NDP N7A C5A sing Y N 264 NDP C5A C6A sing Y N 265 NDP C5A C4A doub Y N 266 NDP C6A N6A sing N N 267 NDP C6A N1A doub Y N 268 NDP N6A H61A sing N N 269 NDP N6A H62A sing N N 270 NDP N1A C2A sing Y N 271 NDP C2A N3A doub Y N 272 NDP C2A H2A sing N N 273 NDP N3A C4A sing Y N 274 NDP O3 PN sing N N 275 NDP PN O1N doub N N 276 NDP PN O2N sing N N 277 NDP PN O5D sing N N 278 NDP O2N H21N sing N N 279 NDP O5D C5D sing N N 280 NDP C5D C4D sing N N 281 NDP C5D H51N sing N N 282 NDP C5D H52N sing N N 283 NDP C4D O4D sing N N 284 NDP C4D C3D sing N N 285 NDP C4D H4D sing N N 286 NDP O4D C1D sing N N 287 NDP C3D O3D sing N N 288 NDP C3D C2D sing N N 289 NDP C3D H3D sing N N 290 NDP O3D HO3N sing N N 291 NDP C2D O2D sing N N 292 NDP C2D C1D sing N N 293 NDP C2D H2D sing N N 294 NDP O2D HO2N sing N N 295 NDP C1D N1N sing N N 296 NDP C1D H1D sing N N 297 NDP N1N C2N sing N N 298 NDP N1N C6N sing N N 299 NDP C2N C3N doub N N 300 NDP C2N H2N sing N N 301 NDP C3N C7N sing N N 302 NDP C3N C4N sing N N 303 NDP C7N O7N doub N N 304 NDP C7N N7N sing N N 305 NDP N7N H71N sing N N 306 NDP N7N H72N sing N N 307 NDP C4N C5N sing N N 308 NDP C4N H41N sing N N 309 NDP C4N H42N sing N N 310 NDP C5N C6N doub N N 311 NDP C5N H5N sing N N 312 NDP C6N H6N sing N N 313 NDP P2B O1X doub N N 314 NDP P2B O2X sing N N 315 NDP P2B O3X sing N N 316 NDP O2X HOP2 sing N N 317 NDP O3X HOP3 sing N N 318 PGE C1 O1 sing N N 319 PGE C1 C2 sing N N 320 PGE C1 H1 sing N N 321 PGE C1 H12 sing N N 322 PGE O1 HO1 sing N N 323 PGE C2 O2 sing N N 324 PGE C2 H2 sing N N 325 PGE C2 H22 sing N N 326 PGE O2 C3 sing N N 327 PGE C3 C4 sing N N 328 PGE C3 H3 sing N N 329 PGE C3 H32 sing N N 330 PGE C4 O3 sing N N 331 PGE C4 H4 sing N N 332 PGE C4 H42 sing N N 333 PGE O4 C6 sing N N 334 PGE O4 HO4 sing N N 335 PGE C6 C5 sing N N 336 PGE C6 H6 sing N N 337 PGE C6 H62 sing N N 338 PGE C5 O3 sing N N 339 PGE C5 H5 sing N N 340 PGE C5 H52 sing N N 341 PHE N CA sing N N 342 PHE N H sing N N 343 PHE N H2 sing N N 344 PHE CA C sing N N 345 PHE CA CB sing N N 346 PHE CA HA sing N N 347 PHE C O doub N N 348 PHE C OXT sing N N 349 PHE CB CG sing N N 350 PHE CB HB2 sing N N 351 PHE CB HB3 sing N N 352 PHE CG CD1 doub Y N 353 PHE CG CD2 sing Y N 354 PHE CD1 CE1 sing Y N 355 PHE CD1 HD1 sing N N 356 PHE CD2 CE2 doub Y N 357 PHE CD2 HD2 sing N N 358 PHE CE1 CZ doub Y N 359 PHE CE1 HE1 sing N N 360 PHE CE2 CZ sing Y N 361 PHE CE2 HE2 sing N N 362 PHE CZ HZ sing N N 363 PHE OXT HXT sing N N 364 PRO N CA sing N N 365 PRO N CD sing N N 366 PRO N H sing N N 367 PRO CA C sing N N 368 PRO CA CB sing N N 369 PRO CA HA sing N N 370 PRO C O doub N N 371 PRO C OXT sing N N 372 PRO CB CG sing N N 373 PRO CB HB2 sing N N 374 PRO CB HB3 sing N N 375 PRO CG CD sing N N 376 PRO CG HG2 sing N N 377 PRO CG HG3 sing N N 378 PRO CD HD2 sing N N 379 PRO CD HD3 sing N N 380 PRO OXT HXT sing N N 381 SER N CA sing N N 382 SER N H sing N N 383 SER N H2 sing N N 384 SER CA C sing N N 385 SER CA CB sing N N 386 SER CA HA sing N N 387 SER C O doub N N 388 SER C OXT sing N N 389 SER CB OG sing N N 390 SER CB HB2 sing N N 391 SER CB HB3 sing N N 392 SER OG HG sing N N 393 SER OXT HXT sing N N 394 THR N CA sing N N 395 THR N H sing N N 396 THR N H2 sing N N 397 THR CA C sing N N 398 THR CA CB sing N N 399 THR CA HA sing N N 400 THR C O doub N N 401 THR C OXT sing N N 402 THR CB OG1 sing N N 403 THR CB CG2 sing N N 404 THR CB HB sing N N 405 THR OG1 HG1 sing N N 406 THR CG2 HG21 sing N N 407 THR CG2 HG22 sing N N 408 THR CG2 HG23 sing N N 409 THR OXT HXT sing N N 410 TOP C1 N2 doub Y N 411 TOP C1 C8 sing Y N 412 TOP C1 H1 sing N N 413 TOP N2 C3 sing Y N 414 TOP C3 N4 sing N N 415 TOP C3 N5 doub Y N 416 TOP N4 HN41 sing N N 417 TOP N4 HN42 sing N N 418 TOP N5 C6 sing Y N 419 TOP C6 N7 sing N N 420 TOP C6 C8 doub Y N 421 TOP N7 HN71 sing N N 422 TOP N7 HN72 sing N N 423 TOP C8 C9 sing N N 424 TOP C9 C10 sing N N 425 TOP C9 H91 sing N N 426 TOP C9 H92 sing N N 427 TOP C10 C11 doub Y N 428 TOP C10 C21 sing Y N 429 TOP C11 C12 sing Y N 430 TOP C11 H11 sing N N 431 TOP C12 O13 sing N N 432 TOP C12 C15 doub Y N 433 TOP O13 C14 sing N N 434 TOP C14 H141 sing N N 435 TOP C14 H142 sing N N 436 TOP C14 H143 sing N N 437 TOP C15 O16 sing N N 438 TOP C15 C18 sing Y N 439 TOP O16 C17 sing N N 440 TOP C17 H171 sing N N 441 TOP C17 H172 sing N N 442 TOP C17 H173 sing N N 443 TOP C18 O19 sing N N 444 TOP C18 C21 doub Y N 445 TOP O19 C20 sing N N 446 TOP C20 H201 sing N N 447 TOP C20 H202 sing N N 448 TOP C20 H203 sing N N 449 TOP C21 H21 sing N N 450 TRP N CA sing N N 451 TRP N H sing N N 452 TRP N H2 sing N N 453 TRP CA C sing N N 454 TRP CA CB sing N N 455 TRP CA HA sing N N 456 TRP C O doub N N 457 TRP C OXT sing N N 458 TRP CB CG sing N N 459 TRP CB HB2 sing N N 460 TRP CB HB3 sing N N 461 TRP CG CD1 doub Y N 462 TRP CG CD2 sing Y N 463 TRP CD1 NE1 sing Y N 464 TRP CD1 HD1 sing N N 465 TRP CD2 CE2 doub Y N 466 TRP CD2 CE3 sing Y N 467 TRP NE1 CE2 sing Y N 468 TRP NE1 HE1 sing N N 469 TRP CE2 CZ2 sing Y N 470 TRP CE3 CZ3 doub Y N 471 TRP CE3 HE3 sing N N 472 TRP CZ2 CH2 doub Y N 473 TRP CZ2 HZ2 sing N N 474 TRP CZ3 CH2 sing Y N 475 TRP CZ3 HZ3 sing N N 476 TRP CH2 HH2 sing N N 477 TRP OXT HXT sing N N 478 TYR N CA sing N N 479 TYR N H sing N N 480 TYR N H2 sing N N 481 TYR CA C sing N N 482 TYR CA CB sing N N 483 TYR CA HA sing N N 484 TYR C O doub N N 485 TYR C OXT sing N N 486 TYR CB CG sing N N 487 TYR CB HB2 sing N N 488 TYR CB HB3 sing N N 489 TYR CG CD1 doub Y N 490 TYR CG CD2 sing Y N 491 TYR CD1 CE1 sing Y N 492 TYR CD1 HD1 sing N N 493 TYR CD2 CE2 doub Y N 494 TYR CD2 HD2 sing N N 495 TYR CE1 CZ doub Y N 496 TYR CE1 HE1 sing N N 497 TYR CE2 CZ sing Y N 498 TYR CE2 HE2 sing N N 499 TYR CZ OH sing N N 500 TYR OH HH sing N N 501 TYR OXT HXT sing N N 502 VAL N CA sing N N 503 VAL N H sing N N 504 VAL N H2 sing N N 505 VAL CA C sing N N 506 VAL CA CB sing N N 507 VAL CA HA sing N N 508 VAL C O doub N N 509 VAL C OXT sing N N 510 VAL CB CG1 sing N N 511 VAL CB CG2 sing N N 512 VAL CB HB sing N N 513 VAL CG1 HG11 sing N N 514 VAL CG1 HG12 sing N N 515 VAL CG1 HG13 sing N N 516 VAL CG2 HG21 sing N N 517 VAL CG2 HG22 sing N N 518 VAL CG2 HG23 sing N N 519 VAL OXT HXT sing N N 520 # loop_ _pdbx_initial_refinement_model.id _pdbx_initial_refinement_model.entity_id_list _pdbx_initial_refinement_model.type _pdbx_initial_refinement_model.source_name _pdbx_initial_refinement_model.accession_code _pdbx_initial_refinement_model.details 1 ? 'experimental model' PDB 5UII '5UII, 5H8D' 2 ? 'experimental model' PDB 5H8D '5UII, 5H8D' # _atom_sites.entry_id 6RUL _atom_sites.fract_transf_matrix[1][1] 0.011546 _atom_sites.fract_transf_matrix[1][2] 0.006666 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013332 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.013691 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O P S # loop_