data_6RY5 # _entry.id 6RY5 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.333 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 6RY5 WWPDB D_1292101429 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6RY5 _pdbx_database_status.recvd_initial_deposition_date 2019-06-10 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Essen, L.-O.' 1 ? 'Vogt, M.S.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Proc.Natl.Acad.Sci.USA _citation.journal_id_ASTM PNASA6 _citation.journal_id_CSD 0040 _citation.journal_id_ISSN 1091-6490 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 117 _citation.language ? _citation.page_first 22061 _citation.page_last 22067 _citation.title 'Structural base for the transfer of GPI-anchored glycoproteins into fungal cell walls.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1073/pnas.2010661117 _citation.pdbx_database_id_PubMed 32839341 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Vogt, M.S.' 1 ? primary 'Schmitz, G.F.' 2 ? primary 'Varon Silva, D.' 3 ? primary 'Mosch, H.U.' 4 ? primary 'Essen, L.O.' 5 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.37 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 6RY5 _cell.details ? _cell.formula_units_Z ? _cell.length_a 83.415 _cell.length_a_esd ? _cell.length_b 55.019 _cell.length_b_esd ? _cell.length_c 80.119 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6RY5 _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Mannan endo-1,6-alpha-mannosidase' 49546.172 1 3.2.1.101 ? ? ? 2 branched man 'alpha-D-mannopyranose-(1-6)-beta-D-mannopyranose' 342.297 1 ? ? ? ? 3 non-polymer man 'CALCIUM ION' 40.078 2 ? ? ? ? 4 non-polymer syn 'TRIETHYLENE GLYCOL' 150.173 1 ? ? ? ? 5 water nat water 18.015 345 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGSSHHHHHHSSGLVPRGSHMASQQQYYKIDTKEEILESARTLAYDMMLFYKGNQSGEIPGILPGPPTEHKGDYYWWEGG AMMGTYVDYWHLTGDPSYNHVIMEGMLHQVGPNADYQPPNHTASLGNDDQGFWGMSAMLAAENKFPNPPDDKPQWLALAQ AVWTTQASPERHDGTCNGGLRWQIPPTNAGYNYKNTIANACFFDLGARLARYTKNNTYAEWAEKIFDWLYAVGYIDHETW AVYDGGHVEHNCTDINRAQFSYNAALLLHGAAFMWNYTEDQKWKDRVDNLLTGILRDFFKDGVVFEIPCEGRQGACTADM LTFKGYVHRWMAVVTQIAPHTKDRILPVLRTSAEAAVKQCVGPPTGRRCGFYWKSGKFVDPSVDHTSGAGEAMSVLAAVS SLLIEYAEPPATNETGISRGDPNAGMRSRGAAQHFREINAGDR ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSSHHHHHHSSGLVPRGSHMASQQQYYKIDTKEEILESARTLAYDMMLFYKGNQSGEIPGILPGPPTEHKGDYYWWEGG AMMGTYVDYWHLTGDPSYNHVIMEGMLHQVGPNADYQPPNHTASLGNDDQGFWGMSAMLAAENKFPNPPDDKPQWLALAQ AVWTTQASPERHDGTCNGGLRWQIPPTNAGYNYKNTIANACFFDLGARLARYTKNNTYAEWAEKIFDWLYAVGYIDHETW AVYDGGHVEHNCTDINRAQFSYNAALLLHGAAFMWNYTEDQKWKDRVDNLLTGILRDFFKDGVVFEIPCEGRQGACTADM LTFKGYVHRWMAVVTQIAPHTKDRILPVLRTSAEAAVKQCVGPPTGRRCGFYWKSGKFVDPSVDHTSGAGEAMSVLAAVS SLLIEYAEPPATNETGISRGDPNAGMRSRGAAQHFREINAGDR ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 SER n 1 12 SER n 1 13 GLY n 1 14 LEU n 1 15 VAL n 1 16 PRO n 1 17 ARG n 1 18 GLY n 1 19 SER n 1 20 HIS n 1 21 MET n 1 22 ALA n 1 23 SER n 1 24 GLN n 1 25 GLN n 1 26 GLN n 1 27 TYR n 1 28 TYR n 1 29 LYS n 1 30 ILE n 1 31 ASP n 1 32 THR n 1 33 LYS n 1 34 GLU n 1 35 GLU n 1 36 ILE n 1 37 LEU n 1 38 GLU n 1 39 SER n 1 40 ALA n 1 41 ARG n 1 42 THR n 1 43 LEU n 1 44 ALA n 1 45 TYR n 1 46 ASP n 1 47 MET n 1 48 MET n 1 49 LEU n 1 50 PHE n 1 51 TYR n 1 52 LYS n 1 53 GLY n 1 54 ASN n 1 55 GLN n 1 56 SER n 1 57 GLY n 1 58 GLU n 1 59 ILE n 1 60 PRO n 1 61 GLY n 1 62 ILE n 1 63 LEU n 1 64 PRO n 1 65 GLY n 1 66 PRO n 1 67 PRO n 1 68 THR n 1 69 GLU n 1 70 HIS n 1 71 LYS n 1 72 GLY n 1 73 ASP n 1 74 TYR n 1 75 TYR n 1 76 TRP n 1 77 TRP n 1 78 GLU n 1 79 GLY n 1 80 GLY n 1 81 ALA n 1 82 MET n 1 83 MET n 1 84 GLY n 1 85 THR n 1 86 TYR n 1 87 VAL n 1 88 ASP n 1 89 TYR n 1 90 TRP n 1 91 HIS n 1 92 LEU n 1 93 THR n 1 94 GLY n 1 95 ASP n 1 96 PRO n 1 97 SER n 1 98 TYR n 1 99 ASN n 1 100 HIS n 1 101 VAL n 1 102 ILE n 1 103 MET n 1 104 GLU n 1 105 GLY n 1 106 MET n 1 107 LEU n 1 108 HIS n 1 109 GLN n 1 110 VAL n 1 111 GLY n 1 112 PRO n 1 113 ASN n 1 114 ALA n 1 115 ASP n 1 116 TYR n 1 117 GLN n 1 118 PRO n 1 119 PRO n 1 120 ASN n 1 121 HIS n 1 122 THR n 1 123 ALA n 1 124 SER n 1 125 LEU n 1 126 GLY n 1 127 ASN n 1 128 ASP n 1 129 ASP n 1 130 GLN n 1 131 GLY n 1 132 PHE n 1 133 TRP n 1 134 GLY n 1 135 MET n 1 136 SER n 1 137 ALA n 1 138 MET n 1 139 LEU n 1 140 ALA n 1 141 ALA n 1 142 GLU n 1 143 ASN n 1 144 LYS n 1 145 PHE n 1 146 PRO n 1 147 ASN n 1 148 PRO n 1 149 PRO n 1 150 ASP n 1 151 ASP n 1 152 LYS n 1 153 PRO n 1 154 GLN n 1 155 TRP n 1 156 LEU n 1 157 ALA n 1 158 LEU n 1 159 ALA n 1 160 GLN n 1 161 ALA n 1 162 VAL n 1 163 TRP n 1 164 THR n 1 165 THR n 1 166 GLN n 1 167 ALA n 1 168 SER n 1 169 PRO n 1 170 GLU n 1 171 ARG n 1 172 HIS n 1 173 ASP n 1 174 GLY n 1 175 THR n 1 176 CYS n 1 177 ASN n 1 178 GLY n 1 179 GLY n 1 180 LEU n 1 181 ARG n 1 182 TRP n 1 183 GLN n 1 184 ILE n 1 185 PRO n 1 186 PRO n 1 187 THR n 1 188 ASN n 1 189 ALA n 1 190 GLY n 1 191 TYR n 1 192 ASN n 1 193 TYR n 1 194 LYS n 1 195 ASN n 1 196 THR n 1 197 ILE n 1 198 ALA n 1 199 ASN n 1 200 ALA n 1 201 CYS n 1 202 PHE n 1 203 PHE n 1 204 ASP n 1 205 LEU n 1 206 GLY n 1 207 ALA n 1 208 ARG n 1 209 LEU n 1 210 ALA n 1 211 ARG n 1 212 TYR n 1 213 THR n 1 214 LYS n 1 215 ASN n 1 216 ASN n 1 217 THR n 1 218 TYR n 1 219 ALA n 1 220 GLU n 1 221 TRP n 1 222 ALA n 1 223 GLU n 1 224 LYS n 1 225 ILE n 1 226 PHE n 1 227 ASP n 1 228 TRP n 1 229 LEU n 1 230 TYR n 1 231 ALA n 1 232 VAL n 1 233 GLY n 1 234 TYR n 1 235 ILE n 1 236 ASP n 1 237 HIS n 1 238 GLU n 1 239 THR n 1 240 TRP n 1 241 ALA n 1 242 VAL n 1 243 TYR n 1 244 ASP n 1 245 GLY n 1 246 GLY n 1 247 HIS n 1 248 VAL n 1 249 GLU n 1 250 HIS n 1 251 ASN n 1 252 CYS n 1 253 THR n 1 254 ASP n 1 255 ILE n 1 256 ASN n 1 257 ARG n 1 258 ALA n 1 259 GLN n 1 260 PHE n 1 261 SER n 1 262 TYR n 1 263 ASN n 1 264 ALA n 1 265 ALA n 1 266 LEU n 1 267 LEU n 1 268 LEU n 1 269 HIS n 1 270 GLY n 1 271 ALA n 1 272 ALA n 1 273 PHE n 1 274 MET n 1 275 TRP n 1 276 ASN n 1 277 TYR n 1 278 THR n 1 279 GLU n 1 280 ASP n 1 281 GLN n 1 282 LYS n 1 283 TRP n 1 284 LYS n 1 285 ASP n 1 286 ARG n 1 287 VAL n 1 288 ASP n 1 289 ASN n 1 290 LEU n 1 291 LEU n 1 292 THR n 1 293 GLY n 1 294 ILE n 1 295 LEU n 1 296 ARG n 1 297 ASP n 1 298 PHE n 1 299 PHE n 1 300 LYS n 1 301 ASP n 1 302 GLY n 1 303 VAL n 1 304 VAL n 1 305 PHE n 1 306 GLU n 1 307 ILE n 1 308 PRO n 1 309 CYS n 1 310 GLU n 1 311 GLY n 1 312 ARG n 1 313 GLN n 1 314 GLY n 1 315 ALA n 1 316 CYS n 1 317 THR n 1 318 ALA n 1 319 ASP n 1 320 MET n 1 321 LEU n 1 322 THR n 1 323 PHE n 1 324 LYS n 1 325 GLY n 1 326 TYR n 1 327 VAL n 1 328 HIS n 1 329 ARG n 1 330 TRP n 1 331 MET n 1 332 ALA n 1 333 VAL n 1 334 VAL n 1 335 THR n 1 336 GLN n 1 337 ILE n 1 338 ALA n 1 339 PRO n 1 340 HIS n 1 341 THR n 1 342 LYS n 1 343 ASP n 1 344 ARG n 1 345 ILE n 1 346 LEU n 1 347 PRO n 1 348 VAL n 1 349 LEU n 1 350 ARG n 1 351 THR n 1 352 SER n 1 353 ALA n 1 354 GLU n 1 355 ALA n 1 356 ALA n 1 357 VAL n 1 358 LYS n 1 359 GLN n 1 360 CYS n 1 361 VAL n 1 362 GLY n 1 363 PRO n 1 364 PRO n 1 365 THR n 1 366 GLY n 1 367 ARG n 1 368 ARG n 1 369 CYS n 1 370 GLY n 1 371 PHE n 1 372 TYR n 1 373 TRP n 1 374 LYS n 1 375 SER n 1 376 GLY n 1 377 LYS n 1 378 PHE n 1 379 VAL n 1 380 ASP n 1 381 PRO n 1 382 SER n 1 383 VAL n 1 384 ASP n 1 385 HIS n 1 386 THR n 1 387 SER n 1 388 GLY n 1 389 ALA n 1 390 GLY n 1 391 GLU n 1 392 ALA n 1 393 MET n 1 394 SER n 1 395 VAL n 1 396 LEU n 1 397 ALA n 1 398 ALA n 1 399 VAL n 1 400 SER n 1 401 SER n 1 402 LEU n 1 403 LEU n 1 404 ILE n 1 405 GLU n 1 406 TYR n 1 407 ALA n 1 408 GLU n 1 409 PRO n 1 410 PRO n 1 411 ALA n 1 412 THR n 1 413 ASN n 1 414 GLU n 1 415 THR n 1 416 GLY n 1 417 ILE n 1 418 SER n 1 419 ARG n 1 420 GLY n 1 421 ASP n 1 422 PRO n 1 423 ASN n 1 424 ALA n 1 425 GLY n 1 426 MET n 1 427 ARG n 1 428 SER n 1 429 ARG n 1 430 GLY n 1 431 ALA n 1 432 ALA n 1 433 GLN n 1 434 HIS n 1 435 PHE n 1 436 ARG n 1 437 GLU n 1 438 ILE n 1 439 ASN n 1 440 ALA n 1 441 GLY n 1 442 ASP n 1 443 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 443 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene CTHT_0020800 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'DSM 1495 / CBS 144.50 / IMI 039719' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 759272 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli B' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 37762 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'SHuffle T7 Express Competent' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type pET28a _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code G0S3F2_CHATD _struct_ref.pdbx_db_accession G0S3F2 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;QQQYYKIDTKEEILESARTLAYDMMLFYKGNQSGEIPGILPGPPTEHKGDYYWWEGGAMMGTYVDYWHLTGDPSYNHVIM EGMLHQVGPNADYQPPNHTASLGNDDQGFWGMSAMLAAENKFPNPPDDKPQWLALAQAVWTTQASPERHDGTCNGGLRWQ IPPTNAGYNYKNTIANACFFDLGARLARYTKNNTYAEWAEKIFDWLYAVGYIDHETWAVYDGGHVEHNCTDINRAQFSYN AALLLHGAAFMWNYTEDQKWKDRVDNLLTGILRDFFKDGVVFEIPCEGRQGACTADMLTFKGYVHRWMAVVTQIAPHTKD RILPVLRTSAEAAVKQCVGPPTGRRCGFYWKSGKFVDPSVDHTSGAGEAMSVLAAVSSLLIEYAEPPATNETGISRGDPN AGMRSRGAAQHFREINAGDR ; _struct_ref.pdbx_align_begin 30 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6RY5 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 24 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 443 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession G0S3F2 _struct_ref_seq.db_align_beg 30 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 449 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 30 _struct_ref_seq.pdbx_auth_seq_align_end 449 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6RY5 MET A 1 ? UNP G0S3F2 ? ? 'initiating methionine' 7 1 1 6RY5 GLY A 2 ? UNP G0S3F2 ? ? 'expression tag' 8 2 1 6RY5 SER A 3 ? UNP G0S3F2 ? ? 'expression tag' 9 3 1 6RY5 SER A 4 ? UNP G0S3F2 ? ? 'expression tag' 10 4 1 6RY5 HIS A 5 ? UNP G0S3F2 ? ? 'expression tag' 11 5 1 6RY5 HIS A 6 ? UNP G0S3F2 ? ? 'expression tag' 12 6 1 6RY5 HIS A 7 ? UNP G0S3F2 ? ? 'expression tag' 13 7 1 6RY5 HIS A 8 ? UNP G0S3F2 ? ? 'expression tag' 14 8 1 6RY5 HIS A 9 ? UNP G0S3F2 ? ? 'expression tag' 15 9 1 6RY5 HIS A 10 ? UNP G0S3F2 ? ? 'expression tag' 16 10 1 6RY5 SER A 11 ? UNP G0S3F2 ? ? 'expression tag' 17 11 1 6RY5 SER A 12 ? UNP G0S3F2 ? ? 'expression tag' 18 12 1 6RY5 GLY A 13 ? UNP G0S3F2 ? ? 'expression tag' 19 13 1 6RY5 LEU A 14 ? UNP G0S3F2 ? ? 'expression tag' 20 14 1 6RY5 VAL A 15 ? UNP G0S3F2 ? ? 'expression tag' 21 15 1 6RY5 PRO A 16 ? UNP G0S3F2 ? ? 'expression tag' 22 16 1 6RY5 ARG A 17 ? UNP G0S3F2 ? ? 'expression tag' 23 17 1 6RY5 GLY A 18 ? UNP G0S3F2 ? ? 'expression tag' 24 18 1 6RY5 SER A 19 ? UNP G0S3F2 ? ? 'expression tag' 25 19 1 6RY5 HIS A 20 ? UNP G0S3F2 ? ? 'expression tag' 26 20 1 6RY5 MET A 21 ? UNP G0S3F2 ? ? 'expression tag' 27 21 1 6RY5 ALA A 22 ? UNP G0S3F2 ? ? 'expression tag' 28 22 1 6RY5 SER A 23 ? UNP G0S3F2 ? ? 'expression tag' 29 23 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 BMA 'D-saccharide, beta linking' . beta-D-mannopyranose 'beta-D-mannose; D-mannose; mannose' 'C6 H12 O6' 180.156 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MAN 'D-saccharide, alpha linking' . alpha-D-mannopyranose 'alpha-D-mannose; D-mannose; mannose' 'C6 H12 O6' 180.156 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PGE non-polymer . 'TRIETHYLENE GLYCOL' ? 'C6 H14 O4' 150.173 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6RY5 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.00 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 38.56 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'Ammoniumiodide, PEG3350, Calcium acetate, MES, PEG 8000' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details 'Toroidal mirror' _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M-F' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-11-18 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'Si(111)' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.072 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE ID29' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.072 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ID29 _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate 13.03 _reflns.entry_id 6RY5 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.3 _reflns.d_resolution_low 45.93 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 85994 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 96.4 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 1.9 _reflns.pdbx_Rmerge_I_obs 0.02 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 20.02 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.028 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.3 _reflns_shell.d_res_low 1.346 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 6.93 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 8464 _reflns_shell.percent_possible_all 95.07 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.094 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 1.8 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.975 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6RY5 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.300 _refine.ls_d_res_low 45.928 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 85992 _refine.ls_number_reflns_R_free 4210 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 96.39 _refine.ls_percent_reflns_R_free 4.90 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1027 _refine.ls_R_factor_R_free 0.1233 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1016 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.35 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 9.58 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.07 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.300 _refine_hist.d_res_low 45.928 _refine_hist.number_atoms_solvent 345 _refine_hist.number_atoms_total 3615 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 3235 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 35 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.015 ? 3568 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.599 ? 4877 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 12.901 ? 1309 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.104 ? 495 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.010 ? 644 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.3000 1.3148 . . 133 2712 95.00 . . . 0.1200 . 0.0833 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.3148 1.3303 . . 128 2649 95.00 . . . 0.1286 . 0.0856 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.3303 1.3465 . . 124 2718 95.00 . . . 0.1252 . 0.0842 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.3465 1.3635 . . 153 2630 95.00 . . . 0.1102 . 0.0820 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.3635 1.3815 . . 143 2701 95.00 . . . 0.1259 . 0.0833 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.3815 1.4004 . . 132 2666 96.00 . . . 0.1286 . 0.0845 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.4004 1.4204 . . 148 2710 96.00 . . . 0.1116 . 0.0850 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.4204 1.4416 . . 123 2684 95.00 . . . 0.1172 . 0.0850 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.4416 1.4641 . . 123 2724 96.00 . . . 0.1215 . 0.0820 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.4641 1.4881 . . 141 2679 95.00 . . . 0.1397 . 0.0801 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.4881 1.5138 . . 114 2753 96.00 . . . 0.1163 . 0.0738 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.5138 1.5413 . . 140 2668 96.00 . . . 0.0937 . 0.0717 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.5413 1.5710 . . 130 2721 95.00 . . . 0.1043 . 0.0736 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.5710 1.6030 . . 136 2699 96.00 . . . 0.0985 . 0.0733 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.6030 1.6379 . . 142 2709 97.00 . . . 0.0981 . 0.0745 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.6379 1.6760 . . 122 2790 97.00 . . . 0.1187 . 0.0756 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.6760 1.7179 . . 169 2705 97.00 . . . 0.1091 . 0.0764 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.7179 1.7644 . . 129 2690 96.00 . . . 0.1191 . 0.0773 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.7644 1.8163 . . 171 2716 97.00 . . . 0.1028 . 0.0827 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.8163 1.8749 . . 113 2760 97.00 . . . 0.1086 . 0.0856 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.8749 1.9419 . . 173 2759 97.00 . . . 0.1269 . 0.0893 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.9419 2.0197 . . 174 2703 98.00 . . . 0.1110 . 0.0905 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.0197 2.1116 . . 141 2766 97.00 . . . 0.1182 . 0.0910 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.1116 2.2229 . . 136 2765 98.00 . . . 0.1191 . 0.0931 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.2229 2.3622 . . 137 2759 97.00 . . . 0.1074 . 0.0946 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.3622 2.5446 . . 151 2725 97.00 . . . 0.1109 . 0.1000 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.5446 2.8006 . . 153 2798 98.00 . . . 0.1279 . 0.1136 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.8006 3.2058 . . 138 2793 98.00 . . . 0.1293 . 0.1224 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.2058 4.0386 . . 160 2762 97.00 . . . 0.1355 . 0.1195 . . . . . . . . . . 'X-RAY DIFFRACTION' 4.0386 45.9566 . . 133 2868 97.00 . . . 0.1554 . 0.1376 . . . . . . . . . . # _struct.entry_id 6RY5 _struct.title 'Crystal structure of Dfg5 from Chaetomium thermophilum in complex with alpha-1,6-mannobiose' _struct.pdbx_descriptor 'Mannan endo-1,6-alpha-mannosidase (E.C.3.2.1.101)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6RY5 _struct_keywords.text 'Transglycosidase, Fungal Cell Wall, Plasma Membrane, GPI-anchor, GPI-CWP, HYDROLASE' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 4 ? F N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 32 ? LEU A 49 ? THR A 38 LEU A 55 1 ? 18 HELX_P HELX_P2 AA2 PRO A 66 ? HIS A 70 ? PRO A 72 HIS A 76 5 ? 5 HELX_P HELX_P3 AA3 TYR A 75 ? GLY A 94 ? TYR A 81 GLY A 100 1 ? 20 HELX_P HELX_P4 AA4 TYR A 98 ? GLN A 109 ? TYR A 104 GLN A 115 1 ? 12 HELX_P HELX_P5 AA5 PRO A 118 ? LEU A 125 ? PRO A 124 LEU A 131 5 ? 8 HELX_P HELX_P6 AA6 GLY A 126 ? ASN A 143 ? GLY A 132 ASN A 149 1 ? 18 HELX_P HELX_P7 AA7 GLN A 154 ? ALA A 167 ? GLN A 160 ALA A 173 1 ? 14 HELX_P HELX_P8 AA8 SER A 168 ? HIS A 172 ? SER A 174 HIS A 178 5 ? 5 HELX_P HELX_P9 AA9 GLY A 174 ? GLY A 178 ? GLY A 180 GLY A 184 5 ? 5 HELX_P HELX_P10 AB1 THR A 196 ? LYS A 214 ? THR A 202 LYS A 220 1 ? 19 HELX_P HELX_P11 AB2 ASN A 215 ? VAL A 232 ? ASN A 221 VAL A 238 1 ? 18 HELX_P HELX_P12 AB3 GLU A 249 ? ASN A 251 ? GLU A 255 ASN A 257 5 ? 3 HELX_P HELX_P13 AB4 PHE A 260 ? GLU A 279 ? PHE A 266 GLU A 285 1 ? 20 HELX_P HELX_P14 AB5 ASP A 280 ? PHE A 298 ? ASP A 286 PHE A 304 1 ? 19 HELX_P HELX_P15 AB6 ASP A 319 ? LEU A 321 ? ASP A 325 LEU A 327 5 ? 3 HELX_P HELX_P16 AB7 THR A 322 ? ALA A 338 ? THR A 328 ALA A 344 1 ? 17 HELX_P HELX_P17 AB8 THR A 341 ? GLN A 359 ? THR A 347 GLN A 365 1 ? 19 HELX_P HELX_P18 AB9 ASP A 380 ? HIS A 385 ? ASP A 386 HIS A 391 5 ? 6 HELX_P HELX_P19 AC1 GLY A 388 ? SER A 401 ? GLY A 394 SER A 407 1 ? 14 HELX_P HELX_P20 AC2 LEU A 402 ? ALA A 407 ? LEU A 408 ALA A 413 5 ? 6 HELX_P HELX_P21 AC3 GLY A 430 ? PHE A 435 ? GLY A 436 PHE A 441 5 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 176 SG ? ? ? 1_555 A CYS 252 SG ? ? A CYS 182 A CYS 258 1_555 ? ? ? ? ? ? ? 2.079 ? ? disulf2 disulf ? ? A CYS 309 SG ? ? ? 1_555 A CYS 316 SG ? ? A CYS 315 A CYS 322 1_555 ? ? ? ? ? ? ? 2.015 ? ? disulf3 disulf ? ? A CYS 360 SG ? ? ? 1_555 A CYS 369 SG ? ? A CYS 366 A CYS 375 1_555 ? ? ? ? ? ? ? 2.104 ? ? covale1 covale both ? B BMA . O6 ? ? ? 1_555 B MAN . C1 ? ? B BMA 1 B MAN 2 1_555 ? ? ? ? ? ? ? 1.411 sing ? metalc1 metalc ? ? A ASP 73 OD1 ? ? ? 1_555 C CA . CA ? ? A ASP 79 A CA 501 1_555 ? ? ? ? ? ? ? 2.244 ? ? metalc2 metalc ? ? A ASP 129 OD1 ? ? ? 1_555 D CA . CA ? ? A ASP 135 A CA 502 1_555 ? ? ? ? ? ? ? 2.431 ? ? metalc3 metalc ? ? A ASP 129 OD2 ? ? ? 1_555 D CA . CA ? ? A ASP 135 A CA 502 1_555 ? ? ? ? ? ? ? 2.516 ? ? metalc4 metalc ? ? A GLU 279 OE1 ? ? ? 1_555 C CA . CA ? ? A GLU 285 A CA 501 3_455 ? ? ? ? ? ? ? 2.516 ? ? metalc5 metalc ? ? A GLU 279 OE2 ? ? ? 1_555 C CA . CA ? ? A GLU 285 A CA 501 3_455 ? ? ? ? ? ? ? 2.449 ? ? metalc6 metalc ? ? A HIS 385 O ? ? ? 1_555 C CA . CA ? ? A HIS 391 A CA 501 1_555 ? ? ? ? ? ? ? 2.450 ? ? metalc7 metalc ? ? C CA . CA ? ? ? 1_555 F HOH . O ? ? A CA 501 A HOH 645 1_555 ? ? ? ? ? ? ? 2.163 ? ? metalc8 metalc ? ? C CA . CA ? ? ? 1_555 F HOH . O ? ? A CA 501 A HOH 857 1_555 ? ? ? ? ? ? ? 2.229 ? ? metalc9 metalc ? ? C CA . CA ? ? ? 1_555 F HOH . O ? ? A CA 501 A HOH 881 1_555 ? ? ? ? ? ? ? 2.409 ? ? metalc10 metalc ? ? D CA . CA ? ? ? 1_555 F HOH . O ? ? A CA 502 A HOH 677 1_555 ? ? ? ? ? ? ? 2.218 ? ? metalc11 metalc ? ? D CA . CA ? ? ? 1_555 F HOH . O ? ? A CA 502 A HOH 784 1_555 ? ? ? ? ? ? ? 2.605 ? ? metalc12 metalc ? ? D CA . CA ? ? ? 1_555 F HOH . O ? ? A CA 502 A HOH 885 1_555 ? ? ? ? ? ? ? 2.271 ? ? metalc13 metalc ? ? D CA . CA ? ? ? 1_555 F HOH . O ? ? A CA 502 A HOH 894 1_555 ? ? ? ? ? ? ? 2.440 ? ? metalc14 metalc ? ? D CA . CA ? ? ? 1_555 B BMA . O2 ? ? A CA 502 B BMA 1 1_555 ? ? ? ? ? ? ? 2.516 ? ? metalc15 metalc ? ? D CA . CA ? ? ? 1_555 B BMA . O1 ? ? A CA 502 B BMA 1 1_555 ? ? ? ? ? ? ? 2.533 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? metalc ? ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 GLY 65 A . ? GLY 71 A PRO 66 A ? PRO 72 A 1 5.91 2 PRO 363 A . ? PRO 369 A PRO 364 A ? PRO 370 A 1 8.14 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 2 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 TYR A 193 ? ASN A 195 ? TYR A 199 ASN A 201 AA1 2 GLY A 245 ? HIS A 247 ? GLY A 251 HIS A 253 AA2 1 PHE A 299 ? LYS A 300 ? PHE A 305 LYS A 306 AA2 2 VAL A 303 ? VAL A 304 ? VAL A 309 VAL A 310 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LYS A 194 ? N LYS A 200 O GLY A 246 ? O GLY A 252 AA2 1 2 N LYS A 300 ? N LYS A 306 O VAL A 303 ? O VAL A 309 # _atom_sites.entry_id 6RY5 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.011988 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000077 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.018176 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012482 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C CA H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 7 ? ? ? A . n A 1 2 GLY 2 8 ? ? ? A . n A 1 3 SER 3 9 ? ? ? A . n A 1 4 SER 4 10 ? ? ? A . n A 1 5 HIS 5 11 ? ? ? A . n A 1 6 HIS 6 12 ? ? ? A . n A 1 7 HIS 7 13 ? ? ? A . n A 1 8 HIS 8 14 ? ? ? A . n A 1 9 HIS 9 15 ? ? ? A . n A 1 10 HIS 10 16 ? ? ? A . n A 1 11 SER 11 17 ? ? ? A . n A 1 12 SER 12 18 ? ? ? A . n A 1 13 GLY 13 19 ? ? ? A . n A 1 14 LEU 14 20 ? ? ? A . n A 1 15 VAL 15 21 ? ? ? A . n A 1 16 PRO 16 22 ? ? ? A . n A 1 17 ARG 17 23 ? ? ? A . n A 1 18 GLY 18 24 ? ? ? A . n A 1 19 SER 19 25 ? ? ? A . n A 1 20 HIS 20 26 ? ? ? A . n A 1 21 MET 21 27 ? ? ? A . n A 1 22 ALA 22 28 ? ? ? A . n A 1 23 SER 23 29 ? ? ? A . n A 1 24 GLN 24 30 ? ? ? A . n A 1 25 GLN 25 31 ? ? ? A . n A 1 26 GLN 26 32 32 GLN GLN A . n A 1 27 TYR 27 33 33 TYR TYR A . n A 1 28 TYR 28 34 34 TYR TYR A . n A 1 29 LYS 29 35 35 LYS LYS A . n A 1 30 ILE 30 36 36 ILE ILE A . n A 1 31 ASP 31 37 37 ASP ASP A . n A 1 32 THR 32 38 38 THR THR A . n A 1 33 LYS 33 39 39 LYS LYS A . n A 1 34 GLU 34 40 40 GLU GLU A . n A 1 35 GLU 35 41 41 GLU GLU A . n A 1 36 ILE 36 42 42 ILE ILE A . n A 1 37 LEU 37 43 43 LEU LEU A . n A 1 38 GLU 38 44 44 GLU GLU A . n A 1 39 SER 39 45 45 SER SER A . n A 1 40 ALA 40 46 46 ALA ALA A . n A 1 41 ARG 41 47 47 ARG ARG A . n A 1 42 THR 42 48 48 THR THR A . n A 1 43 LEU 43 49 49 LEU LEU A . n A 1 44 ALA 44 50 50 ALA ALA A . n A 1 45 TYR 45 51 51 TYR TYR A . n A 1 46 ASP 46 52 52 ASP ASP A . n A 1 47 MET 47 53 53 MET MET A . n A 1 48 MET 48 54 54 MET MET A . n A 1 49 LEU 49 55 55 LEU LEU A . n A 1 50 PHE 50 56 56 PHE PHE A . n A 1 51 TYR 51 57 57 TYR TYR A . n A 1 52 LYS 52 58 58 LYS LYS A . n A 1 53 GLY 53 59 59 GLY GLY A . n A 1 54 ASN 54 60 60 ASN ASN A . n A 1 55 GLN 55 61 61 GLN GLN A . n A 1 56 SER 56 62 62 SER SER A . n A 1 57 GLY 57 63 63 GLY GLY A . n A 1 58 GLU 58 64 64 GLU GLU A . n A 1 59 ILE 59 65 65 ILE ILE A . n A 1 60 PRO 60 66 66 PRO PRO A . n A 1 61 GLY 61 67 67 GLY GLY A . n A 1 62 ILE 62 68 68 ILE ILE A . n A 1 63 LEU 63 69 69 LEU LEU A . n A 1 64 PRO 64 70 70 PRO PRO A . n A 1 65 GLY 65 71 71 GLY GLY A . n A 1 66 PRO 66 72 72 PRO PRO A . n A 1 67 PRO 67 73 73 PRO PRO A . n A 1 68 THR 68 74 74 THR THR A . n A 1 69 GLU 69 75 75 GLU GLU A . n A 1 70 HIS 70 76 76 HIS HIS A . n A 1 71 LYS 71 77 77 LYS LYS A . n A 1 72 GLY 72 78 78 GLY GLY A . n A 1 73 ASP 73 79 79 ASP ASP A . n A 1 74 TYR 74 80 80 TYR TYR A . n A 1 75 TYR 75 81 81 TYR TYR A . n A 1 76 TRP 76 82 82 TRP TRP A . n A 1 77 TRP 77 83 83 TRP TRP A . n A 1 78 GLU 78 84 84 GLU GLU A . n A 1 79 GLY 79 85 85 GLY GLY A . n A 1 80 GLY 80 86 86 GLY GLY A . n A 1 81 ALA 81 87 87 ALA ALA A . n A 1 82 MET 82 88 88 MET MET A . n A 1 83 MET 83 89 89 MET MET A . n A 1 84 GLY 84 90 90 GLY GLY A . n A 1 85 THR 85 91 91 THR THR A . n A 1 86 TYR 86 92 92 TYR TYR A . n A 1 87 VAL 87 93 93 VAL VAL A . n A 1 88 ASP 88 94 94 ASP ASP A . n A 1 89 TYR 89 95 95 TYR TYR A . n A 1 90 TRP 90 96 96 TRP TRP A . n A 1 91 HIS 91 97 97 HIS HIS A . n A 1 92 LEU 92 98 98 LEU LEU A . n A 1 93 THR 93 99 99 THR THR A . n A 1 94 GLY 94 100 100 GLY GLY A . n A 1 95 ASP 95 101 101 ASP ASP A . n A 1 96 PRO 96 102 102 PRO PRO A . n A 1 97 SER 97 103 103 SER SER A . n A 1 98 TYR 98 104 104 TYR TYR A . n A 1 99 ASN 99 105 105 ASN ASN A . n A 1 100 HIS 100 106 106 HIS HIS A . n A 1 101 VAL 101 107 107 VAL VAL A . n A 1 102 ILE 102 108 108 ILE ILE A . n A 1 103 MET 103 109 109 MET MET A . n A 1 104 GLU 104 110 110 GLU GLU A . n A 1 105 GLY 105 111 111 GLY GLY A . n A 1 106 MET 106 112 112 MET MET A . n A 1 107 LEU 107 113 113 LEU LEU A . n A 1 108 HIS 108 114 114 HIS HIS A . n A 1 109 GLN 109 115 115 GLN GLN A . n A 1 110 VAL 110 116 116 VAL VAL A . n A 1 111 GLY 111 117 117 GLY GLY A . n A 1 112 PRO 112 118 118 PRO PRO A . n A 1 113 ASN 113 119 119 ASN ASN A . n A 1 114 ALA 114 120 120 ALA ALA A . n A 1 115 ASP 115 121 121 ASP ASP A . n A 1 116 TYR 116 122 122 TYR TYR A . n A 1 117 GLN 117 123 123 GLN GLN A . n A 1 118 PRO 118 124 124 PRO PRO A . n A 1 119 PRO 119 125 125 PRO PRO A . n A 1 120 ASN 120 126 126 ASN ASN A . n A 1 121 HIS 121 127 127 HIS HIS A . n A 1 122 THR 122 128 128 THR THR A . n A 1 123 ALA 123 129 129 ALA ALA A . n A 1 124 SER 124 130 130 SER SER A . n A 1 125 LEU 125 131 131 LEU LEU A . n A 1 126 GLY 126 132 132 GLY GLY A . n A 1 127 ASN 127 133 133 ASN ASN A . n A 1 128 ASP 128 134 134 ASP ASP A . n A 1 129 ASP 129 135 135 ASP ASP A . n A 1 130 GLN 130 136 136 GLN GLN A . n A 1 131 GLY 131 137 137 GLY GLY A . n A 1 132 PHE 132 138 138 PHE PHE A . n A 1 133 TRP 133 139 139 TRP TRP A . n A 1 134 GLY 134 140 140 GLY GLY A . n A 1 135 MET 135 141 141 MET MET A . n A 1 136 SER 136 142 142 SER SER A . n A 1 137 ALA 137 143 143 ALA ALA A . n A 1 138 MET 138 144 144 MET MET A . n A 1 139 LEU 139 145 145 LEU LEU A . n A 1 140 ALA 140 146 146 ALA ALA A . n A 1 141 ALA 141 147 147 ALA ALA A . n A 1 142 GLU 142 148 148 GLU GLU A . n A 1 143 ASN 143 149 149 ASN ASN A . n A 1 144 LYS 144 150 150 LYS LYS A . n A 1 145 PHE 145 151 151 PHE PHE A . n A 1 146 PRO 146 152 152 PRO PRO A . n A 1 147 ASN 147 153 153 ASN ASN A . n A 1 148 PRO 148 154 154 PRO PRO A . n A 1 149 PRO 149 155 155 PRO PRO A . n A 1 150 ASP 150 156 156 ASP ASP A . n A 1 151 ASP 151 157 157 ASP ASP A . n A 1 152 LYS 152 158 158 LYS LYS A . n A 1 153 PRO 153 159 159 PRO PRO A . n A 1 154 GLN 154 160 160 GLN GLN A . n A 1 155 TRP 155 161 161 TRP TRP A . n A 1 156 LEU 156 162 162 LEU LEU A . n A 1 157 ALA 157 163 163 ALA ALA A . n A 1 158 LEU 158 164 164 LEU LEU A . n A 1 159 ALA 159 165 165 ALA ALA A . n A 1 160 GLN 160 166 166 GLN GLN A . n A 1 161 ALA 161 167 167 ALA ALA A . n A 1 162 VAL 162 168 168 VAL VAL A . n A 1 163 TRP 163 169 169 TRP TRP A . n A 1 164 THR 164 170 170 THR THR A . n A 1 165 THR 165 171 171 THR THR A . n A 1 166 GLN 166 172 172 GLN GLN A . n A 1 167 ALA 167 173 173 ALA ALA A . n A 1 168 SER 168 174 174 SER SER A . n A 1 169 PRO 169 175 175 PRO PRO A . n A 1 170 GLU 170 176 176 GLU GLU A . n A 1 171 ARG 171 177 177 ARG ARG A . n A 1 172 HIS 172 178 178 HIS HIS A . n A 1 173 ASP 173 179 179 ASP ASP A . n A 1 174 GLY 174 180 180 GLY GLY A . n A 1 175 THR 175 181 181 THR THR A . n A 1 176 CYS 176 182 182 CYS CYS A . n A 1 177 ASN 177 183 183 ASN ASN A . n A 1 178 GLY 178 184 184 GLY GLY A . n A 1 179 GLY 179 185 185 GLY GLY A . n A 1 180 LEU 180 186 186 LEU LEU A . n A 1 181 ARG 181 187 187 ARG ARG A . n A 1 182 TRP 182 188 188 TRP TRP A . n A 1 183 GLN 183 189 189 GLN GLN A . n A 1 184 ILE 184 190 190 ILE ILE A . n A 1 185 PRO 185 191 191 PRO PRO A . n A 1 186 PRO 186 192 192 PRO PRO A . n A 1 187 THR 187 193 193 THR THR A . n A 1 188 ASN 188 194 194 ASN ASN A . n A 1 189 ALA 189 195 195 ALA ALA A . n A 1 190 GLY 190 196 196 GLY GLY A . n A 1 191 TYR 191 197 197 TYR TYR A . n A 1 192 ASN 192 198 198 ASN ASN A . n A 1 193 TYR 193 199 199 TYR TYR A . n A 1 194 LYS 194 200 200 LYS LYS A . n A 1 195 ASN 195 201 201 ASN ASN A . n A 1 196 THR 196 202 202 THR THR A . n A 1 197 ILE 197 203 203 ILE ILE A . n A 1 198 ALA 198 204 204 ALA ALA A . n A 1 199 ASN 199 205 205 ASN ASN A . n A 1 200 ALA 200 206 206 ALA ALA A . n A 1 201 CYS 201 207 207 CYS CYS A . n A 1 202 PHE 202 208 208 PHE PHE A . n A 1 203 PHE 203 209 209 PHE PHE A . n A 1 204 ASP 204 210 210 ASP ASP A . n A 1 205 LEU 205 211 211 LEU LEU A . n A 1 206 GLY 206 212 212 GLY GLY A . n A 1 207 ALA 207 213 213 ALA ALA A . n A 1 208 ARG 208 214 214 ARG ARG A . n A 1 209 LEU 209 215 215 LEU LEU A . n A 1 210 ALA 210 216 216 ALA ALA A . n A 1 211 ARG 211 217 217 ARG ARG A . n A 1 212 TYR 212 218 218 TYR TYR A . n A 1 213 THR 213 219 219 THR THR A . n A 1 214 LYS 214 220 220 LYS LYS A . n A 1 215 ASN 215 221 221 ASN ASN A . n A 1 216 ASN 216 222 222 ASN ASN A . n A 1 217 THR 217 223 223 THR THR A . n A 1 218 TYR 218 224 224 TYR TYR A . n A 1 219 ALA 219 225 225 ALA ALA A . n A 1 220 GLU 220 226 226 GLU GLU A . n A 1 221 TRP 221 227 227 TRP TRP A . n A 1 222 ALA 222 228 228 ALA ALA A . n A 1 223 GLU 223 229 229 GLU GLU A . n A 1 224 LYS 224 230 230 LYS LYS A . n A 1 225 ILE 225 231 231 ILE ILE A . n A 1 226 PHE 226 232 232 PHE PHE A . n A 1 227 ASP 227 233 233 ASP ASP A . n A 1 228 TRP 228 234 234 TRP TRP A . n A 1 229 LEU 229 235 235 LEU LEU A . n A 1 230 TYR 230 236 236 TYR TYR A . n A 1 231 ALA 231 237 237 ALA ALA A . n A 1 232 VAL 232 238 238 VAL VAL A . n A 1 233 GLY 233 239 239 GLY GLY A . n A 1 234 TYR 234 240 240 TYR TYR A . n A 1 235 ILE 235 241 241 ILE ILE A . n A 1 236 ASP 236 242 242 ASP ASP A . n A 1 237 HIS 237 243 243 HIS HIS A . n A 1 238 GLU 238 244 244 GLU GLU A . n A 1 239 THR 239 245 245 THR THR A . n A 1 240 TRP 240 246 246 TRP TRP A . n A 1 241 ALA 241 247 247 ALA ALA A . n A 1 242 VAL 242 248 248 VAL VAL A . n A 1 243 TYR 243 249 249 TYR TYR A . n A 1 244 ASP 244 250 250 ASP ASP A . n A 1 245 GLY 245 251 251 GLY GLY A . n A 1 246 GLY 246 252 252 GLY GLY A . n A 1 247 HIS 247 253 253 HIS HIS A . n A 1 248 VAL 248 254 254 VAL VAL A . n A 1 249 GLU 249 255 255 GLU GLU A . n A 1 250 HIS 250 256 256 HIS HIS A . n A 1 251 ASN 251 257 257 ASN ASN A . n A 1 252 CYS 252 258 258 CYS CYS A . n A 1 253 THR 253 259 259 THR THR A . n A 1 254 ASP 254 260 260 ASP ASP A . n A 1 255 ILE 255 261 261 ILE ILE A . n A 1 256 ASN 256 262 262 ASN ASN A . n A 1 257 ARG 257 263 263 ARG ARG A . n A 1 258 ALA 258 264 264 ALA ALA A . n A 1 259 GLN 259 265 265 GLN GLN A . n A 1 260 PHE 260 266 266 PHE PHE A . n A 1 261 SER 261 267 267 SER SER A . n A 1 262 TYR 262 268 268 TYR TYR A . n A 1 263 ASN 263 269 269 ASN ASN A . n A 1 264 ALA 264 270 270 ALA ALA A . n A 1 265 ALA 265 271 271 ALA ALA A . n A 1 266 LEU 266 272 272 LEU LEU A . n A 1 267 LEU 267 273 273 LEU LEU A . n A 1 268 LEU 268 274 274 LEU LEU A . n A 1 269 HIS 269 275 275 HIS HIS A . n A 1 270 GLY 270 276 276 GLY GLY A . n A 1 271 ALA 271 277 277 ALA ALA A . n A 1 272 ALA 272 278 278 ALA ALA A . n A 1 273 PHE 273 279 279 PHE PHE A . n A 1 274 MET 274 280 280 MET MET A . n A 1 275 TRP 275 281 281 TRP TRP A . n A 1 276 ASN 276 282 282 ASN ASN A . n A 1 277 TYR 277 283 283 TYR TYR A . n A 1 278 THR 278 284 284 THR THR A . n A 1 279 GLU 279 285 285 GLU GLU A . n A 1 280 ASP 280 286 286 ASP ASP A . n A 1 281 GLN 281 287 287 GLN GLN A . n A 1 282 LYS 282 288 288 LYS LYS A . n A 1 283 TRP 283 289 289 TRP TRP A . n A 1 284 LYS 284 290 290 LYS LYS A . n A 1 285 ASP 285 291 291 ASP ASP A . n A 1 286 ARG 286 292 292 ARG ARG A . n A 1 287 VAL 287 293 293 VAL VAL A . n A 1 288 ASP 288 294 294 ASP ASP A . n A 1 289 ASN 289 295 295 ASN ASN A . n A 1 290 LEU 290 296 296 LEU LEU A . n A 1 291 LEU 291 297 297 LEU LEU A . n A 1 292 THR 292 298 298 THR THR A . n A 1 293 GLY 293 299 299 GLY GLY A . n A 1 294 ILE 294 300 300 ILE ILE A . n A 1 295 LEU 295 301 301 LEU LEU A . n A 1 296 ARG 296 302 302 ARG ARG A . n A 1 297 ASP 297 303 303 ASP ASP A . n A 1 298 PHE 298 304 304 PHE PHE A . n A 1 299 PHE 299 305 305 PHE PHE A . n A 1 300 LYS 300 306 306 LYS LYS A . n A 1 301 ASP 301 307 307 ASP ASP A . n A 1 302 GLY 302 308 308 GLY GLY A . n A 1 303 VAL 303 309 309 VAL VAL A . n A 1 304 VAL 304 310 310 VAL VAL A . n A 1 305 PHE 305 311 311 PHE PHE A . n A 1 306 GLU 306 312 312 GLU GLU A . n A 1 307 ILE 307 313 313 ILE ILE A . n A 1 308 PRO 308 314 314 PRO PRO A . n A 1 309 CYS 309 315 315 CYS CYS A . n A 1 310 GLU 310 316 316 GLU GLU A . n A 1 311 GLY 311 317 317 GLY GLY A . n A 1 312 ARG 312 318 318 ARG ARG A . n A 1 313 GLN 313 319 319 GLN GLN A . n A 1 314 GLY 314 320 320 GLY GLY A . n A 1 315 ALA 315 321 321 ALA ALA A . n A 1 316 CYS 316 322 322 CYS CYS A . n A 1 317 THR 317 323 323 THR THR A . n A 1 318 ALA 318 324 324 ALA ALA A . n A 1 319 ASP 319 325 325 ASP ASP A . n A 1 320 MET 320 326 326 MET MET A . n A 1 321 LEU 321 327 327 LEU LEU A . n A 1 322 THR 322 328 328 THR THR A . n A 1 323 PHE 323 329 329 PHE PHE A . n A 1 324 LYS 324 330 330 LYS LYS A . n A 1 325 GLY 325 331 331 GLY GLY A . n A 1 326 TYR 326 332 332 TYR TYR A . n A 1 327 VAL 327 333 333 VAL VAL A . n A 1 328 HIS 328 334 334 HIS HIS A . n A 1 329 ARG 329 335 335 ARG ARG A . n A 1 330 TRP 330 336 336 TRP TRP A . n A 1 331 MET 331 337 337 MET MET A . n A 1 332 ALA 332 338 338 ALA ALA A . n A 1 333 VAL 333 339 339 VAL VAL A . n A 1 334 VAL 334 340 340 VAL VAL A . n A 1 335 THR 335 341 341 THR THR A . n A 1 336 GLN 336 342 342 GLN GLN A . n A 1 337 ILE 337 343 343 ILE ILE A . n A 1 338 ALA 338 344 344 ALA ALA A . n A 1 339 PRO 339 345 345 PRO PRO A . n A 1 340 HIS 340 346 346 HIS HIS A . n A 1 341 THR 341 347 347 THR THR A . n A 1 342 LYS 342 348 348 LYS LYS A . n A 1 343 ASP 343 349 349 ASP ASP A . n A 1 344 ARG 344 350 350 ARG ARG A . n A 1 345 ILE 345 351 351 ILE ILE A . n A 1 346 LEU 346 352 352 LEU LEU A . n A 1 347 PRO 347 353 353 PRO PRO A . n A 1 348 VAL 348 354 354 VAL VAL A . n A 1 349 LEU 349 355 355 LEU LEU A . n A 1 350 ARG 350 356 356 ARG ARG A . n A 1 351 THR 351 357 357 THR THR A . n A 1 352 SER 352 358 358 SER SER A . n A 1 353 ALA 353 359 359 ALA ALA A . n A 1 354 GLU 354 360 360 GLU GLU A . n A 1 355 ALA 355 361 361 ALA ALA A . n A 1 356 ALA 356 362 362 ALA ALA A . n A 1 357 VAL 357 363 363 VAL VAL A . n A 1 358 LYS 358 364 364 LYS LYS A . n A 1 359 GLN 359 365 365 GLN GLN A . n A 1 360 CYS 360 366 366 CYS CYS A . n A 1 361 VAL 361 367 367 VAL VAL A . n A 1 362 GLY 362 368 368 GLY GLY A . n A 1 363 PRO 363 369 369 PRO PRO A . n A 1 364 PRO 364 370 370 PRO PRO A . n A 1 365 THR 365 371 371 THR THR A . n A 1 366 GLY 366 372 372 GLY GLY A . n A 1 367 ARG 367 373 373 ARG ARG A . n A 1 368 ARG 368 374 374 ARG ARG A . n A 1 369 CYS 369 375 375 CYS CYS A . n A 1 370 GLY 370 376 376 GLY GLY A . n A 1 371 PHE 371 377 377 PHE PHE A . n A 1 372 TYR 372 378 378 TYR TYR A . n A 1 373 TRP 373 379 379 TRP TRP A . n A 1 374 LYS 374 380 380 LYS LYS A . n A 1 375 SER 375 381 381 SER SER A . n A 1 376 GLY 376 382 382 GLY GLY A . n A 1 377 LYS 377 383 383 LYS LYS A . n A 1 378 PHE 378 384 384 PHE PHE A . n A 1 379 VAL 379 385 385 VAL VAL A . n A 1 380 ASP 380 386 386 ASP ASP A . n A 1 381 PRO 381 387 387 PRO PRO A . n A 1 382 SER 382 388 388 SER SER A . n A 1 383 VAL 383 389 389 VAL VAL A . n A 1 384 ASP 384 390 390 ASP ASP A . n A 1 385 HIS 385 391 391 HIS HIS A . n A 1 386 THR 386 392 392 THR THR A . n A 1 387 SER 387 393 393 SER SER A . n A 1 388 GLY 388 394 394 GLY GLY A . n A 1 389 ALA 389 395 395 ALA ALA A . n A 1 390 GLY 390 396 396 GLY GLY A . n A 1 391 GLU 391 397 397 GLU GLU A . n A 1 392 ALA 392 398 398 ALA ALA A . n A 1 393 MET 393 399 399 MET MET A . n A 1 394 SER 394 400 400 SER SER A . n A 1 395 VAL 395 401 401 VAL VAL A . n A 1 396 LEU 396 402 402 LEU LEU A . n A 1 397 ALA 397 403 403 ALA ALA A . n A 1 398 ALA 398 404 404 ALA ALA A . n A 1 399 VAL 399 405 405 VAL VAL A . n A 1 400 SER 400 406 406 SER SER A . n A 1 401 SER 401 407 407 SER SER A . n A 1 402 LEU 402 408 408 LEU LEU A . n A 1 403 LEU 403 409 409 LEU LEU A . n A 1 404 ILE 404 410 410 ILE ILE A . n A 1 405 GLU 405 411 411 GLU GLU A . n A 1 406 TYR 406 412 412 TYR TYR A . n A 1 407 ALA 407 413 413 ALA ALA A . n A 1 408 GLU 408 414 414 GLU GLU A . n A 1 409 PRO 409 415 415 PRO PRO A . n A 1 410 PRO 410 416 416 PRO PRO A . n A 1 411 ALA 411 417 417 ALA ALA A . n A 1 412 THR 412 418 418 THR THR A . n A 1 413 ASN 413 419 419 ASN ASN A . n A 1 414 GLU 414 420 420 GLU GLU A . n A 1 415 THR 415 421 421 THR THR A . n A 1 416 GLY 416 422 422 GLY GLY A . n A 1 417 ILE 417 423 423 ILE ILE A . n A 1 418 SER 418 424 424 SER SER A . n A 1 419 ARG 419 425 425 ARG ARG A . n A 1 420 GLY 420 426 426 GLY GLY A . n A 1 421 ASP 421 427 427 ASP ASP A . n A 1 422 PRO 422 428 428 PRO PRO A . n A 1 423 ASN 423 429 429 ASN ASN A . n A 1 424 ALA 424 430 430 ALA ALA A . n A 1 425 GLY 425 431 431 GLY GLY A . n A 1 426 MET 426 432 432 MET MET A . n A 1 427 ARG 427 433 433 ARG ARG A . n A 1 428 SER 428 434 434 SER SER A . n A 1 429 ARG 429 435 435 ARG ARG A . n A 1 430 GLY 430 436 436 GLY GLY A . n A 1 431 ALA 431 437 437 ALA ALA A . n A 1 432 ALA 432 438 438 ALA ALA A . n A 1 433 GLN 433 439 439 GLN GLN A . n A 1 434 HIS 434 440 440 HIS HIS A . n A 1 435 PHE 435 441 441 PHE PHE A . n A 1 436 ARG 436 442 ? ? ? A . n A 1 437 GLU 437 443 ? ? ? A . n A 1 438 ILE 438 444 ? ? ? A . n A 1 439 ASN 439 445 ? ? ? A . n A 1 440 ALA 440 446 ? ? ? A . n A 1 441 GLY 441 447 ? ? ? A . n A 1 442 ASP 442 448 ? ? ? A . n A 1 443 ARG 443 449 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 CA 1 501 1 CA CA A . D 3 CA 1 502 2 CA CA A . E 4 PGE 1 503 1 PGE PGE A . F 5 HOH 1 601 609 HOH HOH A . F 5 HOH 2 602 56 HOH HOH A . F 5 HOH 3 603 260 HOH HOH A . F 5 HOH 4 604 472 HOH HOH A . F 5 HOH 5 605 172 HOH HOH A . F 5 HOH 6 606 575 HOH HOH A . F 5 HOH 7 607 208 HOH HOH A . F 5 HOH 8 608 63 HOH HOH A . F 5 HOH 9 609 224 HOH HOH A . F 5 HOH 10 610 354 HOH HOH A . F 5 HOH 11 611 437 HOH HOH A . F 5 HOH 12 612 360 HOH HOH A . F 5 HOH 13 613 118 HOH HOH A . F 5 HOH 14 614 599 HOH HOH A . F 5 HOH 15 615 700 HOH HOH A . F 5 HOH 16 616 243 HOH HOH A . F 5 HOH 17 617 466 HOH HOH A . F 5 HOH 18 618 178 HOH HOH A . F 5 HOH 19 619 125 HOH HOH A . F 5 HOH 20 620 294 HOH HOH A . F 5 HOH 21 621 225 HOH HOH A . F 5 HOH 22 622 135 HOH HOH A . F 5 HOH 23 623 481 HOH HOH A . F 5 HOH 24 624 680 HOH HOH A . F 5 HOH 25 625 139 HOH HOH A . F 5 HOH 26 626 96 HOH HOH A . F 5 HOH 27 627 33 HOH HOH A . F 5 HOH 28 628 24 HOH HOH A . F 5 HOH 29 629 182 HOH HOH A . F 5 HOH 30 630 300 HOH HOH A . F 5 HOH 31 631 193 HOH HOH A . F 5 HOH 32 632 121 HOH HOH A . F 5 HOH 33 633 112 HOH HOH A . F 5 HOH 34 634 16 HOH HOH A . F 5 HOH 35 635 377 HOH HOH A . F 5 HOH 36 636 372 HOH HOH A . F 5 HOH 37 637 21 HOH HOH A . F 5 HOH 38 638 544 HOH HOH A . F 5 HOH 39 639 53 HOH HOH A . F 5 HOH 40 640 36 HOH HOH A . F 5 HOH 41 641 327 HOH HOH A . F 5 HOH 42 642 556 HOH HOH A . F 5 HOH 43 643 151 HOH HOH A . F 5 HOH 44 644 295 HOH HOH A . F 5 HOH 45 645 1 HOH HOH A . F 5 HOH 46 646 19 HOH HOH A . F 5 HOH 47 647 233 HOH HOH A . F 5 HOH 48 648 91 HOH HOH A . F 5 HOH 49 649 5 HOH HOH A . F 5 HOH 50 650 15 HOH HOH A . F 5 HOH 51 651 89 HOH HOH A . F 5 HOH 52 652 176 HOH HOH A . F 5 HOH 53 653 291 HOH HOH A . F 5 HOH 54 654 237 HOH HOH A . F 5 HOH 55 655 282 HOH HOH A . F 5 HOH 56 656 77 HOH HOH A . F 5 HOH 57 657 132 HOH HOH A . F 5 HOH 58 658 134 HOH HOH A . F 5 HOH 59 659 107 HOH HOH A . F 5 HOH 60 660 128 HOH HOH A . F 5 HOH 61 661 204 HOH HOH A . F 5 HOH 62 662 199 HOH HOH A . F 5 HOH 63 663 216 HOH HOH A . F 5 HOH 64 664 321 HOH HOH A . F 5 HOH 65 665 120 HOH HOH A . F 5 HOH 66 666 154 HOH HOH A . F 5 HOH 67 667 3 HOH HOH A . F 5 HOH 68 668 183 HOH HOH A . F 5 HOH 69 669 57 HOH HOH A . F 5 HOH 70 670 23 HOH HOH A . F 5 HOH 71 671 645 HOH HOH A . F 5 HOH 72 672 111 HOH HOH A . F 5 HOH 73 673 70 HOH HOH A . F 5 HOH 74 674 44 HOH HOH A . F 5 HOH 75 675 69 HOH HOH A . F 5 HOH 76 676 186 HOH HOH A . F 5 HOH 77 677 212 HOH HOH A . F 5 HOH 78 678 82 HOH HOH A . F 5 HOH 79 679 79 HOH HOH A . F 5 HOH 80 680 32 HOH HOH A . F 5 HOH 81 681 367 HOH HOH A . F 5 HOH 82 682 263 HOH HOH A . F 5 HOH 83 683 214 HOH HOH A . F 5 HOH 84 684 145 HOH HOH A . F 5 HOH 85 685 34 HOH HOH A . F 5 HOH 86 686 507 HOH HOH A . F 5 HOH 87 687 513 HOH HOH A . F 5 HOH 88 688 555 HOH HOH A . F 5 HOH 89 689 698 HOH HOH A . F 5 HOH 90 690 582 HOH HOH A . F 5 HOH 91 691 92 HOH HOH A . F 5 HOH 92 692 39 HOH HOH A . F 5 HOH 93 693 49 HOH HOH A . F 5 HOH 94 694 338 HOH HOH A . F 5 HOH 95 695 159 HOH HOH A . F 5 HOH 96 696 31 HOH HOH A . F 5 HOH 97 697 11 HOH HOH A . F 5 HOH 98 698 226 HOH HOH A . F 5 HOH 99 699 380 HOH HOH A . F 5 HOH 100 700 288 HOH HOH A . F 5 HOH 101 701 26 HOH HOH A . F 5 HOH 102 702 464 HOH HOH A . F 5 HOH 103 703 351 HOH HOH A . F 5 HOH 104 704 165 HOH HOH A . F 5 HOH 105 705 9 HOH HOH A . F 5 HOH 106 706 150 HOH HOH A . F 5 HOH 107 707 67 HOH HOH A . F 5 HOH 108 708 164 HOH HOH A . F 5 HOH 109 709 99 HOH HOH A . F 5 HOH 110 710 76 HOH HOH A . F 5 HOH 111 711 104 HOH HOH A . F 5 HOH 112 712 78 HOH HOH A . F 5 HOH 113 713 115 HOH HOH A . F 5 HOH 114 714 7 HOH HOH A . F 5 HOH 115 715 51 HOH HOH A . F 5 HOH 116 716 173 HOH HOH A . F 5 HOH 117 717 60 HOH HOH A . F 5 HOH 118 718 142 HOH HOH A . F 5 HOH 119 719 54 HOH HOH A . F 5 HOH 120 720 508 HOH HOH A . F 5 HOH 121 721 37 HOH HOH A . F 5 HOH 122 722 94 HOH HOH A . F 5 HOH 123 723 292 HOH HOH A . F 5 HOH 124 724 181 HOH HOH A . F 5 HOH 125 725 72 HOH HOH A . F 5 HOH 126 726 22 HOH HOH A . F 5 HOH 127 727 211 HOH HOH A . F 5 HOH 128 728 191 HOH HOH A . F 5 HOH 129 729 10 HOH HOH A . F 5 HOH 130 730 6 HOH HOH A . F 5 HOH 131 731 332 HOH HOH A . F 5 HOH 132 732 113 HOH HOH A . F 5 HOH 133 733 47 HOH HOH A . F 5 HOH 134 734 43 HOH HOH A . F 5 HOH 135 735 126 HOH HOH A . F 5 HOH 136 736 18 HOH HOH A . F 5 HOH 137 737 25 HOH HOH A . F 5 HOH 138 738 254 HOH HOH A . F 5 HOH 139 739 210 HOH HOH A . F 5 HOH 140 740 102 HOH HOH A . F 5 HOH 141 741 100 HOH HOH A . F 5 HOH 142 742 28 HOH HOH A . F 5 HOH 143 743 97 HOH HOH A . F 5 HOH 144 744 185 HOH HOH A . F 5 HOH 145 745 241 HOH HOH A . F 5 HOH 146 746 48 HOH HOH A . F 5 HOH 147 747 73 HOH HOH A . F 5 HOH 148 748 62 HOH HOH A . F 5 HOH 149 749 8 HOH HOH A . F 5 HOH 150 750 462 HOH HOH A . F 5 HOH 151 751 129 HOH HOH A . F 5 HOH 152 752 305 HOH HOH A . F 5 HOH 153 753 45 HOH HOH A . F 5 HOH 154 754 27 HOH HOH A . F 5 HOH 155 755 153 HOH HOH A . F 5 HOH 156 756 170 HOH HOH A . F 5 HOH 157 757 46 HOH HOH A . F 5 HOH 158 758 545 HOH HOH A . F 5 HOH 159 759 156 HOH HOH A . F 5 HOH 160 760 87 HOH HOH A . F 5 HOH 161 761 697 HOH HOH A . F 5 HOH 162 762 68 HOH HOH A . F 5 HOH 163 763 247 HOH HOH A . F 5 HOH 164 764 84 HOH HOH A . F 5 HOH 165 765 65 HOH HOH A . F 5 HOH 166 766 42 HOH HOH A . F 5 HOH 167 767 12 HOH HOH A . F 5 HOH 168 768 2 HOH HOH A . F 5 HOH 169 769 242 HOH HOH A . F 5 HOH 170 770 177 HOH HOH A . F 5 HOH 171 771 368 HOH HOH A . F 5 HOH 172 772 17 HOH HOH A . F 5 HOH 173 773 222 HOH HOH A . F 5 HOH 174 774 420 HOH HOH A . F 5 HOH 175 775 75 HOH HOH A . F 5 HOH 176 776 138 HOH HOH A . F 5 HOH 177 777 103 HOH HOH A . F 5 HOH 178 778 704 HOH HOH A . F 5 HOH 179 779 244 HOH HOH A . F 5 HOH 180 780 180 HOH HOH A . F 5 HOH 181 781 337 HOH HOH A . F 5 HOH 182 782 61 HOH HOH A . F 5 HOH 183 783 453 HOH HOH A . F 5 HOH 184 784 546 HOH HOH A . F 5 HOH 185 785 246 HOH HOH A . F 5 HOH 186 786 557 HOH HOH A . F 5 HOH 187 787 184 HOH HOH A . F 5 HOH 188 788 93 HOH HOH A . F 5 HOH 189 789 136 HOH HOH A . F 5 HOH 190 790 209 HOH HOH A . F 5 HOH 191 791 227 HOH HOH A . F 5 HOH 192 792 30 HOH HOH A . F 5 HOH 193 793 256 HOH HOH A . F 5 HOH 194 794 310 HOH HOH A . F 5 HOH 195 795 95 HOH HOH A . F 5 HOH 196 796 163 HOH HOH A . F 5 HOH 197 797 702 HOH HOH A . F 5 HOH 198 798 81 HOH HOH A . F 5 HOH 199 799 480 HOH HOH A . F 5 HOH 200 800 38 HOH HOH A . F 5 HOH 201 801 160 HOH HOH A . F 5 HOH 202 802 35 HOH HOH A . F 5 HOH 203 803 201 HOH HOH A . F 5 HOH 204 804 257 HOH HOH A . F 5 HOH 205 805 59 HOH HOH A . F 5 HOH 206 806 167 HOH HOH A . F 5 HOH 207 807 543 HOH HOH A . F 5 HOH 208 808 88 HOH HOH A . F 5 HOH 209 809 13 HOH HOH A . F 5 HOH 210 810 66 HOH HOH A . F 5 HOH 211 811 207 HOH HOH A . F 5 HOH 212 812 119 HOH HOH A . F 5 HOH 213 813 117 HOH HOH A . F 5 HOH 214 814 158 HOH HOH A . F 5 HOH 215 815 414 HOH HOH A . F 5 HOH 216 816 202 HOH HOH A . F 5 HOH 217 817 265 HOH HOH A . F 5 HOH 218 818 171 HOH HOH A . F 5 HOH 219 819 108 HOH HOH A . F 5 HOH 220 820 219 HOH HOH A . F 5 HOH 221 821 306 HOH HOH A . F 5 HOH 222 822 50 HOH HOH A . F 5 HOH 223 823 20 HOH HOH A . F 5 HOH 224 824 40 HOH HOH A . F 5 HOH 225 825 253 HOH HOH A . F 5 HOH 226 826 281 HOH HOH A . F 5 HOH 227 827 101 HOH HOH A . F 5 HOH 228 828 188 HOH HOH A . F 5 HOH 229 829 4 HOH HOH A . F 5 HOH 230 830 64 HOH HOH A . F 5 HOH 231 831 487 HOH HOH A . F 5 HOH 232 832 631 HOH HOH A . F 5 HOH 233 833 217 HOH HOH A . F 5 HOH 234 834 315 HOH HOH A . F 5 HOH 235 835 562 HOH HOH A . F 5 HOH 236 836 636 HOH HOH A . F 5 HOH 237 837 228 HOH HOH A . F 5 HOH 238 838 90 HOH HOH A . F 5 HOH 239 839 220 HOH HOH A . F 5 HOH 240 840 262 HOH HOH A . F 5 HOH 241 841 58 HOH HOH A . F 5 HOH 242 842 189 HOH HOH A . F 5 HOH 243 843 146 HOH HOH A . F 5 HOH 244 844 190 HOH HOH A . F 5 HOH 245 845 540 HOH HOH A . F 5 HOH 246 846 123 HOH HOH A . F 5 HOH 247 847 175 HOH HOH A . F 5 HOH 248 848 106 HOH HOH A . F 5 HOH 249 849 198 HOH HOH A . F 5 HOH 250 850 80 HOH HOH A . F 5 HOH 251 851 355 HOH HOH A . F 5 HOH 252 852 166 HOH HOH A . F 5 HOH 253 853 143 HOH HOH A . F 5 HOH 254 854 131 HOH HOH A . F 5 HOH 255 855 229 HOH HOH A . F 5 HOH 256 856 55 HOH HOH A . F 5 HOH 257 857 578 HOH HOH A . F 5 HOH 258 858 223 HOH HOH A . F 5 HOH 259 859 140 HOH HOH A . F 5 HOH 260 860 192 HOH HOH A . F 5 HOH 261 861 86 HOH HOH A . F 5 HOH 262 862 488 HOH HOH A . F 5 HOH 263 863 137 HOH HOH A . F 5 HOH 264 864 363 HOH HOH A . F 5 HOH 265 865 14 HOH HOH A . F 5 HOH 266 866 554 HOH HOH A . F 5 HOH 267 867 127 HOH HOH A . F 5 HOH 268 868 593 HOH HOH A . F 5 HOH 269 869 617 HOH HOH A . F 5 HOH 270 870 85 HOH HOH A . F 5 HOH 271 871 52 HOH HOH A . F 5 HOH 272 872 293 HOH HOH A . F 5 HOH 273 873 187 HOH HOH A . F 5 HOH 274 874 148 HOH HOH A . F 5 HOH 275 875 161 HOH HOH A . F 5 HOH 276 876 215 HOH HOH A . F 5 HOH 277 877 340 HOH HOH A . F 5 HOH 278 878 196 HOH HOH A . F 5 HOH 279 879 699 HOH HOH A . F 5 HOH 280 880 114 HOH HOH A . F 5 HOH 281 881 344 HOH HOH A . F 5 HOH 282 882 41 HOH HOH A . F 5 HOH 283 883 482 HOH HOH A . F 5 HOH 284 884 269 HOH HOH A . F 5 HOH 285 885 696 HOH HOH A . F 5 HOH 286 886 98 HOH HOH A . F 5 HOH 287 887 110 HOH HOH A . F 5 HOH 288 888 703 HOH HOH A . F 5 HOH 289 889 105 HOH HOH A . F 5 HOH 290 890 124 HOH HOH A . F 5 HOH 291 891 259 HOH HOH A . F 5 HOH 292 892 203 HOH HOH A . F 5 HOH 293 893 371 HOH HOH A . F 5 HOH 294 894 290 HOH HOH A . F 5 HOH 295 895 357 HOH HOH A . F 5 HOH 296 896 200 HOH HOH A . F 5 HOH 297 897 610 HOH HOH A . F 5 HOH 298 898 179 HOH HOH A . F 5 HOH 299 899 373 HOH HOH A . F 5 HOH 300 900 550 HOH HOH A . F 5 HOH 301 901 152 HOH HOH A . F 5 HOH 302 902 169 HOH HOH A . F 5 HOH 303 903 280 HOH HOH A . F 5 HOH 304 904 561 HOH HOH A . F 5 HOH 305 905 705 HOH HOH A . F 5 HOH 306 906 624 HOH HOH A . F 5 HOH 307 907 221 HOH HOH A . F 5 HOH 308 908 378 HOH HOH A . F 5 HOH 309 909 479 HOH HOH A . F 5 HOH 310 910 71 HOH HOH A . F 5 HOH 311 911 339 HOH HOH A . F 5 HOH 312 912 235 HOH HOH A . F 5 HOH 313 913 298 HOH HOH A . F 5 HOH 314 914 245 HOH HOH A . F 5 HOH 315 915 388 HOH HOH A . F 5 HOH 316 916 326 HOH HOH A . F 5 HOH 317 917 238 HOH HOH A . F 5 HOH 318 918 236 HOH HOH A . F 5 HOH 319 919 701 HOH HOH A . F 5 HOH 320 920 266 HOH HOH A . F 5 HOH 321 921 29 HOH HOH A . F 5 HOH 322 922 572 HOH HOH A . F 5 HOH 323 923 109 HOH HOH A . F 5 HOH 324 924 122 HOH HOH A . F 5 HOH 325 925 463 HOH HOH A . F 5 HOH 326 926 116 HOH HOH A . F 5 HOH 327 927 604 HOH HOH A . F 5 HOH 328 928 484 HOH HOH A . F 5 HOH 329 929 405 HOH HOH A . F 5 HOH 330 930 622 HOH HOH A . F 5 HOH 331 931 230 HOH HOH A . F 5 HOH 332 932 270 HOH HOH A . F 5 HOH 333 933 638 HOH HOH A . F 5 HOH 334 934 162 HOH HOH A . F 5 HOH 335 935 194 HOH HOH A . F 5 HOH 336 936 133 HOH HOH A . F 5 HOH 337 937 489 HOH HOH A . F 5 HOH 338 938 264 HOH HOH A . F 5 HOH 339 939 457 HOH HOH A . F 5 HOH 340 940 255 HOH HOH A . F 5 HOH 341 941 240 HOH HOH A . F 5 HOH 342 942 155 HOH HOH A . F 5 HOH 343 943 450 HOH HOH A . F 5 HOH 344 944 362 HOH HOH A . F 5 HOH 345 945 524 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1210 ? 1 MORE -10 ? 1 'SSA (A^2)' 15470 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD1 ? A ASP 73 ? A ASP 79 ? 1_555 CA ? C CA . ? A CA 501 ? 1_555 OE1 ? A GLU 279 ? A GLU 285 ? 1_555 49.0 ? 2 OD1 ? A ASP 73 ? A ASP 79 ? 1_555 CA ? C CA . ? A CA 501 ? 1_555 OE2 ? A GLU 279 ? A GLU 285 ? 1_555 50.0 ? 3 OE1 ? A GLU 279 ? A GLU 285 ? 1_555 CA ? C CA . ? A CA 501 ? 1_555 OE2 ? A GLU 279 ? A GLU 285 ? 1_555 2.5 ? 4 OD1 ? A ASP 73 ? A ASP 79 ? 1_555 CA ? C CA . ? A CA 501 ? 1_555 O ? A HIS 385 ? A HIS 391 ? 1_555 87.8 ? 5 OE1 ? A GLU 279 ? A GLU 285 ? 1_555 CA ? C CA . ? A CA 501 ? 1_555 O ? A HIS 385 ? A HIS 391 ? 1_555 62.6 ? 6 OE2 ? A GLU 279 ? A GLU 285 ? 1_555 CA ? C CA . ? A CA 501 ? 1_555 O ? A HIS 385 ? A HIS 391 ? 1_555 60.1 ? 7 OD1 ? A ASP 73 ? A ASP 79 ? 1_555 CA ? C CA . ? A CA 501 ? 1_555 O ? F HOH . ? A HOH 645 ? 1_555 92.1 ? 8 OE1 ? A GLU 279 ? A GLU 285 ? 1_555 CA ? C CA . ? A CA 501 ? 1_555 O ? F HOH . ? A HOH 645 ? 1_555 45.4 ? 9 OE2 ? A GLU 279 ? A GLU 285 ? 1_555 CA ? C CA . ? A CA 501 ? 1_555 O ? F HOH . ? A HOH 645 ? 1_555 45.4 ? 10 O ? A HIS 385 ? A HIS 391 ? 1_555 CA ? C CA . ? A CA 501 ? 1_555 O ? F HOH . ? A HOH 645 ? 1_555 70.3 ? 11 OD1 ? A ASP 73 ? A ASP 79 ? 1_555 CA ? C CA . ? A CA 501 ? 1_555 O ? F HOH . ? A HOH 857 ? 1_555 82.5 ? 12 OE1 ? A GLU 279 ? A GLU 285 ? 1_555 CA ? C CA . ? A CA 501 ? 1_555 O ? F HOH . ? A HOH 857 ? 1_555 118.0 ? 13 OE2 ? A GLU 279 ? A GLU 285 ? 1_555 CA ? C CA . ? A CA 501 ? 1_555 O ? F HOH . ? A HOH 857 ? 1_555 116.9 ? 14 O ? A HIS 385 ? A HIS 391 ? 1_555 CA ? C CA . ? A CA 501 ? 1_555 O ? F HOH . ? A HOH 857 ? 1_555 83.0 ? 15 O ? F HOH . ? A HOH 645 ? 1_555 CA ? C CA . ? A CA 501 ? 1_555 O ? F HOH . ? A HOH 857 ? 1_555 152.9 ? 16 OD1 ? A ASP 73 ? A ASP 79 ? 1_555 CA ? C CA . ? A CA 501 ? 1_555 O ? F HOH . ? A HOH 881 ? 1_555 81.5 ? 17 OE1 ? A GLU 279 ? A GLU 285 ? 1_555 CA ? C CA . ? A CA 501 ? 1_555 O ? F HOH . ? A HOH 881 ? 1_555 75.3 ? 18 OE2 ? A GLU 279 ? A GLU 285 ? 1_555 CA ? C CA . ? A CA 501 ? 1_555 O ? F HOH . ? A HOH 881 ? 1_555 77.6 ? 19 O ? A HIS 385 ? A HIS 391 ? 1_555 CA ? C CA . ? A CA 501 ? 1_555 O ? F HOH . ? A HOH 881 ? 1_555 131.6 ? 20 O ? F HOH . ? A HOH 645 ? 1_555 CA ? C CA . ? A CA 501 ? 1_555 O ? F HOH . ? A HOH 881 ? 1_555 63.2 ? 21 O ? F HOH . ? A HOH 857 ? 1_555 CA ? C CA . ? A CA 501 ? 1_555 O ? F HOH . ? A HOH 881 ? 1_555 140.8 ? 22 OD1 ? A ASP 129 ? A ASP 135 ? 1_555 CA ? D CA . ? A CA 502 ? 1_555 OD2 ? A ASP 129 ? A ASP 135 ? 1_555 51.0 ? 23 OD1 ? A ASP 129 ? A ASP 135 ? 1_555 CA ? D CA . ? A CA 502 ? 1_555 O ? F HOH . ? A HOH 677 ? 1_555 71.0 ? 24 OD2 ? A ASP 129 ? A ASP 135 ? 1_555 CA ? D CA . ? A CA 502 ? 1_555 O ? F HOH . ? A HOH 677 ? 1_555 120.6 ? 25 OD1 ? A ASP 129 ? A ASP 135 ? 1_555 CA ? D CA . ? A CA 502 ? 1_555 O ? F HOH . ? A HOH 784 ? 1_555 120.5 ? 26 OD2 ? A ASP 129 ? A ASP 135 ? 1_555 CA ? D CA . ? A CA 502 ? 1_555 O ? F HOH . ? A HOH 784 ? 1_555 79.8 ? 27 O ? F HOH . ? A HOH 677 ? 1_555 CA ? D CA . ? A CA 502 ? 1_555 O ? F HOH . ? A HOH 784 ? 1_555 151.6 ? 28 OD1 ? A ASP 129 ? A ASP 135 ? 1_555 CA ? D CA . ? A CA 502 ? 1_555 O ? F HOH . ? A HOH 885 ? 1_555 87.4 ? 29 OD2 ? A ASP 129 ? A ASP 135 ? 1_555 CA ? D CA . ? A CA 502 ? 1_555 O ? F HOH . ? A HOH 885 ? 1_555 106.8 ? 30 O ? F HOH . ? A HOH 677 ? 1_555 CA ? D CA . ? A CA 502 ? 1_555 O ? F HOH . ? A HOH 885 ? 1_555 79.2 ? 31 O ? F HOH . ? A HOH 784 ? 1_555 CA ? D CA . ? A CA 502 ? 1_555 O ? F HOH . ? A HOH 885 ? 1_555 75.8 ? 32 OD1 ? A ASP 129 ? A ASP 135 ? 1_555 CA ? D CA . ? A CA 502 ? 1_555 O ? F HOH . ? A HOH 894 ? 1_555 151.9 ? 33 OD2 ? A ASP 129 ? A ASP 135 ? 1_555 CA ? D CA . ? A CA 502 ? 1_555 O ? F HOH . ? A HOH 894 ? 1_555 157.0 ? 34 O ? F HOH . ? A HOH 677 ? 1_555 CA ? D CA . ? A CA 502 ? 1_555 O ? F HOH . ? A HOH 894 ? 1_555 81.9 ? 35 O ? F HOH . ? A HOH 784 ? 1_555 CA ? D CA . ? A CA 502 ? 1_555 O ? F HOH . ? A HOH 894 ? 1_555 80.8 ? 36 O ? F HOH . ? A HOH 885 ? 1_555 CA ? D CA . ? A CA 502 ? 1_555 O ? F HOH . ? A HOH 894 ? 1_555 80.1 ? 37 OD1 ? A ASP 129 ? A ASP 135 ? 1_555 CA ? D CA . ? A CA 502 ? 1_555 O2 ? B BMA . ? B BMA 1 ? 1_555 81.1 ? 38 OD2 ? A ASP 129 ? A ASP 135 ? 1_555 CA ? D CA . ? A CA 502 ? 1_555 O2 ? B BMA . ? B BMA 1 ? 1_555 80.6 ? 39 O ? F HOH . ? A HOH 677 ? 1_555 CA ? D CA . ? A CA 502 ? 1_555 O2 ? B BMA . ? B BMA 1 ? 1_555 79.0 ? 40 O ? F HOH . ? A HOH 784 ? 1_555 CA ? D CA . ? A CA 502 ? 1_555 O2 ? B BMA . ? B BMA 1 ? 1_555 126.5 ? 41 O ? F HOH . ? A HOH 885 ? 1_555 CA ? D CA . ? A CA 502 ? 1_555 O2 ? B BMA . ? B BMA 1 ? 1_555 157.7 ? 42 O ? F HOH . ? A HOH 894 ? 1_555 CA ? D CA . ? A CA 502 ? 1_555 O2 ? B BMA . ? B BMA 1 ? 1_555 101.4 ? 43 OD1 ? A ASP 129 ? A ASP 135 ? 1_555 CA ? D CA . ? A CA 502 ? 1_555 O1 ? B BMA . ? B BMA 1 ? 1_555 124.0 ? 44 OD2 ? A ASP 129 ? A ASP 135 ? 1_555 CA ? D CA . ? A CA 502 ? 1_555 O1 ? B BMA . ? B BMA 1 ? 1_555 81.1 ? 45 O ? F HOH . ? A HOH 677 ? 1_555 CA ? D CA . ? A CA 502 ? 1_555 O1 ? B BMA . ? B BMA 1 ? 1_555 131.8 ? 46 O ? F HOH . ? A HOH 784 ? 1_555 CA ? D CA . ? A CA 502 ? 1_555 O1 ? B BMA . ? B BMA 1 ? 1_555 66.4 ? 47 O ? F HOH . ? A HOH 885 ? 1_555 CA ? D CA . ? A CA 502 ? 1_555 O1 ? B BMA . ? B BMA 1 ? 1_555 139.4 ? 48 O ? F HOH . ? A HOH 894 ? 1_555 CA ? D CA . ? A CA 502 ? 1_555 O1 ? B BMA . ? B BMA 1 ? 1_555 79.9 ? 49 O2 ? B BMA . ? B BMA 1 ? 1_555 CA ? D CA . ? A CA 502 ? 1_555 O1 ? B BMA . ? B BMA 1 ? 1_555 61.6 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-08-12 2 'Structure model' 1 1 2020-08-26 3 'Structure model' 1 2 2020-09-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 3 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.year' 7 3 'Structure model' '_citation.country' 8 3 'Structure model' '_citation.journal_abbrev' 9 3 'Structure model' '_citation.journal_id_ASTM' 10 3 'Structure model' '_citation.journal_id_CSD' 11 3 'Structure model' '_citation.journal_id_ISSN' 12 3 'Structure model' '_citation.journal_volume' 13 3 'Structure model' '_citation.page_first' 14 3 'Structure model' '_citation.page_last' 15 3 'Structure model' '_citation.pdbx_database_id_DOI' 16 3 'Structure model' '_citation.pdbx_database_id_PubMed' 17 3 'Structure model' '_citation.title' 18 3 'Structure model' '_citation.year' 19 3 'Structure model' '_citation_author.name' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.9_1692 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _pdbx_entry_details.entry_id 6RY5 _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A HOH 686 ? ? O A HOH 836 ? ? 2.12 2 1 O A HOH 610 ? ? O A HOH 794 ? ? 2.16 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ILE A 36 ? ? -140.86 29.16 2 1 ASP A 121 ? ? -140.90 11.83 # loop_ _pdbx_distant_solvent_atoms.id _pdbx_distant_solvent_atoms.PDB_model_num _pdbx_distant_solvent_atoms.auth_atom_id _pdbx_distant_solvent_atoms.label_alt_id _pdbx_distant_solvent_atoms.auth_asym_id _pdbx_distant_solvent_atoms.auth_comp_id _pdbx_distant_solvent_atoms.auth_seq_id _pdbx_distant_solvent_atoms.PDB_ins_code _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance _pdbx_distant_solvent_atoms.neighbor_ligand_distance 1 1 O ? A HOH 944 ? 6.90 . 2 1 O ? A HOH 945 ? 7.04 . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 7 ? A MET 1 2 1 Y 1 A GLY 8 ? A GLY 2 3 1 Y 1 A SER 9 ? A SER 3 4 1 Y 1 A SER 10 ? A SER 4 5 1 Y 1 A HIS 11 ? A HIS 5 6 1 Y 1 A HIS 12 ? A HIS 6 7 1 Y 1 A HIS 13 ? A HIS 7 8 1 Y 1 A HIS 14 ? A HIS 8 9 1 Y 1 A HIS 15 ? A HIS 9 10 1 Y 1 A HIS 16 ? A HIS 10 11 1 Y 1 A SER 17 ? A SER 11 12 1 Y 1 A SER 18 ? A SER 12 13 1 Y 1 A GLY 19 ? A GLY 13 14 1 Y 1 A LEU 20 ? A LEU 14 15 1 Y 1 A VAL 21 ? A VAL 15 16 1 Y 1 A PRO 22 ? A PRO 16 17 1 Y 1 A ARG 23 ? A ARG 17 18 1 Y 1 A GLY 24 ? A GLY 18 19 1 Y 1 A SER 25 ? A SER 19 20 1 Y 1 A HIS 26 ? A HIS 20 21 1 Y 1 A MET 27 ? A MET 21 22 1 Y 1 A ALA 28 ? A ALA 22 23 1 Y 1 A SER 29 ? A SER 23 24 1 Y 1 A GLN 30 ? A GLN 24 25 1 Y 1 A GLN 31 ? A GLN 25 26 1 Y 1 A ARG 442 ? A ARG 436 27 1 Y 1 A GLU 443 ? A GLU 437 28 1 Y 1 A ILE 444 ? A ILE 438 29 1 Y 1 A ASN 445 ? A ASN 439 30 1 Y 1 A ALA 446 ? A ALA 440 31 1 Y 1 A GLY 447 ? A GLY 441 32 1 Y 1 A ASP 448 ? A ASP 442 33 1 Y 1 A ARG 449 ? A ARG 443 # _pdbx_audit_support.funding_organization 'German Research Foundation' _pdbx_audit_support.country Germany _pdbx_audit_support.grant_number SFB987 _pdbx_audit_support.ordinal 1 # loop_ _pdbx_branch_scheme.asym_id _pdbx_branch_scheme.entity_id _pdbx_branch_scheme.mon_id _pdbx_branch_scheme.num _pdbx_branch_scheme.pdb_asym_id _pdbx_branch_scheme.pdb_mon_id _pdbx_branch_scheme.pdb_seq_num _pdbx_branch_scheme.auth_asym_id _pdbx_branch_scheme.auth_mon_id _pdbx_branch_scheme.auth_seq_num _pdbx_branch_scheme.hetero B 2 BMA 1 B BMA 1 B BMA 1 n B 2 MAN 2 B MAN 2 B MAN 501 n # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier BMA 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DManpb BMA 'COMMON NAME' GMML 1.0 b-D-mannopyranose BMA 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 b-D-Manp BMA 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 Man MAN 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DManpa MAN 'COMMON NAME' GMML 1.0 a-D-mannopyranose MAN 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 a-D-Manp MAN 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 Man # _pdbx_entity_branch.entity_id 2 _pdbx_entity_branch.type oligosaccharide # loop_ _pdbx_entity_branch_descriptor.ordinal _pdbx_entity_branch_descriptor.entity_id _pdbx_entity_branch_descriptor.descriptor _pdbx_entity_branch_descriptor.type _pdbx_entity_branch_descriptor.program _pdbx_entity_branch_descriptor.program_version 1 2 DManpa1-6DManpb1-ROH 'Glycam Condensed Sequence' GMML 1.0 2 2 'WURCS=2.0/2,2,1/[a1122h-1b_1-5][a1122h-1a_1-5]/1-2/a6-b1' WURCS PDB2Glycan 1.1.0 3 2 '[][b-D-Manp]{[(6+1)][a-D-Manp]{}}' LINUCS PDB-CARE ? # _pdbx_entity_branch_link.link_id 1 _pdbx_entity_branch_link.entity_id 2 _pdbx_entity_branch_link.entity_branch_list_num_1 2 _pdbx_entity_branch_link.comp_id_1 MAN _pdbx_entity_branch_link.atom_id_1 C1 _pdbx_entity_branch_link.leaving_atom_id_1 O1 _pdbx_entity_branch_link.entity_branch_list_num_2 1 _pdbx_entity_branch_link.comp_id_2 BMA _pdbx_entity_branch_link.atom_id_2 O6 _pdbx_entity_branch_link.leaving_atom_id_2 HO6 _pdbx_entity_branch_link.value_order sing _pdbx_entity_branch_link.details ? # loop_ _pdbx_entity_branch_list.entity_id _pdbx_entity_branch_list.comp_id _pdbx_entity_branch_list.num _pdbx_entity_branch_list.hetero 2 BMA 1 n 2 MAN 2 n # loop_ _pdbx_entity_instance_feature.ordinal _pdbx_entity_instance_feature.comp_id _pdbx_entity_instance_feature.asym_id _pdbx_entity_instance_feature.seq_num _pdbx_entity_instance_feature.auth_comp_id _pdbx_entity_instance_feature.auth_asym_id _pdbx_entity_instance_feature.auth_seq_num _pdbx_entity_instance_feature.feature_type _pdbx_entity_instance_feature.details 1 BMA ? ? BMA ? ? 'SUBJECT OF INVESTIGATION' ? 2 MAN ? ? MAN ? ? 'SUBJECT OF INVESTIGATION' ? 3 BMA ? ? BMA ? ? 'SUBJECT OF INVESTIGATION' ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 'CALCIUM ION' CA 4 'TRIETHYLENE GLYCOL' PGE 5 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #