data_6SJT # _entry.id 6SJT # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.330 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 6SJT WWPDB D_1292103853 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6SJT _pdbx_database_status.recvd_initial_deposition_date 2019-08-13 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible N _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Portlock, T.J.' 1 ? 'Rehman, S.' 2 ? 'Garnett, J.A.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country CH _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Front Mol Biosci' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2296-889X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 7 _citation.language ? _citation.page_first 112 _citation.page_last 112 _citation.title 'Structure, Dynamics and Cellular Insight Into Novel Substrates of theLegionella pneumophilaType II Secretion System.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.3389/fmolb.2020.00112 _citation.pdbx_database_id_PubMed 32656228 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Portlock, T.J.' 1 ? primary 'Tyson, J.Y.' 2 ? primary 'Dantu, S.C.' 3 ? primary 'Rehman, S.' 4 ? primary 'White, R.C.' 5 ? primary 'McIntire, I.E.' 6 ? primary 'Sewell, L.' 7 ? primary 'Richardson, K.' 8 ? primary 'Shaw, R.' 9 ? primary 'Pandini, A.' 10 ? primary 'Cianciotto, N.P.' 11 ? primary 'Garnett, J.A.' 12 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 6SJT _cell.details ? _cell.formula_units_Z ? _cell.length_a 84.390 _cell.length_a_esd ? _cell.length_b 84.390 _cell.length_b_esd ? _cell.length_c 151.660 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 24 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6SJT _symmetry.cell_setting ? _symmetry.Int_Tables_number 180 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 62 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man NttC 13617.553 2 ? ? ? ? 2 water nat water 18.015 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)AHHHHHHVDDDDK(MSE)APAYLTTHNRTGEESNAYIAGSIPSLYPTAAYSTNQVYWNLVRLACYGHTTNGQCPA LIK(MSE)ATNTANPIDIGYVT(MSE)DLNTGDITPKTLSAKGYSLRVIGPGEAEITKN ; _entity_poly.pdbx_seq_one_letter_code_can ;MAHHHHHHVDDDDKMAPAYLTTHNRTGEESNAYIAGSIPSLYPTAAYSTNQVYWNLVRLACYGHTTNGQCPALIKMATNT ANPIDIGYVTMDLNTGDITPKTLSAKGYSLRVIGPGEAEITKN ; _entity_poly.pdbx_strand_id AAA,BBB _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 ALA n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 VAL n 1 10 ASP n 1 11 ASP n 1 12 ASP n 1 13 ASP n 1 14 LYS n 1 15 MSE n 1 16 ALA n 1 17 PRO n 1 18 ALA n 1 19 TYR n 1 20 LEU n 1 21 THR n 1 22 THR n 1 23 HIS n 1 24 ASN n 1 25 ARG n 1 26 THR n 1 27 GLY n 1 28 GLU n 1 29 GLU n 1 30 SER n 1 31 ASN n 1 32 ALA n 1 33 TYR n 1 34 ILE n 1 35 ALA n 1 36 GLY n 1 37 SER n 1 38 ILE n 1 39 PRO n 1 40 SER n 1 41 LEU n 1 42 TYR n 1 43 PRO n 1 44 THR n 1 45 ALA n 1 46 ALA n 1 47 TYR n 1 48 SER n 1 49 THR n 1 50 ASN n 1 51 GLN n 1 52 VAL n 1 53 TYR n 1 54 TRP n 1 55 ASN n 1 56 LEU n 1 57 VAL n 1 58 ARG n 1 59 LEU n 1 60 ALA n 1 61 CYS n 1 62 TYR n 1 63 GLY n 1 64 HIS n 1 65 THR n 1 66 THR n 1 67 ASN n 1 68 GLY n 1 69 GLN n 1 70 CYS n 1 71 PRO n 1 72 ALA n 1 73 LEU n 1 74 ILE n 1 75 LYS n 1 76 MSE n 1 77 ALA n 1 78 THR n 1 79 ASN n 1 80 THR n 1 81 ALA n 1 82 ASN n 1 83 PRO n 1 84 ILE n 1 85 ASP n 1 86 ILE n 1 87 GLY n 1 88 TYR n 1 89 VAL n 1 90 THR n 1 91 MSE n 1 92 ASP n 1 93 LEU n 1 94 ASN n 1 95 THR n 1 96 GLY n 1 97 ASP n 1 98 ILE n 1 99 THR n 1 100 PRO n 1 101 LYS n 1 102 THR n 1 103 LEU n 1 104 SER n 1 105 ALA n 1 106 LYS n 1 107 GLY n 1 108 TYR n 1 109 SER n 1 110 LEU n 1 111 ARG n 1 112 VAL n 1 113 ILE n 1 114 GLY n 1 115 PRO n 1 116 GLY n 1 117 GLU n 1 118 ALA n 1 119 GLU n 1 120 ILE n 1 121 THR n 1 122 LYS n 1 123 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 123 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene lpw18401 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Legionella pneumophila 130b' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 866628 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A0C9MKT2_LEGPN _struct_ref.pdbx_db_accession A0A0C9MKT2 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;APAYLTTHNRTGEESNAYIAGSIPSLYPTAAYSTNQVYWNLVRLACYGHTTNGQCPALIKMATNTANPIDIGYVTMDLNT GDITPKTLSAKGYSLRVIGPGEAEITKN ; _struct_ref.pdbx_align_begin 23 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 6SJT AAA 16 ? 123 ? A0A0C9MKT2 23 ? 130 ? 1 108 2 1 6SJT BBB 16 ? 123 ? A0A0C9MKT2 23 ? 130 ? 1 108 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6SJT MSE AAA 1 ? UNP A0A0C9MKT2 ? ? 'initiating methionine' -14 1 1 6SJT ALA AAA 2 ? UNP A0A0C9MKT2 ? ? 'expression tag' -13 2 1 6SJT HIS AAA 3 ? UNP A0A0C9MKT2 ? ? 'expression tag' -12 3 1 6SJT HIS AAA 4 ? UNP A0A0C9MKT2 ? ? 'expression tag' -11 4 1 6SJT HIS AAA 5 ? UNP A0A0C9MKT2 ? ? 'expression tag' -10 5 1 6SJT HIS AAA 6 ? UNP A0A0C9MKT2 ? ? 'expression tag' -9 6 1 6SJT HIS AAA 7 ? UNP A0A0C9MKT2 ? ? 'expression tag' -8 7 1 6SJT HIS AAA 8 ? UNP A0A0C9MKT2 ? ? 'expression tag' -7 8 1 6SJT VAL AAA 9 ? UNP A0A0C9MKT2 ? ? 'expression tag' -6 9 1 6SJT ASP AAA 10 ? UNP A0A0C9MKT2 ? ? 'expression tag' -5 10 1 6SJT ASP AAA 11 ? UNP A0A0C9MKT2 ? ? 'expression tag' -4 11 1 6SJT ASP AAA 12 ? UNP A0A0C9MKT2 ? ? 'expression tag' -3 12 1 6SJT ASP AAA 13 ? UNP A0A0C9MKT2 ? ? 'expression tag' -2 13 1 6SJT LYS AAA 14 ? UNP A0A0C9MKT2 ? ? 'expression tag' -1 14 1 6SJT MSE AAA 15 ? UNP A0A0C9MKT2 ? ? 'expression tag' 0 15 2 6SJT MSE BBB 1 ? UNP A0A0C9MKT2 ? ? 'initiating methionine' -14 16 2 6SJT ALA BBB 2 ? UNP A0A0C9MKT2 ? ? 'expression tag' -13 17 2 6SJT HIS BBB 3 ? UNP A0A0C9MKT2 ? ? 'expression tag' -12 18 2 6SJT HIS BBB 4 ? UNP A0A0C9MKT2 ? ? 'expression tag' -11 19 2 6SJT HIS BBB 5 ? UNP A0A0C9MKT2 ? ? 'expression tag' -10 20 2 6SJT HIS BBB 6 ? UNP A0A0C9MKT2 ? ? 'expression tag' -9 21 2 6SJT HIS BBB 7 ? UNP A0A0C9MKT2 ? ? 'expression tag' -8 22 2 6SJT HIS BBB 8 ? UNP A0A0C9MKT2 ? ? 'expression tag' -7 23 2 6SJT VAL BBB 9 ? UNP A0A0C9MKT2 ? ? 'expression tag' -6 24 2 6SJT ASP BBB 10 ? UNP A0A0C9MKT2 ? ? 'expression tag' -5 25 2 6SJT ASP BBB 11 ? UNP A0A0C9MKT2 ? ? 'expression tag' -4 26 2 6SJT ASP BBB 12 ? UNP A0A0C9MKT2 ? ? 'expression tag' -3 27 2 6SJT ASP BBB 13 ? UNP A0A0C9MKT2 ? ? 'expression tag' -2 28 2 6SJT LYS BBB 14 ? UNP A0A0C9MKT2 ? ? 'expression tag' -1 29 2 6SJT MSE BBB 15 ? UNP A0A0C9MKT2 ? ? 'expression tag' 0 30 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6SJT _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.34 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 63.16 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '3.5 M ammonium chloride, 100 mM Tris-HCl pH 8.0' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 S 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2013-03-08 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol MAD _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # loop_ _diffrn_radiation_wavelength.id _diffrn_radiation_wavelength.wavelength _diffrn_radiation_wavelength.wt 1 0.9796 1.0 2 0.9797 1.0 3 0.9681 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I03' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list '0.9796, 0.9797, 0.9681' _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I03 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate 56.2 _reflns.entry_id 6SJT _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 3.10 _reflns.d_resolution_low 73.084 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 6280 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 20.4 _reflns.pdbx_Rmerge_I_obs 0.283 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 10.1 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.290 _reflns.pdbx_Rpim_I_all 0.064 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.994 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 3.10 _reflns_shell.d_res_low 3.18 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 3.7 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 437 _reflns_shell.percent_possible_all 100 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 1.022 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 20.9 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 1.048 _reflns_shell.pdbx_Rpim_I_all 0.226 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.933 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] -0.307 _refine.aniso_B[1][2] -0.154 _refine.aniso_B[1][3] 0.000 _refine.aniso_B[2][2] -0.307 _refine.aniso_B[2][3] 0.000 _refine.aniso_B[3][3] 0.996 _refine.B_iso_max ? _refine.B_iso_mean 59.913 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.885 _refine.correlation_coeff_Fo_to_Fc_free 0.888 _refine.details 'Hydrogens have been added in their riding positions' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6SJT _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3.103 _refine.ls_d_res_low 73.084 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 6250 _refine.ls_number_reflns_R_free 303 _refine.ls_number_reflns_R_work 5947 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.984 _refine.ls_percent_reflns_R_free 4.848 _refine.ls_R_factor_all 0.252 _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_free 0.2886 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2502 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free 0.276 _refine.ls_wR_factor_R_work 0.244 _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'MASK BULK SOLVENT' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct MAD _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.975 _refine.pdbx_overall_ESU_R_Free 0.476 _refine.pdbx_solvent_vdw_probe_radii 1.200 _refine.pdbx_solvent_ion_probe_radii 0.900 _refine.pdbx_solvent_shrinkage_radii 0.900 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 50.593 _refine.overall_SU_ML 0.372 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work 0.9134 _refine.pdbx_average_fsc_free 0.8877 # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 3.103 _refine_hist.d_res_low 73.084 _refine_hist.number_atoms_solvent 1 _refine_hist.number_atoms_total 1627 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1626 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.004 0.013 1664 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.017 1490 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.281 1.668 2282 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.081 1.564 3470 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 6.611 5.000 214 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 29.078 23.429 70 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 12.823 15.000 236 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 17.478 15.000 6 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.038 0.200 242 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.003 0.020 1880 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 314 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? 0.183 0.200 266 ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.175 0.200 1326 ? r_symmetry_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.152 0.200 817 ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? 0.070 0.200 757 ? r_symmetry_nbtor_other ? ? 'X-RAY DIFFRACTION' ? 0.126 0.200 31 ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.181 0.200 10 ? r_symmetry_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.219 0.200 41 ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.081 0.050 3227 ? r_ncsr_local_group_1 ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 3.103 3.184 437 . 30 407 100.0000 . 0.327 . 0.344 . 0.325 . . . . . 0.299 20 . 0.852 0.810 'X-RAY DIFFRACTION' 3.184 3.271 437 . 16 421 100.0000 . 0.312 . 0.453 . 0.307 . . . . . 0.278 20 . 0.866 0.836 'X-RAY DIFFRACTION' 3.271 3.365 420 . 18 402 100.0000 . 0.300 . 0.352 . 0.298 . . . . . 0.272 20 . 0.885 0.832 'X-RAY DIFFRACTION' 3.365 3.469 415 . 16 399 100.0000 . 0.281 . 0.339 . 0.279 . . . . . 0.248 20 . 0.899 0.862 'X-RAY DIFFRACTION' 3.469 3.582 394 . 19 375 100.0000 . 0.291 . 0.337 . 0.289 . . . . . 0.271 20 . 0.888 0.857 'X-RAY DIFFRACTION' 3.582 3.708 388 . 23 365 100.0000 . 0.274 . 0.318 . 0.271 . . . . . 0.250 20 . 0.902 0.855 'X-RAY DIFFRACTION' 3.708 3.847 390 . 24 366 100.0000 . 0.284 . 0.256 . 0.286 . . . . . 0.263 20 . 0.895 0.932 'X-RAY DIFFRACTION' 3.847 4.004 350 . 21 329 100.0000 . 0.252 . 0.275 . 0.250 . . . . . 0.234 20 . 0.913 0.920 'X-RAY DIFFRACTION' 4.004 4.181 345 . 13 332 100.0000 . 0.255 . 0.522 . 0.249 . . . . . 0.234 20 . 0.916 0.765 'X-RAY DIFFRACTION' 4.181 4.385 340 . 14 326 100.0000 . 0.227 . 0.279 . 0.225 . . . . . 0.215 20 . 0.939 0.878 'X-RAY DIFFRACTION' 4.385 4.621 323 . 22 301 100.0000 . 0.219 . 0.193 . 0.221 . . . . . 0.218 20 . 0.944 0.960 'X-RAY DIFFRACTION' 4.621 4.900 307 . 18 289 100.0000 . 0.182 . 0.301 . 0.175 . . . . . 0.177 20 . 0.964 0.946 'X-RAY DIFFRACTION' 4.900 5.237 295 . 13 282 100.0000 . 0.233 . 0.183 . 0.235 . . . . . 0.222 20 . 0.946 0.959 'X-RAY DIFFRACTION' 5.237 5.654 272 . 11 261 100.0000 . 0.236 . 0.325 . 0.232 . . . . . 0.220 20 . 0.939 0.929 'X-RAY DIFFRACTION' 5.654 6.190 250 . 11 239 100.0000 . 0.256 . 0.312 . 0.252 . . . . . 0.244 20 . 0.932 0.936 'X-RAY DIFFRACTION' 6.190 6.914 237 . 8 229 100.0000 . 0.254 . 0.391 . 0.251 . . . . . 0.247 20 . 0.930 0.860 'X-RAY DIFFRACTION' 6.914 7.972 210 . 13 197 100.0000 . 0.221 . 0.312 . 0.214 . . . . . 0.221 20 . 0.950 0.921 'X-RAY DIFFRACTION' 7.972 9.735 182 . 6 176 100.0000 . 0.188 . 0.156 . 0.190 . . . . . 0.202 20 . 0.968 0.983 'X-RAY DIFFRACTION' 9.735 13.647 155 . 3 152 100.0000 . 0.195 . 0.252 . 0.194 . . . . . 0.212 20 . 0.977 0.964 'X-RAY DIFFRACTION' 13.647 73.084 104 . 4 99 99.0385 . 0.392 . 0.298 . 0.395 . . . . . 0.653 20 . 0.905 0.964 # _struct.entry_id 6SJT _struct.title 'Crystal structure of the Legionella pneumophila type II secretion system substrate NttC' _struct.pdbx_descriptor NttC _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6SJT _struct_keywords.text 'Legionella pneumophila, type II sectorion system, UNKNOWN FUNCTION' _struct_keywords.pdbx_keywords 'UNKNOWN FUNCTION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 TRP A 54 ? CYS A 61 ? TRP AAA 39 CYS AAA 46 1 ? 8 HELX_P HELX_P2 AA2 TRP B 54 ? CYS B 61 ? TRP BBB 39 CYS BBB 46 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 61 SG ? ? ? 1_555 A CYS 70 SG ? ? AAA CYS 46 AAA CYS 55 1_555 ? ? ? ? ? ? ? 2.318 ? disulf2 disulf ? ? B CYS 61 SG ? ? ? 1_555 B CYS 70 SG ? ? BBB CYS 46 BBB CYS 55 1_555 ? ? ? ? ? ? ? 2.302 ? covale1 covale both ? A LYS 75 C ? ? ? 1_555 A MSE 76 N ? ? AAA LYS 60 AAA MSE 61 1_555 ? ? ? ? ? ? ? 1.336 ? covale2 covale both ? A MSE 76 C ? ? ? 1_555 A ALA 77 N ? ? AAA MSE 61 AAA ALA 62 1_555 ? ? ? ? ? ? ? 1.339 ? covale3 covale both ? A THR 90 C ? ? ? 1_555 A MSE 91 N ? ? AAA THR 75 AAA MSE 76 1_555 ? ? ? ? ? ? ? 1.341 ? covale4 covale both ? A MSE 91 C ? ? ? 1_555 A ASP 92 N ? ? AAA MSE 76 AAA ASP 77 1_555 ? ? ? ? ? ? ? 1.336 ? covale5 covale both ? B LYS 75 C ? ? ? 1_555 B MSE 76 N ? ? BBB LYS 60 BBB MSE 61 1_555 ? ? ? ? ? ? ? 1.338 ? covale6 covale both ? B MSE 76 C ? ? ? 1_555 B ALA 77 N ? ? BBB MSE 61 BBB ALA 62 1_555 ? ? ? ? ? ? ? 1.336 ? covale7 covale both ? B THR 90 C ? ? ? 1_555 B MSE 91 N ? ? BBB THR 75 BBB MSE 76 1_555 ? ? ? ? ? ? ? 1.339 ? covale8 covale both ? B MSE 91 C ? ? ? 1_555 B ASP 92 N ? ? BBB MSE 76 BBB ASP 77 1_555 ? ? ? ? ? ? ? 1.334 ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 4 ? AA3 ? 5 ? AA4 ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? parallel AA3 3 4 ? anti-parallel AA3 4 5 ? anti-parallel AA4 1 2 ? anti-parallel AA4 2 3 ? anti-parallel AA4 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 SER A 48 ? TYR A 53 ? SER AAA 33 TYR AAA 38 AA1 2 TYR A 19 ? ASN A 24 ? TYR AAA 4 ASN AAA 9 AA1 3 GLU A 117 ? LYS A 122 ? GLU AAA 102 LYS AAA 107 AA1 4 TYR A 108 ? GLY A 114 ? TYR AAA 93 GLY AAA 99 AA1 5 THR A 102 ? ALA A 105 ? THR AAA 87 ALA AAA 90 AA2 1 ILE A 38 ? PRO A 39 ? ILE AAA 23 PRO AAA 24 AA2 2 SER A 30 ? ILE A 34 ? SER AAA 15 ILE AAA 19 AA2 3 GLN A 69 ? MSE A 76 ? GLN AAA 54 MSE AAA 61 AA2 4 ILE A 84 ? ASP A 92 ? ILE AAA 69 ASP AAA 77 AA3 1 SER B 48 ? TYR B 53 ? SER BBB 33 TYR BBB 38 AA3 2 TYR B 19 ? ASN B 24 ? TYR BBB 4 ASN BBB 9 AA3 3 GLU B 117 ? LYS B 122 ? GLU BBB 102 LYS BBB 107 AA3 4 TYR B 108 ? GLY B 114 ? TYR BBB 93 GLY BBB 99 AA3 5 THR B 102 ? ALA B 105 ? THR BBB 87 ALA BBB 90 AA4 1 ILE B 38 ? PRO B 39 ? ILE BBB 23 PRO BBB 24 AA4 2 SER B 30 ? ILE B 34 ? SER BBB 15 ILE BBB 19 AA4 3 GLN B 69 ? MSE B 76 ? GLN BBB 54 MSE BBB 61 AA4 4 ILE B 84 ? ASP B 92 ? ILE BBB 69 ASP BBB 77 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O ASN A 50 ? O ASN AAA 35 N THR A 22 ? N THR AAA 7 AA1 2 3 N HIS A 23 ? N HIS AAA 8 O ILE A 120 ? O ILE AAA 105 AA1 3 4 O THR A 121 ? O THR AAA 106 N SER A 109 ? N SER AAA 94 AA1 4 5 O TYR A 108 ? O TYR AAA 93 N ALA A 105 ? N ALA AAA 90 AA2 1 2 O ILE A 38 ? O ILE AAA 23 N ILE A 34 ? N ILE AAA 19 AA2 2 3 N TYR A 33 ? N TYR AAA 18 O LEU A 73 ? O LEU AAA 58 AA2 3 4 N ILE A 74 ? N ILE AAA 59 O ILE A 86 ? O ILE AAA 71 AA3 1 2 O ASN B 50 ? O ASN BBB 35 N THR B 22 ? N THR BBB 7 AA3 2 3 N HIS B 23 ? N HIS BBB 8 O ILE B 120 ? O ILE BBB 105 AA3 3 4 O THR B 121 ? O THR BBB 106 N SER B 109 ? N SER BBB 94 AA3 4 5 O TYR B 108 ? O TYR BBB 93 N ALA B 105 ? N ALA BBB 90 AA4 1 2 O ILE B 38 ? O ILE BBB 23 N ILE B 34 ? N ILE BBB 19 AA4 2 3 N TYR B 33 ? N TYR BBB 18 O LEU B 73 ? O LEU BBB 58 AA4 3 4 N ILE B 74 ? N ILE BBB 59 O ILE B 86 ? O ILE BBB 71 # _atom_sites.entry_id 6SJT _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.011850 _atom_sites.fract_transf_matrix[1][2] 0.006841 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013683 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006594 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.analytical_mass_percent _atom_type.description _atom_type.number_in_cell _atom_type.oxidation_number _atom_type.pdbx_scat_Cromer_Mann_a5 _atom_type.pdbx_scat_Cromer_Mann_b5 _atom_type.radius_bond _atom_type.radius_contact _atom_type.scat_dispersion_imag _atom_type.scat_dispersion_real _atom_type.scat_dispersion_source _atom_type.scat_length_neutron _atom_type.scat_source _atom_type.scat_versus_stol_list C 2.310 20.844 1.020 10.208 1.589 0.569 0.865 51.651 0.216 ? ? ? ? ? ? ? ? ? ? ? ? ? ? H 0.493 10.511 0.323 26.126 0.140 3.142 0.041 57.800 0.003 ? ? ? ? ? ? ? ? ? ? ? ? ? ? N 12.222 0.006 3.135 9.893 2.014 28.997 1.167 0.583 -11.538 ? ? ? ? ? ? ? ? ? ? ? ? ? ? O 3.049 13.277 2.287 5.701 1.546 0.324 0.867 32.909 0.251 ? ? ? ? ? ? ? ? ? ? ? ? ? ? S 6.905 1.468 5.203 22.215 1.438 0.254 1.586 56.172 1.050 ? ? ? ? ? ? ? ? ? ? ? ? ? ? SE 17.006 2.410 5.822 0.273 3.974 15.237 4.356 43.816 -5.682 ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 -14 ? ? ? AAA . n A 1 2 ALA 2 -13 ? ? ? AAA . n A 1 3 HIS 3 -12 ? ? ? AAA . n A 1 4 HIS 4 -11 ? ? ? AAA . n A 1 5 HIS 5 -10 ? ? ? AAA . n A 1 6 HIS 6 -9 ? ? ? AAA . n A 1 7 HIS 7 -8 ? ? ? AAA . n A 1 8 HIS 8 -7 ? ? ? AAA . n A 1 9 VAL 9 -6 ? ? ? AAA . n A 1 10 ASP 10 -5 ? ? ? AAA . n A 1 11 ASP 11 -4 ? ? ? AAA . n A 1 12 ASP 12 -3 ? ? ? AAA . n A 1 13 ASP 13 -2 ? ? ? AAA . n A 1 14 LYS 14 -1 ? ? ? AAA . n A 1 15 MSE 15 0 ? ? ? AAA . n A 1 16 ALA 16 1 1 ALA ALA AAA . n A 1 17 PRO 17 2 2 PRO PRO AAA . n A 1 18 ALA 18 3 3 ALA ALA AAA . n A 1 19 TYR 19 4 4 TYR TYR AAA . n A 1 20 LEU 20 5 5 LEU LEU AAA . n A 1 21 THR 21 6 6 THR THR AAA . n A 1 22 THR 22 7 7 THR THR AAA . n A 1 23 HIS 23 8 8 HIS HIS AAA . n A 1 24 ASN 24 9 9 ASN ASN AAA . n A 1 25 ARG 25 10 10 ARG ARG AAA . n A 1 26 THR 26 11 11 THR THR AAA . n A 1 27 GLY 27 12 12 GLY GLY AAA . n A 1 28 GLU 28 13 13 GLU GLU AAA . n A 1 29 GLU 29 14 14 GLU GLU AAA . n A 1 30 SER 30 15 15 SER SER AAA . n A 1 31 ASN 31 16 16 ASN ASN AAA . n A 1 32 ALA 32 17 17 ALA ALA AAA . n A 1 33 TYR 33 18 18 TYR TYR AAA . n A 1 34 ILE 34 19 19 ILE ILE AAA . n A 1 35 ALA 35 20 20 ALA ALA AAA . n A 1 36 GLY 36 21 21 GLY GLY AAA . n A 1 37 SER 37 22 22 SER SER AAA . n A 1 38 ILE 38 23 23 ILE ILE AAA . n A 1 39 PRO 39 24 24 PRO PRO AAA . n A 1 40 SER 40 25 25 SER SER AAA . n A 1 41 LEU 41 26 26 LEU LEU AAA . n A 1 42 TYR 42 27 27 TYR TYR AAA . n A 1 43 PRO 43 28 28 PRO PRO AAA . n A 1 44 THR 44 29 29 THR THR AAA . n A 1 45 ALA 45 30 30 ALA ALA AAA . n A 1 46 ALA 46 31 31 ALA ALA AAA . n A 1 47 TYR 47 32 32 TYR TYR AAA . n A 1 48 SER 48 33 33 SER SER AAA . n A 1 49 THR 49 34 34 THR THR AAA . n A 1 50 ASN 50 35 35 ASN ASN AAA . n A 1 51 GLN 51 36 36 GLN GLN AAA . n A 1 52 VAL 52 37 37 VAL VAL AAA . n A 1 53 TYR 53 38 38 TYR TYR AAA . n A 1 54 TRP 54 39 39 TRP TRP AAA . n A 1 55 ASN 55 40 40 ASN ASN AAA . n A 1 56 LEU 56 41 41 LEU LEU AAA . n A 1 57 VAL 57 42 42 VAL VAL AAA . n A 1 58 ARG 58 43 43 ARG ARG AAA . n A 1 59 LEU 59 44 44 LEU LEU AAA . n A 1 60 ALA 60 45 45 ALA ALA AAA . n A 1 61 CYS 61 46 46 CYS CYS AAA . n A 1 62 TYR 62 47 47 TYR TYR AAA . n A 1 63 GLY 63 48 48 GLY GLY AAA . n A 1 64 HIS 64 49 49 HIS HIS AAA . n A 1 65 THR 65 50 50 THR THR AAA . n A 1 66 THR 66 51 51 THR THR AAA . n A 1 67 ASN 67 52 52 ASN ASN AAA . n A 1 68 GLY 68 53 53 GLY GLY AAA . n A 1 69 GLN 69 54 54 GLN GLN AAA . n A 1 70 CYS 70 55 55 CYS CYS AAA . n A 1 71 PRO 71 56 56 PRO PRO AAA . n A 1 72 ALA 72 57 57 ALA ALA AAA . n A 1 73 LEU 73 58 58 LEU LEU AAA . n A 1 74 ILE 74 59 59 ILE ILE AAA . n A 1 75 LYS 75 60 60 LYS LYS AAA . n A 1 76 MSE 76 61 61 MSE MSE AAA . n A 1 77 ALA 77 62 62 ALA ALA AAA . n A 1 78 THR 78 63 63 THR THR AAA . n A 1 79 ASN 79 64 64 ASN ASN AAA . n A 1 80 THR 80 65 65 THR THR AAA . n A 1 81 ALA 81 66 66 ALA ALA AAA . n A 1 82 ASN 82 67 67 ASN ASN AAA . n A 1 83 PRO 83 68 68 PRO PRO AAA . n A 1 84 ILE 84 69 69 ILE ILE AAA . n A 1 85 ASP 85 70 70 ASP ASP AAA . n A 1 86 ILE 86 71 71 ILE ILE AAA . n A 1 87 GLY 87 72 72 GLY GLY AAA . n A 1 88 TYR 88 73 73 TYR TYR AAA . n A 1 89 VAL 89 74 74 VAL VAL AAA . n A 1 90 THR 90 75 75 THR THR AAA . n A 1 91 MSE 91 76 76 MSE MSE AAA . n A 1 92 ASP 92 77 77 ASP ASP AAA . n A 1 93 LEU 93 78 78 LEU LEU AAA . n A 1 94 ASN 94 79 79 ASN ASN AAA . n A 1 95 THR 95 80 80 THR THR AAA . n A 1 96 GLY 96 81 81 GLY GLY AAA . n A 1 97 ASP 97 82 82 ASP ASP AAA . n A 1 98 ILE 98 83 83 ILE ILE AAA . n A 1 99 THR 99 84 84 THR THR AAA . n A 1 100 PRO 100 85 85 PRO PRO AAA . n A 1 101 LYS 101 86 86 LYS LYS AAA . n A 1 102 THR 102 87 87 THR THR AAA . n A 1 103 LEU 103 88 88 LEU LEU AAA . n A 1 104 SER 104 89 89 SER SER AAA . n A 1 105 ALA 105 90 90 ALA ALA AAA . n A 1 106 LYS 106 91 91 LYS LYS AAA . n A 1 107 GLY 107 92 92 GLY GLY AAA . n A 1 108 TYR 108 93 93 TYR TYR AAA . n A 1 109 SER 109 94 94 SER SER AAA . n A 1 110 LEU 110 95 95 LEU LEU AAA . n A 1 111 ARG 111 96 96 ARG ARG AAA . n A 1 112 VAL 112 97 97 VAL VAL AAA . n A 1 113 ILE 113 98 98 ILE ILE AAA . n A 1 114 GLY 114 99 99 GLY GLY AAA . n A 1 115 PRO 115 100 100 PRO PRO AAA . n A 1 116 GLY 116 101 101 GLY GLY AAA . n A 1 117 GLU 117 102 102 GLU GLU AAA . n A 1 118 ALA 118 103 103 ALA ALA AAA . n A 1 119 GLU 119 104 104 GLU GLU AAA . n A 1 120 ILE 120 105 105 ILE ILE AAA . n A 1 121 THR 121 106 106 THR THR AAA . n A 1 122 LYS 122 107 107 LYS LYS AAA . n A 1 123 ASN 123 108 108 ASN ASN AAA . n B 1 1 MSE 1 -14 ? ? ? BBB . n B 1 2 ALA 2 -13 ? ? ? BBB . n B 1 3 HIS 3 -12 ? ? ? BBB . n B 1 4 HIS 4 -11 ? ? ? BBB . n B 1 5 HIS 5 -10 ? ? ? BBB . n B 1 6 HIS 6 -9 ? ? ? BBB . n B 1 7 HIS 7 -8 ? ? ? BBB . n B 1 8 HIS 8 -7 ? ? ? BBB . n B 1 9 VAL 9 -6 ? ? ? BBB . n B 1 10 ASP 10 -5 ? ? ? BBB . n B 1 11 ASP 11 -4 ? ? ? BBB . n B 1 12 ASP 12 -3 ? ? ? BBB . n B 1 13 ASP 13 -2 ? ? ? BBB . n B 1 14 LYS 14 -1 ? ? ? BBB . n B 1 15 MSE 15 0 ? ? ? BBB . n B 1 16 ALA 16 1 1 ALA ALA BBB . n B 1 17 PRO 17 2 2 PRO PRO BBB . n B 1 18 ALA 18 3 3 ALA ALA BBB . n B 1 19 TYR 19 4 4 TYR TYR BBB . n B 1 20 LEU 20 5 5 LEU LEU BBB . n B 1 21 THR 21 6 6 THR THR BBB . n B 1 22 THR 22 7 7 THR THR BBB . n B 1 23 HIS 23 8 8 HIS HIS BBB . n B 1 24 ASN 24 9 9 ASN ASN BBB . n B 1 25 ARG 25 10 10 ARG ARG BBB . n B 1 26 THR 26 11 11 THR THR BBB . n B 1 27 GLY 27 12 12 GLY GLY BBB . n B 1 28 GLU 28 13 13 GLU GLU BBB . n B 1 29 GLU 29 14 14 GLU GLU BBB . n B 1 30 SER 30 15 15 SER SER BBB . n B 1 31 ASN 31 16 16 ASN ASN BBB . n B 1 32 ALA 32 17 17 ALA ALA BBB . n B 1 33 TYR 33 18 18 TYR TYR BBB . n B 1 34 ILE 34 19 19 ILE ILE BBB . n B 1 35 ALA 35 20 20 ALA ALA BBB . n B 1 36 GLY 36 21 21 GLY GLY BBB . n B 1 37 SER 37 22 22 SER SER BBB . n B 1 38 ILE 38 23 23 ILE ILE BBB . n B 1 39 PRO 39 24 24 PRO PRO BBB . n B 1 40 SER 40 25 25 SER SER BBB . n B 1 41 LEU 41 26 26 LEU LEU BBB . n B 1 42 TYR 42 27 27 TYR TYR BBB . n B 1 43 PRO 43 28 28 PRO PRO BBB . n B 1 44 THR 44 29 29 THR THR BBB . n B 1 45 ALA 45 30 30 ALA ALA BBB . n B 1 46 ALA 46 31 31 ALA ALA BBB . n B 1 47 TYR 47 32 32 TYR TYR BBB . n B 1 48 SER 48 33 33 SER SER BBB . n B 1 49 THR 49 34 34 THR THR BBB . n B 1 50 ASN 50 35 35 ASN ASN BBB . n B 1 51 GLN 51 36 36 GLN GLN BBB . n B 1 52 VAL 52 37 37 VAL VAL BBB . n B 1 53 TYR 53 38 38 TYR TYR BBB . n B 1 54 TRP 54 39 39 TRP TRP BBB . n B 1 55 ASN 55 40 40 ASN ASN BBB . n B 1 56 LEU 56 41 41 LEU LEU BBB . n B 1 57 VAL 57 42 42 VAL VAL BBB . n B 1 58 ARG 58 43 43 ARG ARG BBB . n B 1 59 LEU 59 44 44 LEU LEU BBB . n B 1 60 ALA 60 45 45 ALA ALA BBB . n B 1 61 CYS 61 46 46 CYS CYS BBB . n B 1 62 TYR 62 47 47 TYR TYR BBB . n B 1 63 GLY 63 48 48 GLY GLY BBB . n B 1 64 HIS 64 49 49 HIS HIS BBB . n B 1 65 THR 65 50 50 THR THR BBB . n B 1 66 THR 66 51 51 THR THR BBB . n B 1 67 ASN 67 52 52 ASN ASN BBB . n B 1 68 GLY 68 53 53 GLY GLY BBB . n B 1 69 GLN 69 54 54 GLN GLN BBB . n B 1 70 CYS 70 55 55 CYS CYS BBB . n B 1 71 PRO 71 56 56 PRO PRO BBB . n B 1 72 ALA 72 57 57 ALA ALA BBB . n B 1 73 LEU 73 58 58 LEU LEU BBB . n B 1 74 ILE 74 59 59 ILE ILE BBB . n B 1 75 LYS 75 60 60 LYS LYS BBB . n B 1 76 MSE 76 61 61 MSE MSE BBB . n B 1 77 ALA 77 62 62 ALA ALA BBB . n B 1 78 THR 78 63 63 THR THR BBB . n B 1 79 ASN 79 64 64 ASN ASN BBB . n B 1 80 THR 80 65 65 THR THR BBB . n B 1 81 ALA 81 66 66 ALA ALA BBB . n B 1 82 ASN 82 67 67 ASN ASN BBB . n B 1 83 PRO 83 68 68 PRO PRO BBB . n B 1 84 ILE 84 69 69 ILE ILE BBB . n B 1 85 ASP 85 70 70 ASP ASP BBB . n B 1 86 ILE 86 71 71 ILE ILE BBB . n B 1 87 GLY 87 72 72 GLY GLY BBB . n B 1 88 TYR 88 73 73 TYR TYR BBB . n B 1 89 VAL 89 74 74 VAL VAL BBB . n B 1 90 THR 90 75 75 THR THR BBB . n B 1 91 MSE 91 76 76 MSE MSE BBB . n B 1 92 ASP 92 77 77 ASP ASP BBB . n B 1 93 LEU 93 78 78 LEU LEU BBB . n B 1 94 ASN 94 79 79 ASN ASN BBB . n B 1 95 THR 95 80 80 THR THR BBB . n B 1 96 GLY 96 81 81 GLY GLY BBB . n B 1 97 ASP 97 82 82 ASP ASP BBB . n B 1 98 ILE 98 83 83 ILE ILE BBB . n B 1 99 THR 99 84 84 THR THR BBB . n B 1 100 PRO 100 85 85 PRO PRO BBB . n B 1 101 LYS 101 86 86 LYS LYS BBB . n B 1 102 THR 102 87 87 THR THR BBB . n B 1 103 LEU 103 88 88 LEU LEU BBB . n B 1 104 SER 104 89 89 SER SER BBB . n B 1 105 ALA 105 90 90 ALA ALA BBB . n B 1 106 LYS 106 91 91 LYS LYS BBB . n B 1 107 GLY 107 92 92 GLY GLY BBB . n B 1 108 TYR 108 93 93 TYR TYR BBB . n B 1 109 SER 109 94 94 SER SER BBB . n B 1 110 LEU 110 95 95 LEU LEU BBB . n B 1 111 ARG 111 96 96 ARG ARG BBB . n B 1 112 VAL 112 97 97 VAL VAL BBB . n B 1 113 ILE 113 98 98 ILE ILE BBB . n B 1 114 GLY 114 99 99 GLY GLY BBB . n B 1 115 PRO 115 100 100 PRO PRO BBB . n B 1 116 GLY 116 101 101 GLY GLY BBB . n B 1 117 GLU 117 102 102 GLU GLU BBB . n B 1 118 ALA 118 103 103 ALA ALA BBB . n B 1 119 GLU 119 104 104 GLU GLU BBB . n B 1 120 ILE 120 105 105 ILE ILE BBB . n B 1 121 THR 121 106 106 THR THR BBB . n B 1 122 LYS 122 107 107 LYS LYS BBB . n B 1 123 ASN 123 108 108 ASN ASN BBB . n # _pdbx_nonpoly_scheme.asym_id C _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id HOH _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 201 _pdbx_nonpoly_scheme.auth_seq_num 1 _pdbx_nonpoly_scheme.pdb_mon_id HOH _pdbx_nonpoly_scheme.auth_mon_id HOH _pdbx_nonpoly_scheme.pdb_strand_id AAA _pdbx_nonpoly_scheme.pdb_ins_code . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 76 AAA MSE 61 ? MET 'modified residue' 2 A MSE 91 AAA MSE 76 ? MET 'modified residue' 3 B MSE 76 BBB MSE 61 ? MET 'modified residue' 4 B MSE 91 BBB MSE 76 ? MET 'modified residue' # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_defined_assembly ? monomeric 1 2 author_defined_assembly ? monomeric 1 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,C 2 1 B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id AAA _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 201 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id C _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-05-20 2 'Structure model' 1 1 2020-07-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # _pdbx_audit_revision_category.ordinal 1 _pdbx_audit_revision_category.revision_ordinal 2 _pdbx_audit_revision_category.data_content_type 'Structure model' _pdbx_audit_revision_category.category citation # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation.pdbx_database_id_DOI' 5 2 'Structure model' '_citation.pdbx_database_id_PubMed' 6 2 'Structure model' '_citation.title' # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined 30.7440 3.5860 14.7940 0.0634 ? -0.0146 ? -0.0213 ? 0.6103 ? -0.1083 ? 0.0477 ? 4.8825 ? -0.9708 ? -0.9473 ? 4.3549 ? 1.1432 ? 5.3370 ? 0.0857 ? 0.0650 ? -0.3325 ? 0.4330 ? -0.0691 ? -0.0569 ? 0.2315 ? 0.4527 ? -0.0165 ? 2 'X-RAY DIFFRACTION' ? refined 9.6160 13.0670 7.9340 0.2335 ? 0.0981 ? 0.0326 ? 0.6003 ? -0.1122 ? 0.1751 ? 5.3003 ? -0.6194 ? 2.3790 ? 2.7618 ? 2.1496 ? 6.4345 ? -0.0193 ? 0.5728 ? 0.1005 ? -0.0367 ? -0.1526 ? 0.1347 ? -0.8839 ? -0.4247 ? 0.1719 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? A* 1 ? ? A* 108 ALL ? 2 'X-RAY DIFFRACTION' 2 ? ? B* 1 ? ? B* 108 ALL ? # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0253 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? SHARP ? ? ? . 4 # _pdbx_entry_details.entry_id 6SJT _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER AAA 22 ? ? -132.85 -33.89 2 1 SER BBB 22 ? ? -132.59 -34.34 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 AAA MSE -14 ? A MSE 1 2 1 Y 1 AAA ALA -13 ? A ALA 2 3 1 Y 1 AAA HIS -12 ? A HIS 3 4 1 Y 1 AAA HIS -11 ? A HIS 4 5 1 Y 1 AAA HIS -10 ? A HIS 5 6 1 Y 1 AAA HIS -9 ? A HIS 6 7 1 Y 1 AAA HIS -8 ? A HIS 7 8 1 Y 1 AAA HIS -7 ? A HIS 8 9 1 Y 1 AAA VAL -6 ? A VAL 9 10 1 Y 1 AAA ASP -5 ? A ASP 10 11 1 Y 1 AAA ASP -4 ? A ASP 11 12 1 Y 1 AAA ASP -3 ? A ASP 12 13 1 Y 1 AAA ASP -2 ? A ASP 13 14 1 Y 1 AAA LYS -1 ? A LYS 14 15 1 Y 1 AAA MSE 0 ? A MSE 15 16 1 Y 1 BBB MSE -14 ? B MSE 1 17 1 Y 1 BBB ALA -13 ? B ALA 2 18 1 Y 1 BBB HIS -12 ? B HIS 3 19 1 Y 1 BBB HIS -11 ? B HIS 4 20 1 Y 1 BBB HIS -10 ? B HIS 5 21 1 Y 1 BBB HIS -9 ? B HIS 6 22 1 Y 1 BBB HIS -8 ? B HIS 7 23 1 Y 1 BBB HIS -7 ? B HIS 8 24 1 Y 1 BBB VAL -6 ? B VAL 9 25 1 Y 1 BBB ASP -5 ? B ASP 10 26 1 Y 1 BBB ASP -4 ? B ASP 11 27 1 Y 1 BBB ASP -3 ? B ASP 12 28 1 Y 1 BBB ASP -2 ? B ASP 13 29 1 Y 1 BBB LYS -1 ? B LYS 14 30 1 Y 1 BBB MSE 0 ? B MSE 15 # _pdbx_audit_support.funding_organization 'Medical Research Council (United Kingdom)' _pdbx_audit_support.country 'United Kingdom' _pdbx_audit_support.grant_number MR/M009920/10 _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id MSE _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id MSE _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #