data_6SK9 # _entry.id 6SK9 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.326 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 6SK9 WWPDB D_1292103873 # _pdbx_database_PDB_obs_spr.id SPRSDE _pdbx_database_PDB_obs_spr.date 2020-06-17 _pdbx_database_PDB_obs_spr.pdb_id 6SK9 _pdbx_database_PDB_obs_spr.replace_pdb_id 6H0O _pdbx_database_PDB_obs_spr.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6SK9 _pdbx_database_status.recvd_initial_deposition_date 2019-08-15 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Bayliss, R.' 1 0000-0003-0604-2773 'Byrne, M.J.' 2 ? 'Mas-Droux, C.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Biochem.J. _citation.journal_id_ASTM BIJOAK _citation.journal_id_CSD 0043 _citation.journal_id_ISSN 1470-8728 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 477 _citation.language ? _citation.page_first 1525 _citation.page_last 1539 _citation.title 'Nek7 conformational flexibility and inhibitor binding probed through protein engineering of the R-spine.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1042/BCJ20200128 _citation.pdbx_database_id_PubMed 32242624 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Byrne, M.J.' 1 ? primary 'Nasir, N.' 2 ? primary 'Basmadjian, C.' 3 ? primary 'Bhatia, C.' 4 ? primary 'Cunnison, R.F.' 5 ? primary 'Carr, K.H.' 6 ? primary 'Mas-Droux, C.' 7 ? primary 'Yeoh, S.' 8 ? primary 'Cano, C.' 9 ? primary 'Bayliss, R.' 10 ? # _cell.angle_alpha 90.0 _cell.angle_alpha_esd ? _cell.angle_beta 132.42 _cell.angle_beta_esd ? _cell.angle_gamma 90.0 _cell.angle_gamma_esd ? _cell.entry_id 6SK9 _cell.details ? _cell.formula_units_Z ? _cell.length_a 100.02 _cell.length_a_esd ? _cell.length_b 56.89 _cell.length_b_esd ? _cell.length_c 77.94 _cell.length_c_esd ? _cell.volume 327392.665062 _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6SK9 _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 _symmetry.space_group_name_Hall 'C 2y' _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Serine/threonine-protein kinase Nek2' 32662.479 1 2.7.11.1 ? ? ? 2 non-polymer syn '3-[[6-(cyclohexylmethoxy)-7~{H}-purin-2-yl]amino]-~{N}-[3-(dimethylamino)propyl]benzenesulfonamide' 487.618 1 ? ? ? ? 3 non-polymer syn GLYCEROL 92.094 1 ? ? ? ? 4 water nat water 18.015 91 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'HSPK 21,Never in mitosis A-related kinase 2,NimA-related protein kinase 2,NimA-like protein kinase 1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MPSRAEDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSMTEAEKQMLVSEVNLLRELKHPNIVRYYDRIIDRTNT TLYIVMEYCEGGDLASVITKGTKERQYLDEEFVLRVMTQLTLALKECHRRSDGGHTVLHRDLKPANVFLDGKQNVKLGDF GLARILNHDTSFAKTFVGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRRIPYRY SDELNEIITRMLNLKDYHRPSVEEILENPLILEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MPSRAEDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSMTEAEKQMLVSEVNLLRELKHPNIVRYYDRIIDRTNT TLYIVMEYCEGGDLASVITKGTKERQYLDEEFVLRVMTQLTLALKECHRRSDGGHTVLHRDLKPANVFLDGKQNVKLGDF GLARILNHDTSFAKTFVGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRRIPYRY SDELNEIITRMLNLKDYHRPSVEEILENPLILEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 PRO n 1 3 SER n 1 4 ARG n 1 5 ALA n 1 6 GLU n 1 7 ASP n 1 8 TYR n 1 9 GLU n 1 10 VAL n 1 11 LEU n 1 12 TYR n 1 13 THR n 1 14 ILE n 1 15 GLY n 1 16 THR n 1 17 GLY n 1 18 SER n 1 19 TYR n 1 20 GLY n 1 21 ARG n 1 22 CYS n 1 23 GLN n 1 24 LYS n 1 25 ILE n 1 26 ARG n 1 27 ARG n 1 28 LYS n 1 29 SER n 1 30 ASP n 1 31 GLY n 1 32 LYS n 1 33 ILE n 1 34 LEU n 1 35 VAL n 1 36 TRP n 1 37 LYS n 1 38 GLU n 1 39 LEU n 1 40 ASP n 1 41 TYR n 1 42 GLY n 1 43 SER n 1 44 MET n 1 45 THR n 1 46 GLU n 1 47 ALA n 1 48 GLU n 1 49 LYS n 1 50 GLN n 1 51 MET n 1 52 LEU n 1 53 VAL n 1 54 SER n 1 55 GLU n 1 56 VAL n 1 57 ASN n 1 58 LEU n 1 59 LEU n 1 60 ARG n 1 61 GLU n 1 62 LEU n 1 63 LYS n 1 64 HIS n 1 65 PRO n 1 66 ASN n 1 67 ILE n 1 68 VAL n 1 69 ARG n 1 70 TYR n 1 71 TYR n 1 72 ASP n 1 73 ARG n 1 74 ILE n 1 75 ILE n 1 76 ASP n 1 77 ARG n 1 78 THR n 1 79 ASN n 1 80 THR n 1 81 THR n 1 82 LEU n 1 83 TYR n 1 84 ILE n 1 85 VAL n 1 86 MET n 1 87 GLU n 1 88 TYR n 1 89 CYS n 1 90 GLU n 1 91 GLY n 1 92 GLY n 1 93 ASP n 1 94 LEU n 1 95 ALA n 1 96 SER n 1 97 VAL n 1 98 ILE n 1 99 THR n 1 100 LYS n 1 101 GLY n 1 102 THR n 1 103 LYS n 1 104 GLU n 1 105 ARG n 1 106 GLN n 1 107 TYR n 1 108 LEU n 1 109 ASP n 1 110 GLU n 1 111 GLU n 1 112 PHE n 1 113 VAL n 1 114 LEU n 1 115 ARG n 1 116 VAL n 1 117 MET n 1 118 THR n 1 119 GLN n 1 120 LEU n 1 121 THR n 1 122 LEU n 1 123 ALA n 1 124 LEU n 1 125 LYS n 1 126 GLU n 1 127 CYS n 1 128 HIS n 1 129 ARG n 1 130 ARG n 1 131 SER n 1 132 ASP n 1 133 GLY n 1 134 GLY n 1 135 HIS n 1 136 THR n 1 137 VAL n 1 138 LEU n 1 139 HIS n 1 140 ARG n 1 141 ASP n 1 142 LEU n 1 143 LYS n 1 144 PRO n 1 145 ALA n 1 146 ASN n 1 147 VAL n 1 148 PHE n 1 149 LEU n 1 150 ASP n 1 151 GLY n 1 152 LYS n 1 153 GLN n 1 154 ASN n 1 155 VAL n 1 156 LYS n 1 157 LEU n 1 158 GLY n 1 159 ASP n 1 160 PHE n 1 161 GLY n 1 162 LEU n 1 163 ALA n 1 164 ARG n 1 165 ILE n 1 166 LEU n 1 167 ASN n 1 168 HIS n 1 169 ASP n 1 170 THR n 1 171 SER n 1 172 PHE n 1 173 ALA n 1 174 LYS n 1 175 THR n 1 176 PHE n 1 177 VAL n 1 178 GLY n 1 179 THR n 1 180 PRO n 1 181 TYR n 1 182 TYR n 1 183 MET n 1 184 SER n 1 185 PRO n 1 186 GLU n 1 187 GLN n 1 188 MET n 1 189 ASN n 1 190 ARG n 1 191 MET n 1 192 SER n 1 193 TYR n 1 194 ASN n 1 195 GLU n 1 196 LYS n 1 197 SER n 1 198 ASP n 1 199 ILE n 1 200 TRP n 1 201 SER n 1 202 LEU n 1 203 GLY n 1 204 CYS n 1 205 LEU n 1 206 LEU n 1 207 TYR n 1 208 GLU n 1 209 LEU n 1 210 CYS n 1 211 ALA n 1 212 LEU n 1 213 MET n 1 214 PRO n 1 215 PRO n 1 216 PHE n 1 217 THR n 1 218 ALA n 1 219 PHE n 1 220 SER n 1 221 GLN n 1 222 LYS n 1 223 GLU n 1 224 LEU n 1 225 ALA n 1 226 GLY n 1 227 LYS n 1 228 ILE n 1 229 ARG n 1 230 GLU n 1 231 GLY n 1 232 LYS n 1 233 PHE n 1 234 ARG n 1 235 ARG n 1 236 ILE n 1 237 PRO n 1 238 TYR n 1 239 ARG n 1 240 TYR n 1 241 SER n 1 242 ASP n 1 243 GLU n 1 244 LEU n 1 245 ASN n 1 246 GLU n 1 247 ILE n 1 248 ILE n 1 249 THR n 1 250 ARG n 1 251 MET n 1 252 LEU n 1 253 ASN n 1 254 LEU n 1 255 LYS n 1 256 ASP n 1 257 TYR n 1 258 HIS n 1 259 ARG n 1 260 PRO n 1 261 SER n 1 262 VAL n 1 263 GLU n 1 264 GLU n 1 265 ILE n 1 266 LEU n 1 267 GLU n 1 268 ASN n 1 269 PRO n 1 270 LEU n 1 271 ILE n 1 272 LEU n 1 273 GLU n 1 274 HIS n 1 275 HIS n 1 276 HIS n 1 277 HIS n 1 278 HIS n 1 279 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 279 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'NEK2, NEK2A, NLK1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code NEK2_HUMAN _struct_ref.pdbx_db_accession P51955 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MPSRAEDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSMTEAEKQMLVSEVNLLRELKHPNIVRYYDRIIDRTNT TLYIVMEYCEGGDLASVITKGTKERQYLDEEFVLRVMTQLTLALKECHRRSDGGHTVLHRDLKPANVFLDGKQNVKLGDF GLARILNHDTSFAKTFVGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRRIPYRY SDELNEIITRMLNLKDYHRPSVEEILENPLI ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6SK9 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 271 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P51955 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 271 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 271 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6SK9 LEU A 272 ? UNP P51955 ? ? 'expression tag' 272 1 1 6SK9 GLU A 273 ? UNP P51955 ? ? 'expression tag' 273 2 1 6SK9 HIS A 274 ? UNP P51955 ? ? 'expression tag' 274 3 1 6SK9 HIS A 275 ? UNP P51955 ? ? 'expression tag' 275 4 1 6SK9 HIS A 276 ? UNP P51955 ? ? 'expression tag' 276 5 1 6SK9 HIS A 277 ? UNP P51955 ? ? 'expression tag' 277 6 1 6SK9 HIS A 278 ? UNP P51955 ? ? 'expression tag' 278 7 1 6SK9 HIS A 279 ? UNP P51955 ? ? 'expression tag' 279 8 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 F9N non-polymer . '3-[[6-(cyclohexylmethoxy)-7~{H}-purin-2-yl]amino]-~{N}-[3-(dimethylamino)propyl]benzenesulfonamide' ? 'C23 H33 N7 O3 S' 487.618 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6SK9 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.88 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 57.33 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 279 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '50 mM Hepes, pH 7.5, 300 mM sodium chloride, 10 mM sodium phosphate, 5 mM dithiothreitol and 5% glycerol' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 S 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2009-02-20 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9795 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE ID23-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9795 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ID23-1 _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate 31.3770207207 _reflns.entry_id 6SK9 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.0 _reflns.d_resolution_low 30.63 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 21992 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.3 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.6 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 8.5 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.997 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.0 _reflns_shell.d_res_low 2.11 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 3167 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.679 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 49.6367037345 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6SK9 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.00 _refine.ls_d_res_low 30.63 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 21828 _refine.ls_number_reflns_R_free 1112 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.272330362 _refine.ls_percent_reflns_R_free 5.09437419828 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.189516994103 _refine.ls_R_factor_R_free 0.219599199899 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.187889564471 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.35040804944 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 23.177789498 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.186498588615 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.00 _refine_hist.d_res_low 30.63 _refine_hist.number_atoms_solvent 91 _refine_hist.number_atoms_total 2025 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1894 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 40 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.00804393160712 ? 1981 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.02929117658 ? 2680 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0408423445935 ? 294 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.00463971770443 ? 338 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 16.432334505 ? 730 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.0 2.091 . . 132 2572 99.7417926964 . . . 0.32188434003 . 0.249026125735 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.091 2.2012 . . 141 2601 99.8543335761 . . . 0.227397106964 . 0.211410789399 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.2012 2.3391 . . 155 2551 99.9630587366 . . . 0.237144717025 . 0.184014794322 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.3391 2.5196 . . 139 2612 99.9273519797 . . . 0.192307794075 . 0.173713649889 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.5196 2.773 . . 124 2608 99.780861943 . . . 0.20066319249 . 0.183327965951 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.773 3.174 . . 136 2595 99.5625227853 . . . 0.225587181687 . 0.179623032658 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.174 3.9975 . . 148 2600 99.3851717902 . . . 0.202796164466 . 0.175420068536 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.9975 30.63 . . 137 2577 96.1388593695 . . . 0.225745158659 . 0.193660302369 . . . . . . . . . . # _struct.entry_id 6SK9 _struct.title 'Nek2 bound to purine compound 51' _struct.pdbx_descriptor 'Serine/threonine-protein kinase Nek2 (E.C.2.7.11.1)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6SK9 _struct_keywords.text 'Ser/Thr protein kinase, TRANSFERASE' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ARG A 4 ? GLU A 6 ? ARG A 4 GLU A 6 5 ? 3 HELX_P HELX_P2 AA2 ALA A 47 ? ARG A 60 ? ALA A 47 ARG A 60 1 ? 14 HELX_P HELX_P3 AA3 ASP A 93 ? GLU A 104 ? ASP A 93 GLU A 104 1 ? 12 HELX_P HELX_P4 AA4 ASP A 109 ? ARG A 130 ? ASP A 109 ARG A 130 1 ? 22 HELX_P HELX_P5 AA5 LYS A 143 ? ALA A 145 ? LYS A 143 ALA A 145 5 ? 3 HELX_P HELX_P6 AA6 SER A 184 ? ASN A 189 ? SER A 184 ASN A 189 1 ? 6 HELX_P HELX_P7 AA7 GLU A 195 ? LEU A 212 ? GLU A 195 LEU A 212 1 ? 18 HELX_P HELX_P8 AA8 SER A 220 ? GLY A 231 ? SER A 220 GLY A 231 1 ? 12 HELX_P HELX_P9 AA9 SER A 241 ? LEU A 252 ? SER A 241 LEU A 252 1 ? 12 HELX_P HELX_P10 AB1 LYS A 255 ? ARG A 259 ? LYS A 255 ARG A 259 5 ? 5 HELX_P HELX_P11 AB2 SER A 261 ? GLU A 267 ? SER A 261 GLU A 267 1 ? 7 HELX_P HELX_P12 AB3 LEU A 272 ? HIS A 276 ? LEU A 272 HIS A 276 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 TYR A 8 ? GLY A 15 ? TYR A 8 GLY A 15 AA1 2 CYS A 22 ? ARG A 27 ? CYS A 22 ARG A 27 AA1 3 ILE A 33 ? ASP A 40 ? ILE A 33 ASP A 40 AA1 4 THR A 81 ? GLU A 87 ? THR A 81 GLU A 87 AA1 5 TYR A 70 ? ASP A 76 ? TYR A 70 ASP A 76 AA2 1 VAL A 147 ? LEU A 149 ? VAL A 147 LEU A 149 AA2 2 VAL A 155 ? LEU A 157 ? VAL A 155 LEU A 157 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLY A 15 ? N GLY A 15 O CYS A 22 ? O CYS A 22 AA1 2 3 N ILE A 25 ? N ILE A 25 O LEU A 34 ? O LEU A 34 AA1 3 4 N LEU A 39 ? N LEU A 39 O LEU A 82 ? O LEU A 82 AA1 4 5 O TYR A 83 ? O TYR A 83 N ILE A 74 ? N ILE A 74 AA2 1 2 N PHE A 148 ? N PHE A 148 O LYS A 156 ? O LYS A 156 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A F9N 301 ? 14 'binding site for residue F9N A 301' AC2 Software A GOL 302 ? 6 'binding site for residue GOL A 302' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 14 GLY A 15 ? GLY A 15 . ? 1_555 ? 2 AC1 14 THR A 16 ? THR A 16 . ? 1_555 ? 3 AC1 14 CYS A 22 ? CYS A 22 . ? 1_555 ? 4 AC1 14 LYS A 37 ? LYS A 37 . ? 1_555 ? 5 AC1 14 GLU A 87 ? GLU A 87 . ? 1_555 ? 6 AC1 14 TYR A 88 ? TYR A 88 . ? 1_555 ? 7 AC1 14 CYS A 89 ? CYS A 89 . ? 1_555 ? 8 AC1 14 GLY A 92 ? GLY A 92 . ? 1_555 ? 9 AC1 14 ASP A 93 ? ASP A 93 . ? 1_555 ? 10 AC1 14 SER A 96 ? SER A 96 . ? 1_555 ? 11 AC1 14 LYS A 100 ? LYS A 100 . ? 2_556 ? 12 AC1 14 GLU A 104 ? GLU A 104 . ? 2_556 ? 13 AC1 14 PHE A 148 ? PHE A 148 . ? 1_555 ? 14 AC1 14 HOH D . ? HOH A 418 . ? 1_555 ? 15 AC2 6 LEU A 122 ? LEU A 122 . ? 4_556 ? 16 AC2 6 ASP A 242 ? ASP A 242 . ? 1_555 ? 17 AC2 6 HIS A 276 ? HIS A 276 . ? 4_556 ? 18 AC2 6 HIS A 277 ? HIS A 277 . ? 4_556 ? 19 AC2 6 HOH D . ? HOH A 411 . ? 1_555 ? 20 AC2 6 HOH D . ? HOH A 441 . ? 1_555 ? # _atom_sites.entry_id 6SK9 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.009998 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.009136 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.017578 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.017380 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 25.62398 1.50364 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 19.97189 1.75589 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 15.80542 1.70748 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 1.23737 29.19336 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 PRO 2 2 ? ? ? A . n A 1 3 SER 3 3 ? ? ? A . n A 1 4 ARG 4 4 4 ARG ARG A . n A 1 5 ALA 5 5 5 ALA ALA A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 ASP 7 7 7 ASP ASP A . n A 1 8 TYR 8 8 8 TYR TYR A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 TYR 12 12 12 TYR TYR A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 ILE 14 14 14 ILE ILE A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 THR 16 16 16 THR THR A . n A 1 17 GLY 17 17 ? ? ? A . n A 1 18 SER 18 18 ? ? ? A . n A 1 19 TYR 19 19 ? ? ? A . n A 1 20 GLY 20 20 ? ? ? A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 CYS 22 22 22 CYS CYS A . n A 1 23 GLN 23 23 23 GLN GLN A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 ILE 25 25 25 ILE ILE A . n A 1 26 ARG 26 26 26 ARG ARG A . n A 1 27 ARG 27 27 27 ARG ARG A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 ASP 30 30 30 ASP ASP A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 TRP 36 36 36 TRP TRP A . n A 1 37 LYS 37 37 37 LYS LYS A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 TYR 41 41 41 TYR TYR A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 SER 43 43 43 SER SER A . n A 1 44 MET 44 44 44 MET MET A . n A 1 45 THR 45 45 45 THR THR A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 ALA 47 47 47 ALA ALA A . n A 1 48 GLU 48 48 48 GLU GLU A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 GLN 50 50 50 GLN GLN A . n A 1 51 MET 51 51 51 MET MET A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 VAL 53 53 53 VAL VAL A . n A 1 54 SER 54 54 54 SER SER A . n A 1 55 GLU 55 55 55 GLU GLU A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 ASN 57 57 57 ASN ASN A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 ARG 60 60 60 ARG ARG A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 LYS 63 63 63 LYS LYS A . n A 1 64 HIS 64 64 64 HIS HIS A . n A 1 65 PRO 65 65 65 PRO PRO A . n A 1 66 ASN 66 66 66 ASN ASN A . n A 1 67 ILE 67 67 67 ILE ILE A . n A 1 68 VAL 68 68 68 VAL VAL A . n A 1 69 ARG 69 69 69 ARG ARG A . n A 1 70 TYR 70 70 70 TYR TYR A . n A 1 71 TYR 71 71 71 TYR TYR A . n A 1 72 ASP 72 72 72 ASP ASP A . n A 1 73 ARG 73 73 73 ARG ARG A . n A 1 74 ILE 74 74 74 ILE ILE A . n A 1 75 ILE 75 75 75 ILE ILE A . n A 1 76 ASP 76 76 76 ASP ASP A . n A 1 77 ARG 77 77 77 ARG ARG A . n A 1 78 THR 78 78 78 THR THR A . n A 1 79 ASN 79 79 79 ASN ASN A . n A 1 80 THR 80 80 80 THR THR A . n A 1 81 THR 81 81 81 THR THR A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 TYR 83 83 83 TYR TYR A . n A 1 84 ILE 84 84 84 ILE ILE A . n A 1 85 VAL 85 85 85 VAL VAL A . n A 1 86 MET 86 86 86 MET MET A . n A 1 87 GLU 87 87 87 GLU GLU A . n A 1 88 TYR 88 88 88 TYR TYR A . n A 1 89 CYS 89 89 89 CYS CYS A . n A 1 90 GLU 90 90 90 GLU GLU A . n A 1 91 GLY 91 91 91 GLY GLY A . n A 1 92 GLY 92 92 92 GLY GLY A . n A 1 93 ASP 93 93 93 ASP ASP A . n A 1 94 LEU 94 94 94 LEU LEU A . n A 1 95 ALA 95 95 95 ALA ALA A . n A 1 96 SER 96 96 96 SER SER A . n A 1 97 VAL 97 97 97 VAL VAL A . n A 1 98 ILE 98 98 98 ILE ILE A . n A 1 99 THR 99 99 99 THR THR A . n A 1 100 LYS 100 100 100 LYS LYS A . n A 1 101 GLY 101 101 101 GLY GLY A . n A 1 102 THR 102 102 102 THR THR A . n A 1 103 LYS 103 103 103 LYS LYS A . n A 1 104 GLU 104 104 104 GLU GLU A . n A 1 105 ARG 105 105 105 ARG ARG A . n A 1 106 GLN 106 106 106 GLN GLN A . n A 1 107 TYR 107 107 107 TYR TYR A . n A 1 108 LEU 108 108 108 LEU LEU A . n A 1 109 ASP 109 109 109 ASP ASP A . n A 1 110 GLU 110 110 110 GLU GLU A . n A 1 111 GLU 111 111 111 GLU GLU A . n A 1 112 PHE 112 112 112 PHE PHE A . n A 1 113 VAL 113 113 113 VAL VAL A . n A 1 114 LEU 114 114 114 LEU LEU A . n A 1 115 ARG 115 115 115 ARG ARG A . n A 1 116 VAL 116 116 116 VAL VAL A . n A 1 117 MET 117 117 117 MET MET A . n A 1 118 THR 118 118 118 THR THR A . n A 1 119 GLN 119 119 119 GLN GLN A . n A 1 120 LEU 120 120 120 LEU LEU A . n A 1 121 THR 121 121 121 THR THR A . n A 1 122 LEU 122 122 122 LEU LEU A . n A 1 123 ALA 123 123 123 ALA ALA A . n A 1 124 LEU 124 124 124 LEU LEU A . n A 1 125 LYS 125 125 125 LYS LYS A . n A 1 126 GLU 126 126 126 GLU GLU A . n A 1 127 CYS 127 127 127 CYS CYS A . n A 1 128 HIS 128 128 128 HIS HIS A . n A 1 129 ARG 129 129 129 ARG ARG A . n A 1 130 ARG 130 130 130 ARG ARG A . n A 1 131 SER 131 131 ? ? ? A . n A 1 132 ASP 132 132 ? ? ? A . n A 1 133 GLY 133 133 ? ? ? A . n A 1 134 GLY 134 134 ? ? ? A . n A 1 135 HIS 135 135 ? ? ? A . n A 1 136 THR 136 136 ? ? ? A . n A 1 137 VAL 137 137 ? ? ? A . n A 1 138 LEU 138 138 ? ? ? A . n A 1 139 HIS 139 139 ? ? ? A . n A 1 140 ARG 140 140 ? ? ? A . n A 1 141 ASP 141 141 ? ? ? A . n A 1 142 LEU 142 142 142 LEU LEU A . n A 1 143 LYS 143 143 143 LYS LYS A . n A 1 144 PRO 144 144 144 PRO PRO A . n A 1 145 ALA 145 145 145 ALA ALA A . n A 1 146 ASN 146 146 146 ASN ASN A . n A 1 147 VAL 147 147 147 VAL VAL A . n A 1 148 PHE 148 148 148 PHE PHE A . n A 1 149 LEU 149 149 149 LEU LEU A . n A 1 150 ASP 150 150 150 ASP ASP A . n A 1 151 GLY 151 151 151 GLY GLY A . n A 1 152 LYS 152 152 152 LYS LYS A . n A 1 153 GLN 153 153 153 GLN GLN A . n A 1 154 ASN 154 154 154 ASN ASN A . n A 1 155 VAL 155 155 155 VAL VAL A . n A 1 156 LYS 156 156 156 LYS LYS A . n A 1 157 LEU 157 157 157 LEU LEU A . n A 1 158 GLY 158 158 158 GLY GLY A . n A 1 159 ASP 159 159 159 ASP ASP A . n A 1 160 PHE 160 160 160 PHE PHE A . n A 1 161 GLY 161 161 ? ? ? A . n A 1 162 LEU 162 162 ? ? ? A . n A 1 163 ALA 163 163 ? ? ? A . n A 1 164 ARG 164 164 ? ? ? A . n A 1 165 ILE 165 165 ? ? ? A . n A 1 166 LEU 166 166 ? ? ? A . n A 1 167 ASN 167 167 ? ? ? A . n A 1 168 HIS 168 168 ? ? ? A . n A 1 169 ASP 169 169 ? ? ? A . n A 1 170 THR 170 170 ? ? ? A . n A 1 171 SER 171 171 ? ? ? A . n A 1 172 PHE 172 172 ? ? ? A . n A 1 173 ALA 173 173 ? ? ? A . n A 1 174 LYS 174 174 ? ? ? A . n A 1 175 THR 175 175 ? ? ? A . n A 1 176 PHE 176 176 ? ? ? A . n A 1 177 VAL 177 177 ? ? ? A . n A 1 178 GLY 178 178 178 GLY GLY A . n A 1 179 THR 179 179 179 THR THR A . n A 1 180 PRO 180 180 180 PRO PRO A . n A 1 181 TYR 181 181 181 TYR TYR A . n A 1 182 TYR 182 182 182 TYR TYR A . n A 1 183 MET 183 183 183 MET MET A . n A 1 184 SER 184 184 184 SER SER A . n A 1 185 PRO 185 185 185 PRO PRO A . n A 1 186 GLU 186 186 186 GLU GLU A . n A 1 187 GLN 187 187 187 GLN GLN A . n A 1 188 MET 188 188 188 MET MET A . n A 1 189 ASN 189 189 189 ASN ASN A . n A 1 190 ARG 190 190 ? ? ? A . n A 1 191 MET 191 191 ? ? ? A . n A 1 192 SER 192 192 ? ? ? A . n A 1 193 TYR 193 193 ? ? ? A . n A 1 194 ASN 194 194 194 ASN ASN A . n A 1 195 GLU 195 195 195 GLU GLU A . n A 1 196 LYS 196 196 196 LYS LYS A . n A 1 197 SER 197 197 197 SER SER A . n A 1 198 ASP 198 198 198 ASP ASP A . n A 1 199 ILE 199 199 199 ILE ILE A . n A 1 200 TRP 200 200 200 TRP TRP A . n A 1 201 SER 201 201 201 SER SER A . n A 1 202 LEU 202 202 202 LEU LEU A . n A 1 203 GLY 203 203 203 GLY GLY A . n A 1 204 CYS 204 204 204 CYS CYS A . n A 1 205 LEU 205 205 205 LEU LEU A . n A 1 206 LEU 206 206 206 LEU LEU A . n A 1 207 TYR 207 207 207 TYR TYR A . n A 1 208 GLU 208 208 208 GLU GLU A . n A 1 209 LEU 209 209 209 LEU LEU A . n A 1 210 CYS 210 210 210 CYS CYS A . n A 1 211 ALA 211 211 211 ALA ALA A . n A 1 212 LEU 212 212 212 LEU LEU A . n A 1 213 MET 213 213 213 MET MET A . n A 1 214 PRO 214 214 214 PRO PRO A . n A 1 215 PRO 215 215 215 PRO PRO A . n A 1 216 PHE 216 216 216 PHE PHE A . n A 1 217 THR 217 217 217 THR THR A . n A 1 218 ALA 218 218 218 ALA ALA A . n A 1 219 PHE 219 219 219 PHE PHE A . n A 1 220 SER 220 220 220 SER SER A . n A 1 221 GLN 221 221 221 GLN GLN A . n A 1 222 LYS 222 222 222 LYS LYS A . n A 1 223 GLU 223 223 223 GLU GLU A . n A 1 224 LEU 224 224 224 LEU LEU A . n A 1 225 ALA 225 225 225 ALA ALA A . n A 1 226 GLY 226 226 226 GLY GLY A . n A 1 227 LYS 227 227 227 LYS LYS A . n A 1 228 ILE 228 228 228 ILE ILE A . n A 1 229 ARG 229 229 229 ARG ARG A . n A 1 230 GLU 230 230 230 GLU GLU A . n A 1 231 GLY 231 231 231 GLY GLY A . n A 1 232 LYS 232 232 232 LYS LYS A . n A 1 233 PHE 233 233 233 PHE PHE A . n A 1 234 ARG 234 234 234 ARG ARG A . n A 1 235 ARG 235 235 235 ARG ARG A . n A 1 236 ILE 236 236 236 ILE ILE A . n A 1 237 PRO 237 237 237 PRO PRO A . n A 1 238 TYR 238 238 238 TYR TYR A . n A 1 239 ARG 239 239 239 ARG ARG A . n A 1 240 TYR 240 240 240 TYR TYR A . n A 1 241 SER 241 241 241 SER SER A . n A 1 242 ASP 242 242 242 ASP ASP A . n A 1 243 GLU 243 243 243 GLU GLU A . n A 1 244 LEU 244 244 244 LEU LEU A . n A 1 245 ASN 245 245 245 ASN ASN A . n A 1 246 GLU 246 246 246 GLU GLU A . n A 1 247 ILE 247 247 247 ILE ILE A . n A 1 248 ILE 248 248 248 ILE ILE A . n A 1 249 THR 249 249 249 THR THR A . n A 1 250 ARG 250 250 250 ARG ARG A . n A 1 251 MET 251 251 251 MET MET A . n A 1 252 LEU 252 252 252 LEU LEU A . n A 1 253 ASN 253 253 253 ASN ASN A . n A 1 254 LEU 254 254 254 LEU LEU A . n A 1 255 LYS 255 255 255 LYS LYS A . n A 1 256 ASP 256 256 256 ASP ASP A . n A 1 257 TYR 257 257 257 TYR TYR A . n A 1 258 HIS 258 258 258 HIS HIS A . n A 1 259 ARG 259 259 259 ARG ARG A . n A 1 260 PRO 260 260 260 PRO PRO A . n A 1 261 SER 261 261 261 SER SER A . n A 1 262 VAL 262 262 262 VAL VAL A . n A 1 263 GLU 263 263 263 GLU GLU A . n A 1 264 GLU 264 264 264 GLU GLU A . n A 1 265 ILE 265 265 265 ILE ILE A . n A 1 266 LEU 266 266 266 LEU LEU A . n A 1 267 GLU 267 267 267 GLU GLU A . n A 1 268 ASN 268 268 268 ASN ASN A . n A 1 269 PRO 269 269 269 PRO PRO A . n A 1 270 LEU 270 270 270 LEU LEU A . n A 1 271 ILE 271 271 271 ILE ILE A . n A 1 272 LEU 272 272 272 LEU LEU A . n A 1 273 GLU 273 273 273 GLU GLU A . n A 1 274 HIS 274 274 274 HIS HIS A . n A 1 275 HIS 275 275 275 HIS HIS A . n A 1 276 HIS 276 276 276 HIS HIS A . n A 1 277 HIS 277 277 277 HIS HIS A . n A 1 278 HIS 278 278 278 HIS HIS A . n A 1 279 HIS 279 279 279 HIS HIS A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 F9N 1 301 301 F9N F9N A . C 3 GOL 1 302 302 GOL GOL A . D 4 HOH 1 401 60 HOH HOH A . D 4 HOH 2 402 48 HOH HOH A . D 4 HOH 3 403 49 HOH HOH A . D 4 HOH 4 404 94 HOH HOH A . D 4 HOH 5 405 46 HOH HOH A . D 4 HOH 6 406 56 HOH HOH A . D 4 HOH 7 407 43 HOH HOH A . D 4 HOH 8 408 29 HOH HOH A . D 4 HOH 9 409 45 HOH HOH A . D 4 HOH 10 410 54 HOH HOH A . D 4 HOH 11 411 1 HOH HOH A . D 4 HOH 12 412 13 HOH HOH A . D 4 HOH 13 413 64 HOH HOH A . D 4 HOH 14 414 2 HOH HOH A . D 4 HOH 15 415 12 HOH HOH A . D 4 HOH 16 416 32 HOH HOH A . D 4 HOH 17 417 55 HOH HOH A . D 4 HOH 18 418 73 HOH HOH A . D 4 HOH 19 419 7 HOH HOH A . D 4 HOH 20 420 35 HOH HOH A . D 4 HOH 21 421 5 HOH HOH A . D 4 HOH 22 422 44 HOH HOH A . D 4 HOH 23 423 9 HOH HOH A . D 4 HOH 24 424 4 HOH HOH A . D 4 HOH 25 425 6 HOH HOH A . D 4 HOH 26 426 11 HOH HOH A . D 4 HOH 27 427 10 HOH HOH A . D 4 HOH 28 428 37 HOH HOH A . D 4 HOH 29 429 50 HOH HOH A . D 4 HOH 30 430 51 HOH HOH A . D 4 HOH 31 431 15 HOH HOH A . D 4 HOH 32 432 81 HOH HOH A . D 4 HOH 33 433 31 HOH HOH A . D 4 HOH 34 434 17 HOH HOH A . D 4 HOH 35 435 16 HOH HOH A . D 4 HOH 36 436 38 HOH HOH A . D 4 HOH 37 437 14 HOH HOH A . D 4 HOH 38 438 19 HOH HOH A . D 4 HOH 39 439 79 HOH HOH A . D 4 HOH 40 440 8 HOH HOH A . D 4 HOH 41 441 36 HOH HOH A . D 4 HOH 42 442 30 HOH HOH A . D 4 HOH 43 443 18 HOH HOH A . D 4 HOH 44 444 34 HOH HOH A . D 4 HOH 45 445 80 HOH HOH A . D 4 HOH 46 446 33 HOH HOH A . D 4 HOH 47 447 71 HOH HOH A . D 4 HOH 48 448 76 HOH HOH A . D 4 HOH 49 449 92 HOH HOH A . D 4 HOH 50 450 57 HOH HOH A . D 4 HOH 51 451 3 HOH HOH A . D 4 HOH 52 452 23 HOH HOH A . D 4 HOH 53 453 67 HOH HOH A . D 4 HOH 54 454 62 HOH HOH A . D 4 HOH 55 455 53 HOH HOH A . D 4 HOH 56 456 65 HOH HOH A . D 4 HOH 57 457 63 HOH HOH A . D 4 HOH 58 458 91 HOH HOH A . D 4 HOH 59 459 77 HOH HOH A . D 4 HOH 60 460 47 HOH HOH A . D 4 HOH 61 461 58 HOH HOH A . D 4 HOH 62 462 61 HOH HOH A . D 4 HOH 63 463 24 HOH HOH A . D 4 HOH 64 464 86 HOH HOH A . D 4 HOH 65 465 84 HOH HOH A . D 4 HOH 66 466 66 HOH HOH A . D 4 HOH 67 467 78 HOH HOH A . D 4 HOH 68 468 20 HOH HOH A . D 4 HOH 69 469 21 HOH HOH A . D 4 HOH 70 470 22 HOH HOH A . D 4 HOH 71 471 28 HOH HOH A . D 4 HOH 72 472 52 HOH HOH A . D 4 HOH 73 473 93 HOH HOH A . D 4 HOH 74 474 69 HOH HOH A . D 4 HOH 75 475 41 HOH HOH A . D 4 HOH 76 476 39 HOH HOH A . D 4 HOH 77 477 68 HOH HOH A . D 4 HOH 78 478 25 HOH HOH A . D 4 HOH 79 479 72 HOH HOH A . D 4 HOH 80 480 74 HOH HOH A . D 4 HOH 81 481 83 HOH HOH A . D 4 HOH 82 482 75 HOH HOH A . D 4 HOH 83 483 85 HOH HOH A . D 4 HOH 84 484 90 HOH HOH A . D 4 HOH 85 485 87 HOH HOH A . D 4 HOH 86 486 88 HOH HOH A . D 4 HOH 87 487 40 HOH HOH A . D 4 HOH 88 488 70 HOH HOH A . D 4 HOH 89 489 82 HOH HOH A . D 4 HOH 90 490 26 HOH HOH A . D 4 HOH 91 491 89 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 150 ? 1 MORE -0 ? 1 'SSA (A^2)' 12820 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2020-06-17 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined -20.5901381474 3.13010828931 -2.37252781501 1.08014539247 ? -0.165101612832 ? -0.138885618425 ? 1.06887217215 ? -0.172488927764 ? 0.918150127625 ? 0.145687895249 ? -0.254252203258 ? -0.177054850654 ? 0.362391370683 ? 0.297566774224 ? 0.218656486017 ? -0.568118429916 ? 0.539844608836 ? -0.189262739243 ? -0.382249839721 ? 0.173092458442 ? 0.303603252318 ? 0.0838166041076 ? 0.0851936166178 ? 0.253849897705 ? 2 'X-RAY DIFFRACTION' ? refined -16.0201089386 9.81374402958 17.9139890879 0.233586743801 ? -0.00143108882426 ? 0.0170400582741 ? 0.295433047044 ? -0.0159779169875 ? 0.196507575778 ? 3.74938299961 ? 1.59081904866 ? 0.869324872244 ? 2.69137153089 ? 0.452473895379 ? 1.28595946849 ? -0.0940864985905 ? 0.347801193175 ? 0.0305508744139 ? -0.310877393236 ? -0.0161674023021 ? 0.0632925930382 ? 0.016589928777 ? -0.297650598727 ? 0.110622974936 ? 3 'X-RAY DIFFRACTION' ? refined -4.05306771829 20.5089702655 21.6880768725 0.235408737689 ? -0.0225736552152 ? -0.0101225492796 ? 0.204245114033 ? -0.012855010543 ? 0.243425169919 ? 1.74502857428 ? 0.63118341781 ? -0.239489008066 ? 2.87462262545 ? 0.332419550159 ? 2.31806001935 ? -0.144860184892 ? 0.198330291005 ? 0.0571780433061 ? -0.203009734036 ? 0.0712426020233 ? -0.151533697016 ? -0.183865661578 ? 0.00616443266876 ? 0.0713149634885 ? 4 'X-RAY DIFFRACTION' ? refined -31.7767174533 0.606596276967 13.1715745637 0.298237327282 ? -0.0783946212133 ? -0.0464659868424 ? 0.440195496832 ? -0.0725712221366 ? 0.39941541272 ? 2.04817243827 ? -0.0962826837241 ? 0.071860653341 ? 2.07148950144 ? -0.119483991659 ? 3.7885956441 ? -0.0527099706791 ? 0.612347106647 ? -0.434912672059 ? -0.514372914671 ? 0.169132268951 ? 0.453054481176 ? 0.107012257275 ? -0.194817805864 ? -0.0106188387096 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 45 through 59 ) ; 2 'X-RAY DIFFRACTION' 2 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 60 through 194 ) ; 3 'X-RAY DIFFRACTION' 3 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 195 through 279 ) ; 4 'X-RAY DIFFRACTION' 4 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 4 through 44) ; # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.9_1692 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? MOSFLM ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALA ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _pdbx_entry_details.entry_id 6SK9 _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 49 ? ? -49.30 -19.60 2 1 GLN A 153 ? ? 72.28 -3.76 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 6 ? CG ? A GLU 6 CG 2 1 Y 1 A GLU 6 ? CD ? A GLU 6 CD 3 1 Y 1 A GLU 6 ? OE1 ? A GLU 6 OE1 4 1 Y 1 A GLU 6 ? OE2 ? A GLU 6 OE2 5 1 Y 1 A GLU 9 ? CG ? A GLU 9 CG 6 1 Y 1 A GLU 9 ? CD ? A GLU 9 CD 7 1 Y 1 A GLU 9 ? OE1 ? A GLU 9 OE1 8 1 Y 1 A GLU 9 ? OE2 ? A GLU 9 OE2 9 1 Y 1 A THR 45 ? OG1 ? A THR 45 OG1 10 1 Y 1 A THR 45 ? CG2 ? A THR 45 CG2 11 1 Y 1 A GLU 46 ? CG ? A GLU 46 CG 12 1 Y 1 A GLU 46 ? CD ? A GLU 46 CD 13 1 Y 1 A GLU 46 ? OE1 ? A GLU 46 OE1 14 1 Y 1 A GLU 46 ? OE2 ? A GLU 46 OE2 15 1 Y 1 A LYS 49 ? CG ? A LYS 49 CG 16 1 Y 1 A LYS 49 ? CD ? A LYS 49 CD 17 1 Y 1 A LYS 49 ? CE ? A LYS 49 CE 18 1 Y 1 A LYS 49 ? NZ ? A LYS 49 NZ 19 1 Y 1 A GLN 50 ? CG ? A GLN 50 CG 20 1 Y 1 A GLN 50 ? CD ? A GLN 50 CD 21 1 Y 1 A GLN 50 ? OE1 ? A GLN 50 OE1 22 1 Y 1 A GLN 50 ? NE2 ? A GLN 50 NE2 23 1 Y 1 A MET 51 ? CG ? A MET 51 CG 24 1 Y 1 A MET 51 ? SD ? A MET 51 SD 25 1 Y 1 A MET 51 ? CE ? A MET 51 CE 26 1 Y 1 A LEU 52 ? CG ? A LEU 52 CG 27 1 Y 1 A LEU 52 ? CD1 ? A LEU 52 CD1 28 1 Y 1 A LEU 52 ? CD2 ? A LEU 52 CD2 29 1 Y 1 A VAL 53 ? CG1 ? A VAL 53 CG1 30 1 Y 1 A VAL 53 ? CG2 ? A VAL 53 CG2 31 1 Y 1 A SER 54 ? OG ? A SER 54 OG 32 1 Y 1 A GLU 55 ? CG ? A GLU 55 CG 33 1 Y 1 A GLU 55 ? CD ? A GLU 55 CD 34 1 Y 1 A GLU 55 ? OE1 ? A GLU 55 OE1 35 1 Y 1 A GLU 55 ? OE2 ? A GLU 55 OE2 36 1 Y 1 A VAL 56 ? CG1 ? A VAL 56 CG1 37 1 Y 1 A VAL 56 ? CG2 ? A VAL 56 CG2 38 1 Y 1 A ASN 57 ? CG ? A ASN 57 CG 39 1 Y 1 A ASN 57 ? OD1 ? A ASN 57 OD1 40 1 Y 1 A ASN 57 ? ND2 ? A ASN 57 ND2 41 1 Y 1 A LEU 58 ? CG ? A LEU 58 CG 42 1 Y 1 A LEU 58 ? CD1 ? A LEU 58 CD1 43 1 Y 1 A LEU 58 ? CD2 ? A LEU 58 CD2 44 1 Y 1 A ARG 60 ? CG ? A ARG 60 CG 45 1 Y 1 A ARG 60 ? CD ? A ARG 60 CD 46 1 Y 1 A ARG 60 ? NE ? A ARG 60 NE 47 1 Y 1 A ARG 60 ? CZ ? A ARG 60 CZ 48 1 Y 1 A ARG 60 ? NH1 ? A ARG 60 NH1 49 1 Y 1 A ARG 60 ? NH2 ? A ARG 60 NH2 50 1 Y 1 A GLU 61 ? CG ? A GLU 61 CG 51 1 Y 1 A GLU 61 ? CD ? A GLU 61 CD 52 1 Y 1 A GLU 61 ? OE1 ? A GLU 61 OE1 53 1 Y 1 A GLU 61 ? OE2 ? A GLU 61 OE2 54 1 Y 1 A LYS 63 ? CG ? A LYS 63 CG 55 1 Y 1 A LYS 63 ? CD ? A LYS 63 CD 56 1 Y 1 A LYS 63 ? CE ? A LYS 63 CE 57 1 Y 1 A LYS 63 ? NZ ? A LYS 63 NZ 58 1 Y 1 A ARG 73 ? CG ? A ARG 73 CG 59 1 Y 1 A ARG 73 ? CD ? A ARG 73 CD 60 1 Y 1 A ARG 73 ? NE ? A ARG 73 NE 61 1 Y 1 A ARG 73 ? CZ ? A ARG 73 CZ 62 1 Y 1 A ARG 73 ? NH1 ? A ARG 73 NH1 63 1 Y 1 A ARG 73 ? NH2 ? A ARG 73 NH2 64 1 Y 1 A LYS 103 ? CG ? A LYS 103 CG 65 1 Y 1 A LYS 103 ? CD ? A LYS 103 CD 66 1 Y 1 A LYS 103 ? CE ? A LYS 103 CE 67 1 Y 1 A LYS 103 ? NZ ? A LYS 103 NZ 68 1 Y 1 A ARG 105 ? CG ? A ARG 105 CG 69 1 Y 1 A ARG 105 ? CD ? A ARG 105 CD 70 1 Y 1 A ARG 105 ? NE ? A ARG 105 NE 71 1 Y 1 A ARG 105 ? CZ ? A ARG 105 CZ 72 1 Y 1 A ARG 105 ? NH1 ? A ARG 105 NH1 73 1 Y 1 A ARG 105 ? NH2 ? A ARG 105 NH2 74 1 Y 1 A ARG 130 ? CG ? A ARG 130 CG 75 1 Y 1 A ARG 130 ? CD ? A ARG 130 CD 76 1 Y 1 A ARG 130 ? NE ? A ARG 130 NE 77 1 Y 1 A ARG 130 ? CZ ? A ARG 130 CZ 78 1 Y 1 A ARG 130 ? NH1 ? A ARG 130 NH1 79 1 Y 1 A ARG 130 ? NH2 ? A ARG 130 NH2 80 1 Y 1 A PHE 160 ? CG ? A PHE 160 CG 81 1 Y 1 A PHE 160 ? CD1 ? A PHE 160 CD1 82 1 Y 1 A PHE 160 ? CD2 ? A PHE 160 CD2 83 1 Y 1 A PHE 160 ? CE1 ? A PHE 160 CE1 84 1 Y 1 A PHE 160 ? CE2 ? A PHE 160 CE2 85 1 Y 1 A PHE 160 ? CZ ? A PHE 160 CZ 86 1 Y 1 A LYS 222 ? CG ? A LYS 222 CG 87 1 Y 1 A LYS 222 ? CD ? A LYS 222 CD 88 1 Y 1 A LYS 222 ? CE ? A LYS 222 CE 89 1 Y 1 A LYS 222 ? NZ ? A LYS 222 NZ 90 1 Y 1 A GLU 230 ? CG ? A GLU 230 CG 91 1 Y 1 A GLU 230 ? CD ? A GLU 230 CD 92 1 Y 1 A GLU 230 ? OE1 ? A GLU 230 OE1 93 1 Y 1 A GLU 230 ? OE2 ? A GLU 230 OE2 94 1 Y 1 A LYS 255 ? CG ? A LYS 255 CG 95 1 Y 1 A LYS 255 ? CD ? A LYS 255 CD 96 1 Y 1 A LYS 255 ? CE ? A LYS 255 CE 97 1 Y 1 A LYS 255 ? NZ ? A LYS 255 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A PRO 2 ? A PRO 2 3 1 Y 1 A SER 3 ? A SER 3 4 1 Y 1 A GLY 17 ? A GLY 17 5 1 Y 1 A SER 18 ? A SER 18 6 1 Y 1 A TYR 19 ? A TYR 19 7 1 Y 1 A GLY 20 ? A GLY 20 8 1 Y 1 A SER 131 ? A SER 131 9 1 Y 1 A ASP 132 ? A ASP 132 10 1 Y 1 A GLY 133 ? A GLY 133 11 1 Y 1 A GLY 134 ? A GLY 134 12 1 Y 1 A HIS 135 ? A HIS 135 13 1 Y 1 A THR 136 ? A THR 136 14 1 Y 1 A VAL 137 ? A VAL 137 15 1 Y 1 A LEU 138 ? A LEU 138 16 1 Y 1 A HIS 139 ? A HIS 139 17 1 Y 1 A ARG 140 ? A ARG 140 18 1 Y 1 A ASP 141 ? A ASP 141 19 1 Y 1 A GLY 161 ? A GLY 161 20 1 Y 1 A LEU 162 ? A LEU 162 21 1 Y 1 A ALA 163 ? A ALA 163 22 1 Y 1 A ARG 164 ? A ARG 164 23 1 Y 1 A ILE 165 ? A ILE 165 24 1 Y 1 A LEU 166 ? A LEU 166 25 1 Y 1 A ASN 167 ? A ASN 167 26 1 Y 1 A HIS 168 ? A HIS 168 27 1 Y 1 A ASP 169 ? A ASP 169 28 1 Y 1 A THR 170 ? A THR 170 29 1 Y 1 A SER 171 ? A SER 171 30 1 Y 1 A PHE 172 ? A PHE 172 31 1 Y 1 A ALA 173 ? A ALA 173 32 1 Y 1 A LYS 174 ? A LYS 174 33 1 Y 1 A THR 175 ? A THR 175 34 1 Y 1 A PHE 176 ? A PHE 176 35 1 Y 1 A VAL 177 ? A VAL 177 36 1 Y 1 A ARG 190 ? A ARG 190 37 1 Y 1 A MET 191 ? A MET 191 38 1 Y 1 A SER 192 ? A SER 192 39 1 Y 1 A TYR 193 ? A TYR 193 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Cancer Research UK' 'United Kingdom' 'C24461/ A13231' 1 'Medical Research Council (United Kingdom)' 'United Kingdom' MR/L017032/1 2 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id F9N _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id F9N _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '3-[[6-(cyclohexylmethoxy)-7~{H}-purin-2-yl]amino]-~{N}-[3-(dimethylamino)propyl]benzenesulfonamide' F9N 3 GLYCEROL GOL 4 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _space_group.name_H-M_alt 'C 1 2 1' _space_group.name_Hall 'C 2y' _space_group.IT_number 5 _space_group.crystal_system monoclinic _space_group.id 1 # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -x,y,-z 3 x+1/2,y+1/2,z 4 -x+1/2,y+1/2,-z #