data_6SO0 # _entry.id 6SO0 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6SO0 pdb_00006so0 10.2210/pdb6so0/pdb WWPDB D_1292104007 ? ? BMRB 27277 ? ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.details . _pdbx_database_related.db_id 27277 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 6SO0 _pdbx_database_status.recvd_initial_deposition_date 2019-08-28 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Madland, E.' 1 0000-0001-7124-2638 'Crasson, O.' 2 ? 'Vandevenne, M.' 3 0000-0002-4492-2635 'Sorlie, M.' 4 0000-0001-7259-6710 'Aachmann, F.L.' 5 0000-0003-1613-4663 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Acs Omega' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2470-1343 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 4 _citation.language ? _citation.page_first 21975 _citation.page_last 21984 _citation.title ;NMR and Fluorescence Spectroscopies Reveal the Preorganized Binding Site in Family 14 Carbohydrate-Binding Module from Human Chitotriosidase. ; _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acsomega.9b03043 _citation.pdbx_database_id_PubMed 31891077 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Madland, E.' 1 ? primary 'Crasson, O.' 2 ? primary 'Vandevenne, M.' 3 ? primary 'Sorlie, M.' 4 ? primary 'Aachmann, F.L.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description Chitotriosidase-1 _entity.formula_weight 6201.022 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 3.2.1.14 _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name Chitinase-1 # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSPTFCQGKADGLYPNPRERSSFYSCAAGRLFQQSCPTGLVFSNSCKCCTWNGLVPR _entity_poly.pdbx_seq_one_letter_code_can GSPTFCQGKADGLYPNPRERSSFYSCAAGRLFQQSCPTGLVFSNSCKCCTWNGLVPR _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 PRO n 1 4 THR n 1 5 PHE n 1 6 CYS n 1 7 GLN n 1 8 GLY n 1 9 LYS n 1 10 ALA n 1 11 ASP n 1 12 GLY n 1 13 LEU n 1 14 TYR n 1 15 PRO n 1 16 ASN n 1 17 PRO n 1 18 ARG n 1 19 GLU n 1 20 ARG n 1 21 SER n 1 22 SER n 1 23 PHE n 1 24 TYR n 1 25 SER n 1 26 CYS n 1 27 ALA n 1 28 ALA n 1 29 GLY n 1 30 ARG n 1 31 LEU n 1 32 PHE n 1 33 GLN n 1 34 GLN n 1 35 SER n 1 36 CYS n 1 37 PRO n 1 38 THR n 1 39 GLY n 1 40 LEU n 1 41 VAL n 1 42 PHE n 1 43 SER n 1 44 ASN n 1 45 SER n 1 46 CYS n 1 47 LYS n 1 48 CYS n 1 49 CYS n 1 50 THR n 1 51 TRP n 1 52 ASN n 1 53 GLY n 1 54 LEU n 1 55 VAL n 1 56 PRO n 1 57 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 57 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene CHIT1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CHIT1_HUMAN _struct_ref.pdbx_db_accession Q13231 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code TFCQGKADGLYPNPRERSSFYSCAAGRLFQQSCPTGLVFSNSCKCCTWN _struct_ref.pdbx_align_begin 418 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6SO0 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 52 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q13231 _struct_ref_seq.db_align_beg 418 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 466 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 4 _struct_ref_seq.pdbx_auth_seq_align_end 52 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6SO0 GLY A 1 ? UNP Q13231 ? ? 'expression tag' 1 1 1 6SO0 SER A 2 ? UNP Q13231 ? ? 'expression tag' 2 2 1 6SO0 PRO A 3 ? UNP Q13231 ? ? 'expression tag' 3 3 1 6SO0 GLY A 53 ? UNP Q13231 ? ? 'expression tag' 53 4 1 6SO0 LEU A 54 ? UNP Q13231 ? ? 'expression tag' 54 5 1 6SO0 VAL A 55 ? UNP Q13231 ? ? 'expression tag' 55 6 1 6SO0 PRO A 56 ? UNP Q13231 ? ? 'expression tag' 56 7 1 6SO0 ARG A 57 ? UNP Q13231 ? ? 'expression tag' 57 8 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 1 isotropic 2 1 1 '3D 1H-15N TOCSY' 1 isotropic 3 1 2 '2D 1H-13C HSQC aliphatic' 1 isotropic 4 1 2 '3D HNCA' 1 isotropic 5 1 2 '3D HNCO' 1 isotropic 6 1 2 '3D CBCA(CO)NH' 1 isotropic 7 1 2 '3D HNCACB' 1 isotropic 9 1 2 '3D HN(CO)CA' 1 isotropic 8 1 2 '3D HCCH-TOCSY' 1 isotropic 14 1 2 '3D H(CCO)NH' 1 isotropic 13 1 2 '3D 1H-15N NOESY' 1 isotropic 12 1 2 '3D 1H-13C NOESY aliphatic' 1 isotropic 11 2 3 '2D 1H-1H NOESY' 1 isotropic 10 2 3 '2D 1H-1H COSY' 1 isotropic 15 2 3 '2D 1H-1H TOCSY' 1 isotropic # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.details _pdbx_nmr_exptl_sample_conditions.ionic_strength_err _pdbx_nmr_exptl_sample_conditions.ionic_strength_units _pdbx_nmr_exptl_sample_conditions.label _pdbx_nmr_exptl_sample_conditions.pH_err _pdbx_nmr_exptl_sample_conditions.pH_units _pdbx_nmr_exptl_sample_conditions.pressure_err _pdbx_nmr_exptl_sample_conditions.temperature_err _pdbx_nmr_exptl_sample_conditions.temperature_units 1 298.1 atm 1 5.5 0.11 ? ? M conditions_1 ? pH ? ? K 2 298.1 atm 1 5.5 0.11 'Sample was freeze dried and dissolved in D2O' ? M conditions_2 ? pH ? ? K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 '0.1 mM [U-98% 15N] CBM14, 50 mM sodium phosphate, 90% H2O/10% D2O' '90% H2O/10% D2O' 15N_sample solution ? 2 '0.1 mM [U-98% 13C; U-98% 15N] CBM14, 50 mM sodium phosphate, 90% H2O/10% D2O' '90% H2O/10% D2O' 13C_15N_sample solution ? 3 '0.1 mM CBM14, 50 mM sodium phosphate, 100% D2O' '100% D2O' D2O_sample solution ? # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AVANCE III' _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.details ? # _pdbx_nmr_refine.entry_id 6SO0 _pdbx_nmr_refine.method 'molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 5 # _pdbx_nmr_ensemble.entry_id 6SO0 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 6SO0 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'target function' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 collection TopSpin ? 'Bruker Biospin' 2 'structure calculation' CYANA 3.97 'Guntert, Mumenthaler and Wuthrich' 3 'data analysis' CARA 1.5 'Keller and Wuthrich' 4 'data analysis' XEASY ? 'Bartels et al.' 5 refinement YASARA ? 'Krieger, Darden, Nabuurs, Finkelstein, Vriend' # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6SO0 _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 6SO0 _struct.title 'NMR solution structure of the family 14 carbohydrate binding module (CBM14) from human chitotriosidase' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6SO0 _struct_keywords.text 'CBM, hevein like fold, chitin binding, chitotriosidase, SUGAR BINDING PROTEIN' _struct_keywords.pdbx_keywords 'SUGAR BINDING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 6 SG ? ? ? 1_555 A CYS 26 SG ? ? A CYS 6 A CYS 26 1_555 ? ? ? ? ? ? ? 2.032 ? ? disulf2 disulf ? ? A CYS 36 SG ? ? ? 1_555 A CYS 49 SG ? ? A CYS 36 A CYS 49 1_555 ? ? ? ? ? ? ? 2.029 ? ? disulf3 disulf ? ? A CYS 46 SG ? ? ? 1_555 A CYS 48 SG ? ? A CYS 46 A CYS 48 1_555 ? ? ? ? ? ? ? 2.040 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 3 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLY A 12 ? PRO A 15 ? GLY A 12 PRO A 15 AA1 2 SER A 22 ? ALA A 27 ? SER A 22 ALA A 27 AA1 3 ARG A 30 ? SER A 35 ? ARG A 30 SER A 35 AA2 1 LEU A 40 ? SER A 43 ? LEU A 40 SER A 43 AA2 2 CYS A 48 ? TRP A 51 ? CYS A 48 TRP A 51 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N TYR A 14 ? N TYR A 14 O TYR A 24 ? O TYR A 24 AA1 2 3 N SER A 25 ? N SER A 25 O PHE A 32 ? O PHE A 32 AA2 1 2 N VAL A 41 ? N VAL A 41 O THR A 50 ? O THR A 50 # _atom_sites.entry_id 6SO0 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 PRO 3 3 3 PRO PRO A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 PHE 5 5 5 PHE PHE A . n A 1 6 CYS 6 6 6 CYS CYS A . n A 1 7 GLN 7 7 7 GLN GLN A . n A 1 8 GLY 8 8 8 GLY GLY A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 ASP 11 11 11 ASP ASP A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 TYR 14 14 14 TYR TYR A . n A 1 15 PRO 15 15 15 PRO PRO A . n A 1 16 ASN 16 16 16 ASN ASN A . n A 1 17 PRO 17 17 17 PRO PRO A . n A 1 18 ARG 18 18 18 ARG ARG A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 ARG 20 20 20 ARG ARG A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 PHE 23 23 23 PHE PHE A . n A 1 24 TYR 24 24 24 TYR TYR A . n A 1 25 SER 25 25 25 SER SER A . n A 1 26 CYS 26 26 26 CYS CYS A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 ARG 30 30 30 ARG ARG A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 PHE 32 32 32 PHE PHE A . n A 1 33 GLN 33 33 33 GLN GLN A . n A 1 34 GLN 34 34 34 GLN GLN A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 CYS 36 36 36 CYS CYS A . n A 1 37 PRO 37 37 37 PRO PRO A . n A 1 38 THR 38 38 38 THR THR A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 PHE 42 42 42 PHE PHE A . n A 1 43 SER 43 43 43 SER SER A . n A 1 44 ASN 44 44 44 ASN ASN A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 CYS 46 46 46 CYS CYS A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 CYS 48 48 48 CYS CYS A . n A 1 49 CYS 49 49 49 CYS CYS A . n A 1 50 THR 50 50 50 THR THR A . n A 1 51 TRP 51 51 51 TRP TRP A . n A 1 52 ASN 52 52 52 ASN ASN A . n A 1 53 GLY 53 53 53 GLY GLY A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 PRO 56 56 56 PRO PRO A . n A 1 57 ARG 57 57 57 ARG ARG A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 4690 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-01-15 2 'Structure model' 1 1 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 2 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' database_2 2 2 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_database_status.status_code_nmr_data' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 CBM14 0.1 ? mM '[U-98% 15N]' 1 'sodium phosphate' 50 ? mM 'natural abundance' 2 CBM14 0.1 ? mM '[U-98% 13C; U-98% 15N]' 2 'sodium phosphate' 50 ? mM 'natural abundance' 3 CBM14 0.1 ? mM 'natural abundance' 3 'sodium phosphate' 50 ? mM 'natural abundance' # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 18 _pdbx_validate_close_contact.auth_atom_id_1 HG1 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 THR _pdbx_validate_close_contact.auth_seq_id_1 38 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 HE1 _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 TRP _pdbx_validate_close_contact.auth_seq_id_2 51 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.29 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 3 NE A ARG 18 ? ? CZ A ARG 18 ? ? NH2 A ARG 18 ? ? 123.43 120.30 3.13 0.50 N 2 11 NE A ARG 18 ? ? CZ A ARG 18 ? ? NH2 A ARG 18 ? ? 123.31 120.30 3.01 0.50 N 3 16 NE A ARG 18 ? ? CZ A ARG 18 ? ? NH2 A ARG 18 ? ? 124.52 120.30 4.22 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 18 ? ? -137.00 -50.42 2 1 SER A 21 ? ? -143.43 35.29 3 2 PRO A 37 ? ? -81.39 -92.16 4 3 PRO A 37 ? ? -82.53 -74.23 5 4 PRO A 37 ? ? -85.77 -78.02 6 5 ARG A 18 ? ? -162.30 -79.81 7 5 GLU A 19 ? ? 36.25 -105.57 8 5 ARG A 20 ? ? -154.97 -61.86 9 5 SER A 21 ? ? -150.94 37.94 10 6 ARG A 18 ? ? -140.48 -36.45 11 6 PRO A 37 ? ? -78.74 -106.81 12 6 ASN A 52 ? ? -83.58 30.09 13 7 ARG A 18 ? ? -136.29 -44.72 14 8 SER A 2 ? ? 52.18 70.73 15 8 ARG A 18 ? ? -147.42 -44.41 16 8 PRO A 37 ? ? -79.44 -91.34 17 9 ARG A 18 ? ? -163.76 -78.84 18 9 GLU A 19 ? ? 38.62 -129.22 19 9 ARG A 20 ? ? -136.43 -55.93 20 9 SER A 21 ? ? -156.56 47.40 21 10 THR A 4 ? ? -86.24 30.79 22 10 LEU A 40 ? ? -46.55 104.73 23 11 ARG A 18 ? ? -146.01 -47.06 24 11 PRO A 37 ? ? -84.98 -96.75 25 11 ASN A 52 ? ? -68.06 1.32 26 12 THR A 4 ? ? 61.72 -0.48 27 12 PRO A 37 ? ? -79.79 -89.17 28 13 ARG A 18 ? ? -156.26 -78.34 29 13 GLU A 19 ? ? 34.43 -120.12 30 13 ARG A 20 ? ? -155.82 -56.99 31 13 SER A 21 ? ? -153.68 39.79 32 14 ARG A 18 ? ? -133.95 -59.77 33 14 PRO A 37 ? ? -75.45 -84.90 34 16 PRO A 37 ? ? -91.83 -119.13 35 17 THR A 4 ? ? 48.03 26.23 36 17 ARG A 18 ? ? -144.06 -29.67 37 17 ARG A 20 ? ? -134.96 -56.05 38 17 PRO A 37 ? ? -71.86 -87.60 39 18 ARG A 20 ? ? -172.47 -101.53 40 20 SER A 2 ? ? 66.26 151.69 41 20 THR A 4 ? ? 62.03 -2.32 # _pdbx_audit_support.funding_organization 'Research Council of Norway' _pdbx_audit_support.country Norway _pdbx_audit_support.grant_number 226244 _pdbx_audit_support.ordinal 1 # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #