data_6SOW # _entry.id 6SOW # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6SOW pdb_00006sow 10.2210/pdb6sow/pdb WWPDB D_1292103989 ? ? BMRB 34430 ? ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'NMR solution structure of staphylococcal protein A, C domain' _pdbx_database_related.db_id 34430 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 6SOW _pdbx_database_status.recvd_initial_deposition_date 2019-08-30 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Backlund, S.M.' 1 ? 'Iwai, H.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country CH _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Molecules _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1420-3049 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 26 _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'NMR Structure Determinations of Small Proteins Using only One Fractionally 20% 13 C- and Uniformly 100% 15 N-Labeled Sample.' _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.3390/molecules26030747 _citation.pdbx_database_id_PubMed 33535444 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Heikkinen, H.A.' 1 0000-0002-0240-6528 primary 'Backlund, S.M.' 2 ? primary 'Iwai, H.' 3 0000-0001-7376-5264 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Immunoglobulin G binding protein A' _entity.formula_weight 6653.353 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code SDNKFNKEQQNAFYEILHLPNLTEEQRNGFIQSLKDDPSVSKEILAEAKKLNDAQAPK _entity_poly.pdbx_seq_one_letter_code_can SDNKFNKEQQNAFYEILHLPNLTEEQRNGFIQSLKDDPSVSKEILAEAKKLNDAQAPK _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 ASP n 1 3 ASN n 1 4 LYS n 1 5 PHE n 1 6 ASN n 1 7 LYS n 1 8 GLU n 1 9 GLN n 1 10 GLN n 1 11 ASN n 1 12 ALA n 1 13 PHE n 1 14 TYR n 1 15 GLU n 1 16 ILE n 1 17 LEU n 1 18 HIS n 1 19 LEU n 1 20 PRO n 1 21 ASN n 1 22 LEU n 1 23 THR n 1 24 GLU n 1 25 GLU n 1 26 GLN n 1 27 ARG n 1 28 ASN n 1 29 GLY n 1 30 PHE n 1 31 ILE n 1 32 GLN n 1 33 SER n 1 34 LEU n 1 35 LYS n 1 36 ASP n 1 37 ASP n 1 38 PRO n 1 39 SER n 1 40 VAL n 1 41 SER n 1 42 LYS n 1 43 GLU n 1 44 ILE n 1 45 LEU n 1 46 ALA n 1 47 GLU n 1 48 ALA n 1 49 LYS n 1 50 LYS n 1 51 LEU n 1 52 ASN n 1 53 ASP n 1 54 ALA n 1 55 GLN n 1 56 ALA n 1 57 PRO n 1 58 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 58 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene spa _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Staphylococcus aureus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1280 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q2UW48_STAAU _struct_ref.pdbx_db_accession Q2UW48 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code DNKFNKEQQNAFYEILHLPNLTEEQRNGFIQSLKDDPSVSKEILAEAKKLNDAQAPK _struct_ref.pdbx_align_begin 244 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6SOW _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 58 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q2UW48 _struct_ref_seq.db_align_beg 244 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 300 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 58 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 6SOW _struct_ref_seq_dif.mon_id SER _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q2UW48 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'expression tag' _struct_ref_seq_dif.pdbx_auth_seq_num 1 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 1 isotropic 3 1 1 '3D HNCA' 1 isotropic 10 1 1 '3D HNCACBi' 1 isotropic 11 1 1 '3D HNCO' 1 isotropic 12 1 1 '3D HNCOi' 1 isotropic 13 1 1 '2D CACO' 1 isotropic 14 1 1 '2D CON' 1 isotropic 15 1 1 '3D HCCH-COSY' 1 isotropic 9 2 2 '2D 1H-15N HSQC' 1 isotropic 2 2 2 '2D 1H-13C HSQC' 1 isotropic 16 1 2 '2D 1H-13C HSQC aromatic' 1 isotropic 4 2 2 '2D CACO' 1 isotropic 5 2 2 '2D CON' 1 isotropic 6 2 2 '3D HCCH-COSY' 1 isotropic 7 2 2 '3D 1H-15N NOESY' 1 isotropic 8 2 2 '3D 1H-13C NOESY' 1 isotropic # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.details _pdbx_nmr_exptl_sample_conditions.ionic_strength_err _pdbx_nmr_exptl_sample_conditions.ionic_strength_units _pdbx_nmr_exptl_sample_conditions.label _pdbx_nmr_exptl_sample_conditions.pH_err _pdbx_nmr_exptl_sample_conditions.pH_units _pdbx_nmr_exptl_sample_conditions.pressure_err _pdbx_nmr_exptl_sample_conditions.temperature_err _pdbx_nmr_exptl_sample_conditions.temperature_units 1 303 atm 1 6 20 ? ? mM conditions_1 ? pH ? ? K 2 298 atm 1 6 20 ? ? mM conditions_2 ? pH ? ? K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 '5.6 mM [U-20% 13C; U-100% 15N] Protein A C domain, 95% H2O/5% D2O' '95% H2O/5% D2O' sample_1 solution ? 2 '2.8 mM [U-20% 13C; U-100% 15N] Protein A C domain, 95% H2O/5% D2O' '95% H2O/5% D2O' sample_2 solution ? # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 850 _pdbx_nmr_spectrometer.details ? # _pdbx_nmr_refine.entry_id 6SOW _pdbx_nmr_refine.method 'molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 3 # _pdbx_nmr_ensemble.entry_id 6SOW _pdbx_nmr_ensemble.conformers_calculated_total_number 20 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'all calculated structures submitted' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 6SOW _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 'chemical shift assignment' 'CcpNmr Analysis' 2.4.2 CCPN 2 'structure calculation' CYANA 3.0 'Guntert, Mumenthaler and Wuthrich' 3 refinement Amber 14 'Case, Darden, Cheatham III, Simmerling, Wang, Duke, Luo, ... and Kollman' 4 'peak picking' 'CcpNmr Analysis' 2.4.2 CCPN 5 'data analysis' PSVS 1.5 'Bhattacharya and Montelione' 6 'chemical shift assignment' TALOS N 'Cornilescu, Delaglio and Bax' # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6SOW _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 6SOW _struct.title 'NMR solution structure of staphylococcal protein A, C domain' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6SOW _struct_keywords.text 'three-helix bundle, immunoglobulin-binding protein, immune system, PROTEIN BINDING' _struct_keywords.pdbx_keywords 'PROTEIN BINDING' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASN A 6 ? LEU A 19 ? ASN A 6 LEU A 19 1 ? 14 HELX_P HELX_P2 AA2 GLU A 25 ? ASP A 37 ? GLU A 25 ASP A 37 1 ? 13 HELX_P HELX_P3 AA3 VAL A 40 ? ALA A 56 ? VAL A 40 ALA A 56 1 ? 17 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 6SOW _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1 1 SER SER A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 ASN 3 3 3 ASN ASN A . n A 1 4 LYS 4 4 4 LYS LYS A . n A 1 5 PHE 5 5 5 PHE PHE A . n A 1 6 ASN 6 6 6 ASN ASN A . n A 1 7 LYS 7 7 7 LYS LYS A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 GLN 9 9 9 GLN GLN A . n A 1 10 GLN 10 10 10 GLN GLN A . n A 1 11 ASN 11 11 11 ASN ASN A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 PHE 13 13 13 PHE PHE A . n A 1 14 TYR 14 14 14 TYR TYR A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 ILE 16 16 16 ILE ILE A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 HIS 18 18 18 HIS HIS A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 PRO 20 20 20 PRO PRO A . n A 1 21 ASN 21 21 21 ASN ASN A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 THR 23 23 23 THR THR A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 GLN 26 26 26 GLN GLN A . n A 1 27 ARG 27 27 27 ARG ARG A . n A 1 28 ASN 28 28 28 ASN ASN A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 PHE 30 30 30 PHE PHE A . n A 1 31 ILE 31 31 31 ILE ILE A . n A 1 32 GLN 32 32 32 GLN GLN A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 ASP 37 37 37 ASP ASP A . n A 1 38 PRO 38 38 38 PRO PRO A . n A 1 39 SER 39 39 39 SER SER A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 SER 41 41 41 SER SER A . n A 1 42 LYS 42 42 42 LYS LYS A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 ILE 44 44 44 ILE ILE A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 ASN 52 52 52 ASN ASN A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 GLN 55 55 55 GLN GLN A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 PRO 57 57 57 PRO PRO A . n A 1 58 LYS 58 58 58 LYS LYS A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 4540 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-09-09 2 'Structure model' 1 1 2021-03-03 3 'Structure model' 1 2 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' database_2 4 3 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.pdbx_database_id_DOI' 7 2 'Structure model' '_citation.pdbx_database_id_PubMed' 8 2 'Structure model' '_citation.title' 9 2 'Structure model' '_citation.year' 10 3 'Structure model' '_database_2.pdbx_DOI' 11 3 'Structure model' '_database_2.pdbx_database_accession' 12 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 'Protein A C domain' 5.6 ? mM '[U-20% 13C; U-100% 15N]' 2 'Protein A C domain' 2.8 ? mM '[U-20% 13C; U-100% 15N]' # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 27 ? ? CZ A ARG 27 ? ? NH1 A ARG 27 ? ? 124.71 120.30 4.41 0.50 N 2 3 NE A ARG 27 ? ? CZ A ARG 27 ? ? NH1 A ARG 27 ? ? 123.83 120.30 3.53 0.50 N 3 4 NE A ARG 27 ? ? CZ A ARG 27 ? ? NH1 A ARG 27 ? ? 123.81 120.30 3.51 0.50 N 4 5 NE A ARG 27 ? ? CZ A ARG 27 ? ? NH1 A ARG 27 ? ? 123.89 120.30 3.59 0.50 N 5 6 NE A ARG 27 ? ? CZ A ARG 27 ? ? NH1 A ARG 27 ? ? 124.23 120.30 3.93 0.50 N 6 8 NE A ARG 27 ? ? CZ A ARG 27 ? ? NH1 A ARG 27 ? ? 123.61 120.30 3.31 0.50 N 7 9 NE A ARG 27 ? ? CZ A ARG 27 ? ? NH1 A ARG 27 ? ? 123.58 120.30 3.28 0.50 N 8 10 NE A ARG 27 ? ? CZ A ARG 27 ? ? NH1 A ARG 27 ? ? 124.63 120.30 4.33 0.50 N 9 12 NE A ARG 27 ? ? CZ A ARG 27 ? ? NH1 A ARG 27 ? ? 124.28 120.30 3.98 0.50 N 10 14 NE A ARG 27 ? ? CZ A ARG 27 ? ? NH1 A ARG 27 ? ? 124.70 120.30 4.40 0.50 N 11 15 NE A ARG 27 ? ? CZ A ARG 27 ? ? NH1 A ARG 27 ? ? 125.10 120.30 4.80 0.50 N 12 16 NE A ARG 27 ? ? CZ A ARG 27 ? ? NH1 A ARG 27 ? ? 124.20 120.30 3.90 0.50 N 13 17 NE A ARG 27 ? ? CZ A ARG 27 ? ? NH1 A ARG 27 ? ? 124.59 120.30 4.29 0.50 N 14 18 NE A ARG 27 ? ? CZ A ARG 27 ? ? NH1 A ARG 27 ? ? 124.85 120.30 4.55 0.50 N 15 19 NE A ARG 27 ? ? CZ A ARG 27 ? ? NH1 A ARG 27 ? ? 123.68 120.30 3.38 0.50 N 16 20 NE A ARG 27 ? ? CZ A ARG 27 ? ? NH1 A ARG 27 ? ? 123.62 120.30 3.32 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PHE A 5 ? ? -76.77 -168.49 2 1 PRO A 57 ? ? -57.83 170.43 3 2 ASP A 2 ? ? -82.42 46.99 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 TYR A 14 ? ? 0.072 'SIDE CHAIN' 2 8 ARG A 27 ? ? 0.081 'SIDE CHAIN' 3 11 ARG A 27 ? ? 0.080 'SIDE CHAIN' # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Sigrid Juselius Foundation' Finland ? 1 'Academy of Finland' Finland 137995 2 'Academy of Finland' Finland 131413 3 # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #