data_6SSS # _entry.id 6SSS # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6SSS pdb_00006sss 10.2210/pdb6sss/pdb WWPDB D_1292104245 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-02-03 2 'Structure model' 2 0 2021-04-07 3 'Structure model' 3 0 2023-09-27 4 'Structure model' 3 1 2024-01-24 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Atomic model' 2 2 'Structure model' 'Data collection' 3 2 'Structure model' 'Database references' 4 3 'Structure model' 'Atomic model' 5 3 'Structure model' 'Data collection' 6 3 'Structure model' 'Database references' 7 3 'Structure model' 'Derived calculations' 8 3 'Structure model' 'Refinement description' 9 3 'Structure model' 'Source and taxonomy' 10 3 'Structure model' 'Structure summary' 11 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' atom_site 2 2 'Structure model' citation 3 2 'Structure model' citation_author 4 2 'Structure model' diffrn_radiation_wavelength 5 2 'Structure model' diffrn_source 6 3 'Structure model' atom_site 7 3 'Structure model' chem_comp 8 3 'Structure model' chem_comp_atom 9 3 'Structure model' chem_comp_bond 10 3 'Structure model' database_2 11 3 'Structure model' entity 12 3 'Structure model' entity_src_gen 13 3 'Structure model' pdbx_entity_nonpoly 14 3 'Structure model' struct_ncs_dom_lim 15 4 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.pdbx_database_id_PubMed' 10 2 'Structure model' '_citation.title' 11 2 'Structure model' '_citation.year' 12 2 'Structure model' '_diffrn_radiation_wavelength.wavelength' 13 2 'Structure model' '_diffrn_source.pdbx_wavelength_list' 14 3 'Structure model' '_atom_site.Cartn_x' 15 3 'Structure model' '_atom_site.Cartn_y' 16 3 'Structure model' '_atom_site.Cartn_z' 17 3 'Structure model' '_atom_site.auth_atom_id' 18 3 'Structure model' '_atom_site.label_atom_id' 19 3 'Structure model' '_chem_comp.name' 20 3 'Structure model' '_chem_comp.pdbx_synonyms' 21 3 'Structure model' '_database_2.pdbx_DOI' 22 3 'Structure model' '_database_2.pdbx_database_accession' 23 3 'Structure model' '_entity.pdbx_description' 24 3 'Structure model' '_entity_src_gen.gene_src_common_name' 25 3 'Structure model' '_pdbx_entity_nonpoly.name' 26 3 'Structure model' '_struct_ncs_dom_lim.beg_auth_comp_id' 27 3 'Structure model' '_struct_ncs_dom_lim.beg_auth_seq_id' 28 3 'Structure model' '_struct_ncs_dom_lim.beg_label_asym_id' 29 3 'Structure model' '_struct_ncs_dom_lim.beg_label_comp_id' 30 3 'Structure model' '_struct_ncs_dom_lim.beg_label_seq_id' 31 3 'Structure model' '_struct_ncs_dom_lim.end_auth_comp_id' 32 3 'Structure model' '_struct_ncs_dom_lim.end_auth_seq_id' 33 3 'Structure model' '_struct_ncs_dom_lim.end_label_asym_id' 34 3 'Structure model' '_struct_ncs_dom_lim.end_label_comp_id' 35 3 'Structure model' '_struct_ncs_dom_lim.end_label_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6SSS _pdbx_database_status.recvd_initial_deposition_date 2019-09-09 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Thulasingam, M.' 1 0000-0002-4277-9839 'Nji, E.' 2 0000-0001-6991-1046 'Haeggstrom, J.Z.' 3 0000-0002-1823-5153 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nat Commun' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2041-1723 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 12 _citation.language ? _citation.page_first 1728 _citation.page_last 1728 _citation.title 'Crystal structures of human MGST2 reveal synchronized conformational changes regulating catalysis.' _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41467-021-21924-8 _citation.pdbx_database_id_PubMed 33741927 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Thulasingam, M.' 1 0000-0002-4277-9839 primary 'Orellana, L.' 2 ? primary 'Nji, E.' 3 0000-0001-6991-1046 primary 'Ahmad, S.' 4 0000-0003-2374-1197 primary 'Rinaldo-Matthis, A.' 5 ? primary 'Haeggstrom, J.Z.' 6 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Microsomal glutathione S-transferase 2' 17465.410 6 2.5.1.18 ? ? ? 2 non-polymer syn 'SULFATE ION' 96.063 6 ? ? ? ? 3 non-polymer syn 'SODIUM ION' 22.990 5 ? ? ? ? 4 non-polymer syn '1-(8Z-hexadecenoyl)-sn-glycerol' 328.487 5 ? ? ? ? 5 non-polymer syn GLYCEROL 92.094 2 ? ? ? ? 6 non-polymer syn 'THIOCYANATE ION' 58.082 1 ? ? ? ? 7 non-polymer syn 'POTASSIUM ION' 39.098 1 ? ? ? ? 8 water nat water 18.015 71 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Microsomal GST-2,Microsomal GST-II' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MHHHHHHAGNSILLAAVSILSACQQSYFALQVGKARLKYKVTPPAVTGSPEFERVFRAQQNCVEFYPIFIITLWMAGWYF NQVFATCLGLVYIYGRHLYFWGYSEAAKKRITGFRLSLGILALLTLLGALGIANSFLDEYLDLNIAKKLRRQF ; _entity_poly.pdbx_seq_one_letter_code_can ;MHHHHHHAGNSILLAAVSILSACQQSYFALQVGKARLKYKVTPPAVTGSPEFERVFRAQQNCVEFYPIFIITLWMAGWYF NQVFATCLGLVYIYGRHLYFWGYSEAAKKRITGFRLSLGILALLTLLGALGIANSFLDEYLDLNIAKKLRRQF ; _entity_poly.pdbx_strand_id A,B,C,D,E,F _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SULFATE ION' SO4 3 'SODIUM ION' NA 4 '1-(8Z-hexadecenoyl)-sn-glycerol' M88 5 GLYCEROL GOL 6 'THIOCYANATE ION' SCN 7 'POTASSIUM ION' K 8 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 HIS n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 ALA n 1 9 GLY n 1 10 ASN n 1 11 SER n 1 12 ILE n 1 13 LEU n 1 14 LEU n 1 15 ALA n 1 16 ALA n 1 17 VAL n 1 18 SER n 1 19 ILE n 1 20 LEU n 1 21 SER n 1 22 ALA n 1 23 CYS n 1 24 GLN n 1 25 GLN n 1 26 SER n 1 27 TYR n 1 28 PHE n 1 29 ALA n 1 30 LEU n 1 31 GLN n 1 32 VAL n 1 33 GLY n 1 34 LYS n 1 35 ALA n 1 36 ARG n 1 37 LEU n 1 38 LYS n 1 39 TYR n 1 40 LYS n 1 41 VAL n 1 42 THR n 1 43 PRO n 1 44 PRO n 1 45 ALA n 1 46 VAL n 1 47 THR n 1 48 GLY n 1 49 SER n 1 50 PRO n 1 51 GLU n 1 52 PHE n 1 53 GLU n 1 54 ARG n 1 55 VAL n 1 56 PHE n 1 57 ARG n 1 58 ALA n 1 59 GLN n 1 60 GLN n 1 61 ASN n 1 62 CYS n 1 63 VAL n 1 64 GLU n 1 65 PHE n 1 66 TYR n 1 67 PRO n 1 68 ILE n 1 69 PHE n 1 70 ILE n 1 71 ILE n 1 72 THR n 1 73 LEU n 1 74 TRP n 1 75 MET n 1 76 ALA n 1 77 GLY n 1 78 TRP n 1 79 TYR n 1 80 PHE n 1 81 ASN n 1 82 GLN n 1 83 VAL n 1 84 PHE n 1 85 ALA n 1 86 THR n 1 87 CYS n 1 88 LEU n 1 89 GLY n 1 90 LEU n 1 91 VAL n 1 92 TYR n 1 93 ILE n 1 94 TYR n 1 95 GLY n 1 96 ARG n 1 97 HIS n 1 98 LEU n 1 99 TYR n 1 100 PHE n 1 101 TRP n 1 102 GLY n 1 103 TYR n 1 104 SER n 1 105 GLU n 1 106 ALA n 1 107 ALA n 1 108 LYS n 1 109 LYS n 1 110 ARG n 1 111 ILE n 1 112 THR n 1 113 GLY n 1 114 PHE n 1 115 ARG n 1 116 LEU n 1 117 SER n 1 118 LEU n 1 119 GLY n 1 120 ILE n 1 121 LEU n 1 122 ALA n 1 123 LEU n 1 124 LEU n 1 125 THR n 1 126 LEU n 1 127 LEU n 1 128 GLY n 1 129 ALA n 1 130 LEU n 1 131 GLY n 1 132 ILE n 1 133 ALA n 1 134 ASN n 1 135 SER n 1 136 PHE n 1 137 LEU n 1 138 ASP n 1 139 GLU n 1 140 TYR n 1 141 LEU n 1 142 ASP n 1 143 LEU n 1 144 ASN n 1 145 ILE n 1 146 ALA n 1 147 LYS n 1 148 LYS n 1 149 LEU n 1 150 ARG n 1 151 ARG n 1 152 GLN n 1 153 PHE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 153 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'MGST2, GST2' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Komagataella pastoris' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 4922 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 K non-polymer . 'POTASSIUM ION' ? 'K 1' 39.098 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 M88 non-polymer . '1-(8Z-hexadecenoyl)-sn-glycerol' '2,3-dihydroxypropyl (Z)-hexadec-8-enoate; [(2S)-2,3-bis(oxidanyl)propyl] (Z)-hexadec-8-enoate' 'C19 H36 O4' 328.487 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NA non-polymer . 'SODIUM ION' ? 'Na 1' 22.990 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SCN non-polymer . 'THIOCYANATE ION' ? 'C N S -1' 58.082 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -5 ? ? ? A . n A 1 2 HIS 2 -4 ? ? ? A . n A 1 3 HIS 3 -3 ? ? ? A . n A 1 4 HIS 4 -2 ? ? ? A . n A 1 5 HIS 5 -1 ? ? ? A . n A 1 6 HIS 6 0 ? ? ? A . n A 1 7 HIS 7 1 ? ? ? A . n A 1 8 ALA 8 2 ? ? ? A . n A 1 9 GLY 9 3 3 GLY GLY A . n A 1 10 ASN 10 4 4 ASN ASN A . n A 1 11 SER 11 5 5 SER SER A . n A 1 12 ILE 12 6 6 ILE ILE A . n A 1 13 LEU 13 7 7 LEU LEU A . n A 1 14 LEU 14 8 8 LEU LEU A . n A 1 15 ALA 15 9 9 ALA ALA A . n A 1 16 ALA 16 10 10 ALA ALA A . n A 1 17 VAL 17 11 11 VAL VAL A . n A 1 18 SER 18 12 12 SER SER A . n A 1 19 ILE 19 13 13 ILE ILE A . n A 1 20 LEU 20 14 14 LEU LEU A . n A 1 21 SER 21 15 15 SER SER A . n A 1 22 ALA 22 16 16 ALA ALA A . n A 1 23 CYS 23 17 17 CYS CYS A . n A 1 24 GLN 24 18 18 GLN GLN A . n A 1 25 GLN 25 19 19 GLN GLN A . n A 1 26 SER 26 20 20 SER SER A . n A 1 27 TYR 27 21 21 TYR TYR A . n A 1 28 PHE 28 22 22 PHE PHE A . n A 1 29 ALA 29 23 23 ALA ALA A . n A 1 30 LEU 30 24 24 LEU LEU A . n A 1 31 GLN 31 25 25 GLN GLN A . n A 1 32 VAL 32 26 26 VAL VAL A . n A 1 33 GLY 33 27 27 GLY GLY A . n A 1 34 LYS 34 28 28 LYS LYS A . n A 1 35 ALA 35 29 29 ALA ALA A . n A 1 36 ARG 36 30 30 ARG ARG A . n A 1 37 LEU 37 31 31 LEU LEU A . n A 1 38 LYS 38 32 32 LYS LYS A . n A 1 39 TYR 39 33 33 TYR TYR A . n A 1 40 LYS 40 34 34 LYS LYS A . n A 1 41 VAL 41 35 35 VAL VAL A . n A 1 42 THR 42 36 36 THR THR A . n A 1 43 PRO 43 37 37 PRO PRO A . n A 1 44 PRO 44 38 38 PRO PRO A . n A 1 45 ALA 45 39 39 ALA ALA A . n A 1 46 VAL 46 40 40 VAL VAL A . n A 1 47 THR 47 41 41 THR THR A . n A 1 48 GLY 48 42 42 GLY GLY A . n A 1 49 SER 49 43 43 SER SER A . n A 1 50 PRO 50 44 44 PRO PRO A . n A 1 51 GLU 51 45 45 GLU GLU A . n A 1 52 PHE 52 46 46 PHE PHE A . n A 1 53 GLU 53 47 47 GLU GLU A . n A 1 54 ARG 54 48 48 ARG ARG A . n A 1 55 VAL 55 49 49 VAL VAL A . n A 1 56 PHE 56 50 50 PHE PHE A . n A 1 57 ARG 57 51 51 ARG ARG A . n A 1 58 ALA 58 52 52 ALA ALA A . n A 1 59 GLN 59 53 53 GLN GLN A . n A 1 60 GLN 60 54 54 GLN GLN A . n A 1 61 ASN 61 55 55 ASN ASN A . n A 1 62 CYS 62 56 56 CYS CYS A . n A 1 63 VAL 63 57 57 VAL VAL A . n A 1 64 GLU 64 58 58 GLU GLU A . n A 1 65 PHE 65 59 59 PHE PHE A . n A 1 66 TYR 66 60 60 TYR TYR A . n A 1 67 PRO 67 61 61 PRO PRO A . n A 1 68 ILE 68 62 62 ILE ILE A . n A 1 69 PHE 69 63 63 PHE PHE A . n A 1 70 ILE 70 64 64 ILE ILE A . n A 1 71 ILE 71 65 65 ILE ILE A . n A 1 72 THR 72 66 66 THR THR A . n A 1 73 LEU 73 67 67 LEU LEU A . n A 1 74 TRP 74 68 68 TRP TRP A . n A 1 75 MET 75 69 69 MET MET A . n A 1 76 ALA 76 70 70 ALA ALA A . n A 1 77 GLY 77 71 71 GLY GLY A . n A 1 78 TRP 78 72 72 TRP TRP A . n A 1 79 TYR 79 73 73 TYR TYR A . n A 1 80 PHE 80 74 74 PHE PHE A . n A 1 81 ASN 81 75 75 ASN ASN A . n A 1 82 GLN 82 76 76 GLN GLN A . n A 1 83 VAL 83 77 77 VAL VAL A . n A 1 84 PHE 84 78 78 PHE PHE A . n A 1 85 ALA 85 79 79 ALA ALA A . n A 1 86 THR 86 80 80 THR THR A . n A 1 87 CYS 87 81 81 CYS CYS A . n A 1 88 LEU 88 82 82 LEU LEU A . n A 1 89 GLY 89 83 83 GLY GLY A . n A 1 90 LEU 90 84 84 LEU LEU A . n A 1 91 VAL 91 85 85 VAL VAL A . n A 1 92 TYR 92 86 86 TYR TYR A . n A 1 93 ILE 93 87 87 ILE ILE A . n A 1 94 TYR 94 88 88 TYR TYR A . n A 1 95 GLY 95 89 89 GLY GLY A . n A 1 96 ARG 96 90 90 ARG ARG A . n A 1 97 HIS 97 91 91 HIS HIS A . n A 1 98 LEU 98 92 92 LEU LEU A . n A 1 99 TYR 99 93 93 TYR TYR A . n A 1 100 PHE 100 94 94 PHE PHE A . n A 1 101 TRP 101 95 95 TRP TRP A . n A 1 102 GLY 102 96 96 GLY GLY A . n A 1 103 TYR 103 97 97 TYR TYR A . n A 1 104 SER 104 98 98 SER SER A . n A 1 105 GLU 105 99 99 GLU GLU A . n A 1 106 ALA 106 100 100 ALA ALA A . n A 1 107 ALA 107 101 101 ALA ALA A . n A 1 108 LYS 108 102 102 LYS LYS A . n A 1 109 LYS 109 103 103 LYS LYS A . n A 1 110 ARG 110 104 104 ARG ARG A . n A 1 111 ILE 111 105 105 ILE ILE A . n A 1 112 THR 112 106 106 THR THR A . n A 1 113 GLY 113 107 107 GLY GLY A . n A 1 114 PHE 114 108 108 PHE PHE A . n A 1 115 ARG 115 109 109 ARG ARG A . n A 1 116 LEU 116 110 110 LEU LEU A . n A 1 117 SER 117 111 111 SER SER A . n A 1 118 LEU 118 112 112 LEU LEU A . n A 1 119 GLY 119 113 113 GLY GLY A . n A 1 120 ILE 120 114 114 ILE ILE A . n A 1 121 LEU 121 115 115 LEU LEU A . n A 1 122 ALA 122 116 116 ALA ALA A . n A 1 123 LEU 123 117 117 LEU LEU A . n A 1 124 LEU 124 118 118 LEU LEU A . n A 1 125 THR 125 119 119 THR THR A . n A 1 126 LEU 126 120 120 LEU LEU A . n A 1 127 LEU 127 121 121 LEU LEU A . n A 1 128 GLY 128 122 122 GLY GLY A . n A 1 129 ALA 129 123 123 ALA ALA A . n A 1 130 LEU 130 124 124 LEU LEU A . n A 1 131 GLY 131 125 125 GLY GLY A . n A 1 132 ILE 132 126 126 ILE ILE A . n A 1 133 ALA 133 127 127 ALA ALA A . n A 1 134 ASN 134 128 128 ASN ASN A . n A 1 135 SER 135 129 129 SER SER A . n A 1 136 PHE 136 130 130 PHE PHE A . n A 1 137 LEU 137 131 131 LEU LEU A . n A 1 138 ASP 138 132 132 ASP ASP A . n A 1 139 GLU 139 133 133 GLU GLU A . n A 1 140 TYR 140 134 134 TYR TYR A . n A 1 141 LEU 141 135 135 LEU LEU A . n A 1 142 ASP 142 136 136 ASP ASP A . n A 1 143 LEU 143 137 137 LEU LEU A . n A 1 144 ASN 144 138 138 ASN ASN A . n A 1 145 ILE 145 139 ? ? ? A . n A 1 146 ALA 146 140 ? ? ? A . n A 1 147 LYS 147 141 ? ? ? A . n A 1 148 LYS 148 142 ? ? ? A . n A 1 149 LEU 149 143 ? ? ? A . n A 1 150 ARG 150 144 ? ? ? A . n A 1 151 ARG 151 145 ? ? ? A . n A 1 152 GLN 152 146 ? ? ? A . n A 1 153 PHE 153 147 ? ? ? A . n B 1 1 MET 1 -5 ? ? ? B . n B 1 2 HIS 2 -4 ? ? ? B . n B 1 3 HIS 3 -3 ? ? ? B . n B 1 4 HIS 4 -2 ? ? ? B . n B 1 5 HIS 5 -1 ? ? ? B . n B 1 6 HIS 6 0 ? ? ? B . n B 1 7 HIS 7 1 ? ? ? B . n B 1 8 ALA 8 2 ? ? ? B . n B 1 9 GLY 9 3 ? ? ? B . n B 1 10 ASN 10 4 4 ASN ASN B . n B 1 11 SER 11 5 5 SER SER B . n B 1 12 ILE 12 6 6 ILE ILE B . n B 1 13 LEU 13 7 7 LEU LEU B . n B 1 14 LEU 14 8 8 LEU LEU B . n B 1 15 ALA 15 9 9 ALA ALA B . n B 1 16 ALA 16 10 10 ALA ALA B . n B 1 17 VAL 17 11 11 VAL VAL B . n B 1 18 SER 18 12 12 SER SER B . n B 1 19 ILE 19 13 13 ILE ILE B . n B 1 20 LEU 20 14 14 LEU LEU B . n B 1 21 SER 21 15 15 SER SER B . n B 1 22 ALA 22 16 16 ALA ALA B . n B 1 23 CYS 23 17 17 CYS CYS B . n B 1 24 GLN 24 18 18 GLN GLN B . n B 1 25 GLN 25 19 19 GLN GLN B . n B 1 26 SER 26 20 20 SER SER B . n B 1 27 TYR 27 21 21 TYR TYR B . n B 1 28 PHE 28 22 22 PHE PHE B . n B 1 29 ALA 29 23 23 ALA ALA B . n B 1 30 LEU 30 24 24 LEU LEU B . n B 1 31 GLN 31 25 25 GLN GLN B . n B 1 32 VAL 32 26 26 VAL VAL B . n B 1 33 GLY 33 27 27 GLY GLY B . n B 1 34 LYS 34 28 28 LYS LYS B . n B 1 35 ALA 35 29 29 ALA ALA B . n B 1 36 ARG 36 30 30 ARG ARG B . n B 1 37 LEU 37 31 31 LEU LEU B . n B 1 38 LYS 38 32 32 LYS LYS B . n B 1 39 TYR 39 33 33 TYR TYR B . n B 1 40 LYS 40 34 34 LYS LYS B . n B 1 41 VAL 41 35 35 VAL VAL B . n B 1 42 THR 42 36 36 THR THR B . n B 1 43 PRO 43 37 37 PRO PRO B . n B 1 44 PRO 44 38 38 PRO PRO B . n B 1 45 ALA 45 39 39 ALA ALA B . n B 1 46 VAL 46 40 40 VAL VAL B . n B 1 47 THR 47 41 41 THR THR B . n B 1 48 GLY 48 42 42 GLY GLY B . n B 1 49 SER 49 43 43 SER SER B . n B 1 50 PRO 50 44 44 PRO PRO B . n B 1 51 GLU 51 45 45 GLU GLU B . n B 1 52 PHE 52 46 46 PHE PHE B . n B 1 53 GLU 53 47 47 GLU GLU B . n B 1 54 ARG 54 48 48 ARG ARG B . n B 1 55 VAL 55 49 49 VAL VAL B . n B 1 56 PHE 56 50 50 PHE PHE B . n B 1 57 ARG 57 51 51 ARG ARG B . n B 1 58 ALA 58 52 52 ALA ALA B . n B 1 59 GLN 59 53 53 GLN GLN B . n B 1 60 GLN 60 54 54 GLN GLN B . n B 1 61 ASN 61 55 55 ASN ASN B . n B 1 62 CYS 62 56 56 CYS CYS B . n B 1 63 VAL 63 57 57 VAL VAL B . n B 1 64 GLU 64 58 58 GLU GLU B . n B 1 65 PHE 65 59 59 PHE PHE B . n B 1 66 TYR 66 60 60 TYR TYR B . n B 1 67 PRO 67 61 61 PRO PRO B . n B 1 68 ILE 68 62 62 ILE ILE B . n B 1 69 PHE 69 63 63 PHE PHE B . n B 1 70 ILE 70 64 64 ILE ILE B . n B 1 71 ILE 71 65 65 ILE ILE B . n B 1 72 THR 72 66 66 THR THR B . n B 1 73 LEU 73 67 67 LEU LEU B . n B 1 74 TRP 74 68 68 TRP TRP B . n B 1 75 MET 75 69 69 MET MET B . n B 1 76 ALA 76 70 70 ALA ALA B . n B 1 77 GLY 77 71 71 GLY GLY B . n B 1 78 TRP 78 72 72 TRP TRP B . n B 1 79 TYR 79 73 73 TYR TYR B . n B 1 80 PHE 80 74 74 PHE PHE B . n B 1 81 ASN 81 75 75 ASN ASN B . n B 1 82 GLN 82 76 76 GLN GLN B . n B 1 83 VAL 83 77 77 VAL VAL B . n B 1 84 PHE 84 78 78 PHE PHE B . n B 1 85 ALA 85 79 79 ALA ALA B . n B 1 86 THR 86 80 80 THR THR B . n B 1 87 CYS 87 81 81 CYS CYS B . n B 1 88 LEU 88 82 82 LEU LEU B . n B 1 89 GLY 89 83 83 GLY GLY B . n B 1 90 LEU 90 84 84 LEU LEU B . n B 1 91 VAL 91 85 85 VAL VAL B . n B 1 92 TYR 92 86 86 TYR TYR B . n B 1 93 ILE 93 87 87 ILE ILE B . n B 1 94 TYR 94 88 88 TYR TYR B . n B 1 95 GLY 95 89 89 GLY GLY B . n B 1 96 ARG 96 90 90 ARG ARG B . n B 1 97 HIS 97 91 91 HIS HIS B . n B 1 98 LEU 98 92 92 LEU LEU B . n B 1 99 TYR 99 93 93 TYR TYR B . n B 1 100 PHE 100 94 94 PHE PHE B . n B 1 101 TRP 101 95 95 TRP TRP B . n B 1 102 GLY 102 96 96 GLY GLY B . n B 1 103 TYR 103 97 97 TYR TYR B . n B 1 104 SER 104 98 98 SER SER B . n B 1 105 GLU 105 99 99 GLU GLU B . n B 1 106 ALA 106 100 100 ALA ALA B . n B 1 107 ALA 107 101 101 ALA ALA B . n B 1 108 LYS 108 102 102 LYS LYS B . n B 1 109 LYS 109 103 103 LYS LYS B . n B 1 110 ARG 110 104 104 ARG ARG B . n B 1 111 ILE 111 105 105 ILE ILE B . n B 1 112 THR 112 106 106 THR THR B . n B 1 113 GLY 113 107 107 GLY GLY B . n B 1 114 PHE 114 108 108 PHE PHE B . n B 1 115 ARG 115 109 109 ARG ARG B . n B 1 116 LEU 116 110 110 LEU LEU B . n B 1 117 SER 117 111 111 SER SER B . n B 1 118 LEU 118 112 112 LEU LEU B . n B 1 119 GLY 119 113 113 GLY GLY B . n B 1 120 ILE 120 114 114 ILE ILE B . n B 1 121 LEU 121 115 115 LEU LEU B . n B 1 122 ALA 122 116 116 ALA ALA B . n B 1 123 LEU 123 117 117 LEU LEU B . n B 1 124 LEU 124 118 118 LEU LEU B . n B 1 125 THR 125 119 119 THR THR B . n B 1 126 LEU 126 120 120 LEU LEU B . n B 1 127 LEU 127 121 121 LEU LEU B . n B 1 128 GLY 128 122 122 GLY GLY B . n B 1 129 ALA 129 123 123 ALA ALA B . n B 1 130 LEU 130 124 124 LEU LEU B . n B 1 131 GLY 131 125 125 GLY GLY B . n B 1 132 ILE 132 126 126 ILE ILE B . n B 1 133 ALA 133 127 127 ALA ALA B . n B 1 134 ASN 134 128 128 ASN ASN B . n B 1 135 SER 135 129 129 SER SER B . n B 1 136 PHE 136 130 130 PHE PHE B . n B 1 137 LEU 137 131 131 LEU LEU B . n B 1 138 ASP 138 132 132 ASP ASP B . n B 1 139 GLU 139 133 133 GLU GLU B . n B 1 140 TYR 140 134 ? ? ? B . n B 1 141 LEU 141 135 ? ? ? B . n B 1 142 ASP 142 136 ? ? ? B . n B 1 143 LEU 143 137 ? ? ? B . n B 1 144 ASN 144 138 ? ? ? B . n B 1 145 ILE 145 139 ? ? ? B . n B 1 146 ALA 146 140 ? ? ? B . n B 1 147 LYS 147 141 ? ? ? B . n B 1 148 LYS 148 142 ? ? ? B . n B 1 149 LEU 149 143 ? ? ? B . n B 1 150 ARG 150 144 ? ? ? B . n B 1 151 ARG 151 145 ? ? ? B . n B 1 152 GLN 152 146 ? ? ? B . n B 1 153 PHE 153 147 ? ? ? B . n C 1 1 MET 1 -5 ? ? ? C . n C 1 2 HIS 2 -4 ? ? ? C . n C 1 3 HIS 3 -3 ? ? ? C . n C 1 4 HIS 4 -2 ? ? ? C . n C 1 5 HIS 5 -1 ? ? ? C . n C 1 6 HIS 6 0 ? ? ? C . n C 1 7 HIS 7 1 ? ? ? C . n C 1 8 ALA 8 2 ? ? ? C . n C 1 9 GLY 9 3 3 GLY GLY C . n C 1 10 ASN 10 4 4 ASN ASN C . n C 1 11 SER 11 5 5 SER SER C . n C 1 12 ILE 12 6 6 ILE ILE C . n C 1 13 LEU 13 7 7 LEU LEU C . n C 1 14 LEU 14 8 8 LEU LEU C . n C 1 15 ALA 15 9 9 ALA ALA C . n C 1 16 ALA 16 10 10 ALA ALA C . n C 1 17 VAL 17 11 11 VAL VAL C . n C 1 18 SER 18 12 12 SER SER C . n C 1 19 ILE 19 13 13 ILE ILE C . n C 1 20 LEU 20 14 14 LEU LEU C . n C 1 21 SER 21 15 15 SER SER C . n C 1 22 ALA 22 16 16 ALA ALA C . n C 1 23 CYS 23 17 17 CYS CYS C . n C 1 24 GLN 24 18 18 GLN GLN C . n C 1 25 GLN 25 19 19 GLN GLN C . n C 1 26 SER 26 20 20 SER SER C . n C 1 27 TYR 27 21 21 TYR TYR C . n C 1 28 PHE 28 22 22 PHE PHE C . n C 1 29 ALA 29 23 23 ALA ALA C . n C 1 30 LEU 30 24 24 LEU LEU C . n C 1 31 GLN 31 25 25 GLN GLN C . n C 1 32 VAL 32 26 26 VAL VAL C . n C 1 33 GLY 33 27 27 GLY GLY C . n C 1 34 LYS 34 28 28 LYS LYS C . n C 1 35 ALA 35 29 29 ALA ALA C . n C 1 36 ARG 36 30 30 ARG ARG C . n C 1 37 LEU 37 31 31 LEU LEU C . n C 1 38 LYS 38 32 32 LYS LYS C . n C 1 39 TYR 39 33 33 TYR TYR C . n C 1 40 LYS 40 34 34 LYS LYS C . n C 1 41 VAL 41 35 35 VAL VAL C . n C 1 42 THR 42 36 36 THR THR C . n C 1 43 PRO 43 37 37 PRO PRO C . n C 1 44 PRO 44 38 38 PRO PRO C . n C 1 45 ALA 45 39 39 ALA ALA C . n C 1 46 VAL 46 40 40 VAL VAL C . n C 1 47 THR 47 41 41 THR THR C . n C 1 48 GLY 48 42 42 GLY GLY C . n C 1 49 SER 49 43 43 SER SER C . n C 1 50 PRO 50 44 44 PRO PRO C . n C 1 51 GLU 51 45 45 GLU GLU C . n C 1 52 PHE 52 46 46 PHE PHE C . n C 1 53 GLU 53 47 47 GLU GLU C . n C 1 54 ARG 54 48 48 ARG ARG C . n C 1 55 VAL 55 49 49 VAL VAL C . n C 1 56 PHE 56 50 50 PHE PHE C . n C 1 57 ARG 57 51 51 ARG ARG C . n C 1 58 ALA 58 52 52 ALA ALA C . n C 1 59 GLN 59 53 53 GLN GLN C . n C 1 60 GLN 60 54 54 GLN GLN C . n C 1 61 ASN 61 55 55 ASN ASN C . n C 1 62 CYS 62 56 56 CYS CYS C . n C 1 63 VAL 63 57 57 VAL VAL C . n C 1 64 GLU 64 58 58 GLU GLU C . n C 1 65 PHE 65 59 59 PHE PHE C . n C 1 66 TYR 66 60 60 TYR TYR C . n C 1 67 PRO 67 61 61 PRO PRO C . n C 1 68 ILE 68 62 62 ILE ILE C . n C 1 69 PHE 69 63 63 PHE PHE C . n C 1 70 ILE 70 64 64 ILE ILE C . n C 1 71 ILE 71 65 65 ILE ILE C . n C 1 72 THR 72 66 66 THR THR C . n C 1 73 LEU 73 67 67 LEU LEU C . n C 1 74 TRP 74 68 68 TRP TRP C . n C 1 75 MET 75 69 69 MET MET C . n C 1 76 ALA 76 70 70 ALA ALA C . n C 1 77 GLY 77 71 71 GLY GLY C . n C 1 78 TRP 78 72 72 TRP TRP C . n C 1 79 TYR 79 73 73 TYR TYR C . n C 1 80 PHE 80 74 74 PHE PHE C . n C 1 81 ASN 81 75 75 ASN ASN C . n C 1 82 GLN 82 76 76 GLN GLN C . n C 1 83 VAL 83 77 77 VAL VAL C . n C 1 84 PHE 84 78 78 PHE PHE C . n C 1 85 ALA 85 79 79 ALA ALA C . n C 1 86 THR 86 80 80 THR THR C . n C 1 87 CYS 87 81 81 CYS CYS C . n C 1 88 LEU 88 82 82 LEU LEU C . n C 1 89 GLY 89 83 83 GLY GLY C . n C 1 90 LEU 90 84 84 LEU LEU C . n C 1 91 VAL 91 85 85 VAL VAL C . n C 1 92 TYR 92 86 86 TYR TYR C . n C 1 93 ILE 93 87 87 ILE ILE C . n C 1 94 TYR 94 88 88 TYR TYR C . n C 1 95 GLY 95 89 89 GLY GLY C . n C 1 96 ARG 96 90 90 ARG ARG C . n C 1 97 HIS 97 91 91 HIS HIS C . n C 1 98 LEU 98 92 92 LEU LEU C . n C 1 99 TYR 99 93 93 TYR TYR C . n C 1 100 PHE 100 94 94 PHE PHE C . n C 1 101 TRP 101 95 95 TRP TRP C . n C 1 102 GLY 102 96 96 GLY GLY C . n C 1 103 TYR 103 97 97 TYR TYR C . n C 1 104 SER 104 98 98 SER SER C . n C 1 105 GLU 105 99 99 GLU GLU C . n C 1 106 ALA 106 100 100 ALA ALA C . n C 1 107 ALA 107 101 101 ALA ALA C . n C 1 108 LYS 108 102 102 LYS LYS C . n C 1 109 LYS 109 103 103 LYS LYS C . n C 1 110 ARG 110 104 104 ARG ARG C . n C 1 111 ILE 111 105 105 ILE ILE C . n C 1 112 THR 112 106 106 THR THR C . n C 1 113 GLY 113 107 107 GLY GLY C . n C 1 114 PHE 114 108 108 PHE PHE C . n C 1 115 ARG 115 109 109 ARG ARG C . n C 1 116 LEU 116 110 110 LEU LEU C . n C 1 117 SER 117 111 111 SER SER C . n C 1 118 LEU 118 112 112 LEU LEU C . n C 1 119 GLY 119 113 113 GLY GLY C . n C 1 120 ILE 120 114 114 ILE ILE C . n C 1 121 LEU 121 115 115 LEU LEU C . n C 1 122 ALA 122 116 116 ALA ALA C . n C 1 123 LEU 123 117 117 LEU LEU C . n C 1 124 LEU 124 118 118 LEU LEU C . n C 1 125 THR 125 119 119 THR THR C . n C 1 126 LEU 126 120 120 LEU LEU C . n C 1 127 LEU 127 121 121 LEU LEU C . n C 1 128 GLY 128 122 122 GLY GLY C . n C 1 129 ALA 129 123 123 ALA ALA C . n C 1 130 LEU 130 124 124 LEU LEU C . n C 1 131 GLY 131 125 125 GLY GLY C . n C 1 132 ILE 132 126 126 ILE ILE C . n C 1 133 ALA 133 127 127 ALA ALA C . n C 1 134 ASN 134 128 128 ASN ASN C . n C 1 135 SER 135 129 129 SER SER C . n C 1 136 PHE 136 130 130 PHE PHE C . n C 1 137 LEU 137 131 131 LEU LEU C . n C 1 138 ASP 138 132 132 ASP ASP C . n C 1 139 GLU 139 133 133 GLU GLU C . n C 1 140 TYR 140 134 134 TYR TYR C . n C 1 141 LEU 141 135 135 LEU LEU C . n C 1 142 ASP 142 136 ? ? ? C . n C 1 143 LEU 143 137 ? ? ? C . n C 1 144 ASN 144 138 ? ? ? C . n C 1 145 ILE 145 139 ? ? ? C . n C 1 146 ALA 146 140 ? ? ? C . n C 1 147 LYS 147 141 ? ? ? C . n C 1 148 LYS 148 142 ? ? ? C . n C 1 149 LEU 149 143 ? ? ? C . n C 1 150 ARG 150 144 ? ? ? C . n C 1 151 ARG 151 145 ? ? ? C . n C 1 152 GLN 152 146 ? ? ? C . n C 1 153 PHE 153 147 ? ? ? C . n D 1 1 MET 1 -5 ? ? ? D . n D 1 2 HIS 2 -4 ? ? ? D . n D 1 3 HIS 3 -3 ? ? ? D . n D 1 4 HIS 4 -2 ? ? ? D . n D 1 5 HIS 5 -1 ? ? ? D . n D 1 6 HIS 6 0 ? ? ? D . n D 1 7 HIS 7 1 ? ? ? D . n D 1 8 ALA 8 2 ? ? ? D . n D 1 9 GLY 9 3 ? ? ? D . n D 1 10 ASN 10 4 4 ASN ASN D . n D 1 11 SER 11 5 5 SER SER D . n D 1 12 ILE 12 6 6 ILE ILE D . n D 1 13 LEU 13 7 7 LEU LEU D . n D 1 14 LEU 14 8 8 LEU LEU D . n D 1 15 ALA 15 9 9 ALA ALA D . n D 1 16 ALA 16 10 10 ALA ALA D . n D 1 17 VAL 17 11 11 VAL VAL D . n D 1 18 SER 18 12 12 SER SER D . n D 1 19 ILE 19 13 13 ILE ILE D . n D 1 20 LEU 20 14 14 LEU LEU D . n D 1 21 SER 21 15 15 SER SER D . n D 1 22 ALA 22 16 16 ALA ALA D . n D 1 23 CYS 23 17 17 CYS CYS D . n D 1 24 GLN 24 18 18 GLN GLN D . n D 1 25 GLN 25 19 19 GLN GLN D . n D 1 26 SER 26 20 20 SER SER D . n D 1 27 TYR 27 21 21 TYR TYR D . n D 1 28 PHE 28 22 22 PHE PHE D . n D 1 29 ALA 29 23 23 ALA ALA D . n D 1 30 LEU 30 24 24 LEU LEU D . n D 1 31 GLN 31 25 25 GLN GLN D . n D 1 32 VAL 32 26 26 VAL VAL D . n D 1 33 GLY 33 27 27 GLY GLY D . n D 1 34 LYS 34 28 28 LYS LYS D . n D 1 35 ALA 35 29 29 ALA ALA D . n D 1 36 ARG 36 30 30 ARG ARG D . n D 1 37 LEU 37 31 31 LEU LEU D . n D 1 38 LYS 38 32 32 LYS LYS D . n D 1 39 TYR 39 33 33 TYR TYR D . n D 1 40 LYS 40 34 34 LYS LYS D . n D 1 41 VAL 41 35 35 VAL VAL D . n D 1 42 THR 42 36 36 THR THR D . n D 1 43 PRO 43 37 37 PRO PRO D . n D 1 44 PRO 44 38 38 PRO PRO D . n D 1 45 ALA 45 39 39 ALA ALA D . n D 1 46 VAL 46 40 40 VAL VAL D . n D 1 47 THR 47 41 41 THR THR D . n D 1 48 GLY 48 42 42 GLY GLY D . n D 1 49 SER 49 43 43 SER SER D . n D 1 50 PRO 50 44 44 PRO PRO D . n D 1 51 GLU 51 45 45 GLU GLU D . n D 1 52 PHE 52 46 46 PHE PHE D . n D 1 53 GLU 53 47 47 GLU GLU D . n D 1 54 ARG 54 48 48 ARG ARG D . n D 1 55 VAL 55 49 49 VAL VAL D . n D 1 56 PHE 56 50 50 PHE PHE D . n D 1 57 ARG 57 51 51 ARG ARG D . n D 1 58 ALA 58 52 52 ALA ALA D . n D 1 59 GLN 59 53 53 GLN GLN D . n D 1 60 GLN 60 54 54 GLN GLN D . n D 1 61 ASN 61 55 55 ASN ASN D . n D 1 62 CYS 62 56 56 CYS CYS D . n D 1 63 VAL 63 57 57 VAL VAL D . n D 1 64 GLU 64 58 58 GLU GLU D . n D 1 65 PHE 65 59 59 PHE PHE D . n D 1 66 TYR 66 60 60 TYR TYR D . n D 1 67 PRO 67 61 61 PRO PRO D . n D 1 68 ILE 68 62 62 ILE ILE D . n D 1 69 PHE 69 63 63 PHE PHE D . n D 1 70 ILE 70 64 64 ILE ILE D . n D 1 71 ILE 71 65 65 ILE ILE D . n D 1 72 THR 72 66 66 THR THR D . n D 1 73 LEU 73 67 67 LEU LEU D . n D 1 74 TRP 74 68 68 TRP TRP D . n D 1 75 MET 75 69 69 MET MET D . n D 1 76 ALA 76 70 70 ALA ALA D . n D 1 77 GLY 77 71 71 GLY GLY D . n D 1 78 TRP 78 72 72 TRP TRP D . n D 1 79 TYR 79 73 73 TYR TYR D . n D 1 80 PHE 80 74 74 PHE PHE D . n D 1 81 ASN 81 75 75 ASN ASN D . n D 1 82 GLN 82 76 76 GLN GLN D . n D 1 83 VAL 83 77 77 VAL VAL D . n D 1 84 PHE 84 78 78 PHE PHE D . n D 1 85 ALA 85 79 79 ALA ALA D . n D 1 86 THR 86 80 80 THR THR D . n D 1 87 CYS 87 81 81 CYS CYS D . n D 1 88 LEU 88 82 82 LEU LEU D . n D 1 89 GLY 89 83 83 GLY GLY D . n D 1 90 LEU 90 84 84 LEU LEU D . n D 1 91 VAL 91 85 85 VAL VAL D . n D 1 92 TYR 92 86 86 TYR TYR D . n D 1 93 ILE 93 87 87 ILE ILE D . n D 1 94 TYR 94 88 88 TYR TYR D . n D 1 95 GLY 95 89 89 GLY GLY D . n D 1 96 ARG 96 90 90 ARG ARG D . n D 1 97 HIS 97 91 91 HIS HIS D . n D 1 98 LEU 98 92 92 LEU LEU D . n D 1 99 TYR 99 93 93 TYR TYR D . n D 1 100 PHE 100 94 94 PHE PHE D . n D 1 101 TRP 101 95 95 TRP TRP D . n D 1 102 GLY 102 96 96 GLY GLY D . n D 1 103 TYR 103 97 97 TYR TYR D . n D 1 104 SER 104 98 98 SER SER D . n D 1 105 GLU 105 99 99 GLU GLU D . n D 1 106 ALA 106 100 100 ALA ALA D . n D 1 107 ALA 107 101 101 ALA ALA D . n D 1 108 LYS 108 102 102 LYS LYS D . n D 1 109 LYS 109 103 103 LYS LYS D . n D 1 110 ARG 110 104 104 ARG ARG D . n D 1 111 ILE 111 105 105 ILE ILE D . n D 1 112 THR 112 106 106 THR THR D . n D 1 113 GLY 113 107 107 GLY GLY D . n D 1 114 PHE 114 108 108 PHE PHE D . n D 1 115 ARG 115 109 109 ARG ARG D . n D 1 116 LEU 116 110 110 LEU LEU D . n D 1 117 SER 117 111 111 SER SER D . n D 1 118 LEU 118 112 112 LEU LEU D . n D 1 119 GLY 119 113 113 GLY GLY D . n D 1 120 ILE 120 114 114 ILE ILE D . n D 1 121 LEU 121 115 115 LEU LEU D . n D 1 122 ALA 122 116 116 ALA ALA D . n D 1 123 LEU 123 117 117 LEU LEU D . n D 1 124 LEU 124 118 118 LEU LEU D . n D 1 125 THR 125 119 119 THR THR D . n D 1 126 LEU 126 120 120 LEU LEU D . n D 1 127 LEU 127 121 121 LEU LEU D . n D 1 128 GLY 128 122 122 GLY GLY D . n D 1 129 ALA 129 123 123 ALA ALA D . n D 1 130 LEU 130 124 124 LEU LEU D . n D 1 131 GLY 131 125 125 GLY GLY D . n D 1 132 ILE 132 126 126 ILE ILE D . n D 1 133 ALA 133 127 127 ALA ALA D . n D 1 134 ASN 134 128 128 ASN ASN D . n D 1 135 SER 135 129 129 SER SER D . n D 1 136 PHE 136 130 130 PHE PHE D . n D 1 137 LEU 137 131 131 LEU LEU D . n D 1 138 ASP 138 132 ? ? ? D . n D 1 139 GLU 139 133 ? ? ? D . n D 1 140 TYR 140 134 ? ? ? D . n D 1 141 LEU 141 135 ? ? ? D . n D 1 142 ASP 142 136 ? ? ? D . n D 1 143 LEU 143 137 ? ? ? D . n D 1 144 ASN 144 138 ? ? ? D . n D 1 145 ILE 145 139 ? ? ? D . n D 1 146 ALA 146 140 ? ? ? D . n D 1 147 LYS 147 141 ? ? ? D . n D 1 148 LYS 148 142 ? ? ? D . n D 1 149 LEU 149 143 ? ? ? D . n D 1 150 ARG 150 144 ? ? ? D . n D 1 151 ARG 151 145 ? ? ? D . n D 1 152 GLN 152 146 ? ? ? D . n D 1 153 PHE 153 147 ? ? ? D . n E 1 1 MET 1 -5 ? ? ? E . n E 1 2 HIS 2 -4 ? ? ? E . n E 1 3 HIS 3 -3 ? ? ? E . n E 1 4 HIS 4 -2 ? ? ? E . n E 1 5 HIS 5 -1 ? ? ? E . n E 1 6 HIS 6 0 ? ? ? E . n E 1 7 HIS 7 1 ? ? ? E . n E 1 8 ALA 8 2 ? ? ? E . n E 1 9 GLY 9 3 ? ? ? E . n E 1 10 ASN 10 4 4 ASN ASN E . n E 1 11 SER 11 5 5 SER SER E . n E 1 12 ILE 12 6 6 ILE ILE E . n E 1 13 LEU 13 7 7 LEU LEU E . n E 1 14 LEU 14 8 8 LEU LEU E . n E 1 15 ALA 15 9 9 ALA ALA E . n E 1 16 ALA 16 10 10 ALA ALA E . n E 1 17 VAL 17 11 11 VAL VAL E . n E 1 18 SER 18 12 12 SER SER E . n E 1 19 ILE 19 13 13 ILE ILE E . n E 1 20 LEU 20 14 14 LEU LEU E . n E 1 21 SER 21 15 15 SER SER E . n E 1 22 ALA 22 16 16 ALA ALA E . n E 1 23 CYS 23 17 17 CYS CYS E . n E 1 24 GLN 24 18 18 GLN GLN E . n E 1 25 GLN 25 19 19 GLN GLN E . n E 1 26 SER 26 20 20 SER SER E . n E 1 27 TYR 27 21 21 TYR TYR E . n E 1 28 PHE 28 22 22 PHE PHE E . n E 1 29 ALA 29 23 23 ALA ALA E . n E 1 30 LEU 30 24 24 LEU LEU E . n E 1 31 GLN 31 25 25 GLN GLN E . n E 1 32 VAL 32 26 26 VAL VAL E . n E 1 33 GLY 33 27 27 GLY GLY E . n E 1 34 LYS 34 28 28 LYS LYS E . n E 1 35 ALA 35 29 29 ALA ALA E . n E 1 36 ARG 36 30 30 ARG ARG E . n E 1 37 LEU 37 31 31 LEU LEU E . n E 1 38 LYS 38 32 32 LYS LYS E . n E 1 39 TYR 39 33 33 TYR TYR E . n E 1 40 LYS 40 34 34 LYS LYS E . n E 1 41 VAL 41 35 35 VAL VAL E . n E 1 42 THR 42 36 36 THR THR E . n E 1 43 PRO 43 37 37 PRO PRO E . n E 1 44 PRO 44 38 38 PRO PRO E . n E 1 45 ALA 45 39 39 ALA ALA E . n E 1 46 VAL 46 40 40 VAL VAL E . n E 1 47 THR 47 41 41 THR THR E . n E 1 48 GLY 48 42 42 GLY GLY E . n E 1 49 SER 49 43 43 SER SER E . n E 1 50 PRO 50 44 44 PRO PRO E . n E 1 51 GLU 51 45 45 GLU GLU E . n E 1 52 PHE 52 46 46 PHE PHE E . n E 1 53 GLU 53 47 47 GLU GLU E . n E 1 54 ARG 54 48 48 ARG ARG E . n E 1 55 VAL 55 49 49 VAL VAL E . n E 1 56 PHE 56 50 50 PHE PHE E . n E 1 57 ARG 57 51 51 ARG ARG E . n E 1 58 ALA 58 52 52 ALA ALA E . n E 1 59 GLN 59 53 53 GLN GLN E . n E 1 60 GLN 60 54 54 GLN GLN E . n E 1 61 ASN 61 55 55 ASN ASN E . n E 1 62 CYS 62 56 56 CYS CYS E . n E 1 63 VAL 63 57 57 VAL VAL E . n E 1 64 GLU 64 58 58 GLU GLU E . n E 1 65 PHE 65 59 59 PHE PHE E . n E 1 66 TYR 66 60 60 TYR TYR E . n E 1 67 PRO 67 61 61 PRO PRO E . n E 1 68 ILE 68 62 62 ILE ILE E . n E 1 69 PHE 69 63 63 PHE PHE E . n E 1 70 ILE 70 64 64 ILE ILE E . n E 1 71 ILE 71 65 65 ILE ILE E . n E 1 72 THR 72 66 66 THR THR E . n E 1 73 LEU 73 67 67 LEU LEU E . n E 1 74 TRP 74 68 68 TRP TRP E . n E 1 75 MET 75 69 69 MET MET E . n E 1 76 ALA 76 70 70 ALA ALA E . n E 1 77 GLY 77 71 71 GLY GLY E . n E 1 78 TRP 78 72 72 TRP TRP E . n E 1 79 TYR 79 73 73 TYR TYR E . n E 1 80 PHE 80 74 74 PHE PHE E . n E 1 81 ASN 81 75 75 ASN ASN E . n E 1 82 GLN 82 76 76 GLN GLN E . n E 1 83 VAL 83 77 77 VAL VAL E . n E 1 84 PHE 84 78 78 PHE PHE E . n E 1 85 ALA 85 79 79 ALA ALA E . n E 1 86 THR 86 80 80 THR THR E . n E 1 87 CYS 87 81 81 CYS CYS E . n E 1 88 LEU 88 82 82 LEU LEU E . n E 1 89 GLY 89 83 83 GLY GLY E . n E 1 90 LEU 90 84 84 LEU LEU E . n E 1 91 VAL 91 85 85 VAL VAL E . n E 1 92 TYR 92 86 86 TYR TYR E . n E 1 93 ILE 93 87 87 ILE ILE E . n E 1 94 TYR 94 88 88 TYR TYR E . n E 1 95 GLY 95 89 89 GLY GLY E . n E 1 96 ARG 96 90 90 ARG ARG E . n E 1 97 HIS 97 91 91 HIS HIS E . n E 1 98 LEU 98 92 92 LEU LEU E . n E 1 99 TYR 99 93 93 TYR TYR E . n E 1 100 PHE 100 94 94 PHE PHE E . n E 1 101 TRP 101 95 95 TRP TRP E . n E 1 102 GLY 102 96 96 GLY GLY E . n E 1 103 TYR 103 97 97 TYR TYR E . n E 1 104 SER 104 98 98 SER SER E . n E 1 105 GLU 105 99 99 GLU GLU E . n E 1 106 ALA 106 100 100 ALA ALA E . n E 1 107 ALA 107 101 101 ALA ALA E . n E 1 108 LYS 108 102 102 LYS LYS E . n E 1 109 LYS 109 103 103 LYS LYS E . n E 1 110 ARG 110 104 104 ARG ARG E . n E 1 111 ILE 111 105 105 ILE ILE E . n E 1 112 THR 112 106 106 THR THR E . n E 1 113 GLY 113 107 107 GLY GLY E . n E 1 114 PHE 114 108 108 PHE PHE E . n E 1 115 ARG 115 109 109 ARG ARG E . n E 1 116 LEU 116 110 110 LEU LEU E . n E 1 117 SER 117 111 111 SER SER E . n E 1 118 LEU 118 112 112 LEU LEU E . n E 1 119 GLY 119 113 113 GLY GLY E . n E 1 120 ILE 120 114 114 ILE ILE E . n E 1 121 LEU 121 115 115 LEU LEU E . n E 1 122 ALA 122 116 116 ALA ALA E . n E 1 123 LEU 123 117 117 LEU LEU E . n E 1 124 LEU 124 118 118 LEU LEU E . n E 1 125 THR 125 119 119 THR THR E . n E 1 126 LEU 126 120 120 LEU LEU E . n E 1 127 LEU 127 121 121 LEU LEU E . n E 1 128 GLY 128 122 122 GLY GLY E . n E 1 129 ALA 129 123 123 ALA ALA E . n E 1 130 LEU 130 124 124 LEU LEU E . n E 1 131 GLY 131 125 125 GLY GLY E . n E 1 132 ILE 132 126 126 ILE ILE E . n E 1 133 ALA 133 127 127 ALA ALA E . n E 1 134 ASN 134 128 128 ASN ASN E . n E 1 135 SER 135 129 129 SER SER E . n E 1 136 PHE 136 130 130 PHE PHE E . n E 1 137 LEU 137 131 131 LEU LEU E . n E 1 138 ASP 138 132 132 ASP ASP E . n E 1 139 GLU 139 133 133 GLU GLU E . n E 1 140 TYR 140 134 ? ? ? E . n E 1 141 LEU 141 135 ? ? ? E . n E 1 142 ASP 142 136 ? ? ? E . n E 1 143 LEU 143 137 ? ? ? E . n E 1 144 ASN 144 138 ? ? ? E . n E 1 145 ILE 145 139 ? ? ? E . n E 1 146 ALA 146 140 ? ? ? E . n E 1 147 LYS 147 141 ? ? ? E . n E 1 148 LYS 148 142 ? ? ? E . n E 1 149 LEU 149 143 ? ? ? E . n E 1 150 ARG 150 144 ? ? ? E . n E 1 151 ARG 151 145 ? ? ? E . n E 1 152 GLN 152 146 ? ? ? E . n E 1 153 PHE 153 147 ? ? ? E . n F 1 1 MET 1 -5 ? ? ? F . n F 1 2 HIS 2 -4 ? ? ? F . n F 1 3 HIS 3 -3 ? ? ? F . n F 1 4 HIS 4 -2 ? ? ? F . n F 1 5 HIS 5 -1 ? ? ? F . n F 1 6 HIS 6 0 ? ? ? F . n F 1 7 HIS 7 1 ? ? ? F . n F 1 8 ALA 8 2 ? ? ? F . n F 1 9 GLY 9 3 ? ? ? F . n F 1 10 ASN 10 4 4 ASN ASN F . n F 1 11 SER 11 5 5 SER SER F . n F 1 12 ILE 12 6 6 ILE ILE F . n F 1 13 LEU 13 7 7 LEU LEU F . n F 1 14 LEU 14 8 8 LEU LEU F . n F 1 15 ALA 15 9 9 ALA ALA F . n F 1 16 ALA 16 10 10 ALA ALA F . n F 1 17 VAL 17 11 11 VAL VAL F . n F 1 18 SER 18 12 12 SER SER F . n F 1 19 ILE 19 13 13 ILE ILE F . n F 1 20 LEU 20 14 14 LEU LEU F . n F 1 21 SER 21 15 15 SER SER F . n F 1 22 ALA 22 16 16 ALA ALA F . n F 1 23 CYS 23 17 17 CYS CYS F . n F 1 24 GLN 24 18 18 GLN GLN F . n F 1 25 GLN 25 19 19 GLN GLN F . n F 1 26 SER 26 20 20 SER SER F . n F 1 27 TYR 27 21 21 TYR TYR F . n F 1 28 PHE 28 22 22 PHE PHE F . n F 1 29 ALA 29 23 23 ALA ALA F . n F 1 30 LEU 30 24 24 LEU LEU F . n F 1 31 GLN 31 25 25 GLN GLN F . n F 1 32 VAL 32 26 26 VAL VAL F . n F 1 33 GLY 33 27 27 GLY GLY F . n F 1 34 LYS 34 28 28 LYS LYS F . n F 1 35 ALA 35 29 29 ALA ALA F . n F 1 36 ARG 36 30 30 ARG ARG F . n F 1 37 LEU 37 31 31 LEU LEU F . n F 1 38 LYS 38 32 32 LYS LYS F . n F 1 39 TYR 39 33 33 TYR TYR F . n F 1 40 LYS 40 34 34 LYS LYS F . n F 1 41 VAL 41 35 35 VAL VAL F . n F 1 42 THR 42 36 36 THR THR F . n F 1 43 PRO 43 37 37 PRO PRO F . n F 1 44 PRO 44 38 38 PRO PRO F . n F 1 45 ALA 45 39 39 ALA ALA F . n F 1 46 VAL 46 40 40 VAL VAL F . n F 1 47 THR 47 41 41 THR THR F . n F 1 48 GLY 48 42 42 GLY GLY F . n F 1 49 SER 49 43 43 SER SER F . n F 1 50 PRO 50 44 44 PRO PRO F . n F 1 51 GLU 51 45 45 GLU GLU F . n F 1 52 PHE 52 46 46 PHE PHE F . n F 1 53 GLU 53 47 47 GLU GLU F . n F 1 54 ARG 54 48 48 ARG ARG F . n F 1 55 VAL 55 49 49 VAL VAL F . n F 1 56 PHE 56 50 50 PHE PHE F . n F 1 57 ARG 57 51 51 ARG ARG F . n F 1 58 ALA 58 52 52 ALA ALA F . n F 1 59 GLN 59 53 53 GLN GLN F . n F 1 60 GLN 60 54 54 GLN GLN F . n F 1 61 ASN 61 55 55 ASN ASN F . n F 1 62 CYS 62 56 56 CYS CYS F . n F 1 63 VAL 63 57 57 VAL VAL F . n F 1 64 GLU 64 58 58 GLU GLU F . n F 1 65 PHE 65 59 59 PHE PHE F . n F 1 66 TYR 66 60 60 TYR TYR F . n F 1 67 PRO 67 61 61 PRO PRO F . n F 1 68 ILE 68 62 62 ILE ILE F . n F 1 69 PHE 69 63 63 PHE PHE F . n F 1 70 ILE 70 64 64 ILE ILE F . n F 1 71 ILE 71 65 65 ILE ILE F . n F 1 72 THR 72 66 66 THR THR F . n F 1 73 LEU 73 67 67 LEU LEU F . n F 1 74 TRP 74 68 68 TRP TRP F . n F 1 75 MET 75 69 69 MET MET F . n F 1 76 ALA 76 70 70 ALA ALA F . n F 1 77 GLY 77 71 71 GLY GLY F . n F 1 78 TRP 78 72 72 TRP TRP F . n F 1 79 TYR 79 73 73 TYR TYR F . n F 1 80 PHE 80 74 74 PHE PHE F . n F 1 81 ASN 81 75 75 ASN ASN F . n F 1 82 GLN 82 76 76 GLN GLN F . n F 1 83 VAL 83 77 77 VAL VAL F . n F 1 84 PHE 84 78 78 PHE PHE F . n F 1 85 ALA 85 79 79 ALA ALA F . n F 1 86 THR 86 80 80 THR THR F . n F 1 87 CYS 87 81 81 CYS CYS F . n F 1 88 LEU 88 82 82 LEU LEU F . n F 1 89 GLY 89 83 83 GLY GLY F . n F 1 90 LEU 90 84 84 LEU LEU F . n F 1 91 VAL 91 85 85 VAL VAL F . n F 1 92 TYR 92 86 86 TYR TYR F . n F 1 93 ILE 93 87 87 ILE ILE F . n F 1 94 TYR 94 88 88 TYR TYR F . n F 1 95 GLY 95 89 89 GLY GLY F . n F 1 96 ARG 96 90 90 ARG ARG F . n F 1 97 HIS 97 91 91 HIS HIS F . n F 1 98 LEU 98 92 92 LEU LEU F . n F 1 99 TYR 99 93 93 TYR TYR F . n F 1 100 PHE 100 94 94 PHE PHE F . n F 1 101 TRP 101 95 95 TRP TRP F . n F 1 102 GLY 102 96 96 GLY GLY F . n F 1 103 TYR 103 97 97 TYR TYR F . n F 1 104 SER 104 98 98 SER SER F . n F 1 105 GLU 105 99 99 GLU GLU F . n F 1 106 ALA 106 100 100 ALA ALA F . n F 1 107 ALA 107 101 101 ALA ALA F . n F 1 108 LYS 108 102 102 LYS LYS F . n F 1 109 LYS 109 103 103 LYS LYS F . n F 1 110 ARG 110 104 104 ARG ARG F . n F 1 111 ILE 111 105 105 ILE ILE F . n F 1 112 THR 112 106 106 THR THR F . n F 1 113 GLY 113 107 107 GLY GLY F . n F 1 114 PHE 114 108 108 PHE PHE F . n F 1 115 ARG 115 109 109 ARG ARG F . n F 1 116 LEU 116 110 110 LEU LEU F . n F 1 117 SER 117 111 111 SER SER F . n F 1 118 LEU 118 112 112 LEU LEU F . n F 1 119 GLY 119 113 113 GLY GLY F . n F 1 120 ILE 120 114 114 ILE ILE F . n F 1 121 LEU 121 115 115 LEU LEU F . n F 1 122 ALA 122 116 116 ALA ALA F . n F 1 123 LEU 123 117 117 LEU LEU F . n F 1 124 LEU 124 118 118 LEU LEU F . n F 1 125 THR 125 119 119 THR THR F . n F 1 126 LEU 126 120 120 LEU LEU F . n F 1 127 LEU 127 121 121 LEU LEU F . n F 1 128 GLY 128 122 122 GLY GLY F . n F 1 129 ALA 129 123 123 ALA ALA F . n F 1 130 LEU 130 124 124 LEU LEU F . n F 1 131 GLY 131 125 125 GLY GLY F . n F 1 132 ILE 132 126 126 ILE ILE F . n F 1 133 ALA 133 127 127 ALA ALA F . n F 1 134 ASN 134 128 128 ASN ASN F . n F 1 135 SER 135 129 129 SER SER F . n F 1 136 PHE 136 130 130 PHE PHE F . n F 1 137 LEU 137 131 131 LEU LEU F . n F 1 138 ASP 138 132 132 ASP ASP F . n F 1 139 GLU 139 133 ? ? ? F . n F 1 140 TYR 140 134 ? ? ? F . n F 1 141 LEU 141 135 ? ? ? F . n F 1 142 ASP 142 136 ? ? ? F . n F 1 143 LEU 143 137 ? ? ? F . n F 1 144 ASN 144 138 ? ? ? F . n F 1 145 ILE 145 139 ? ? ? F . n F 1 146 ALA 146 140 ? ? ? F . n F 1 147 LYS 147 141 ? ? ? F . n F 1 148 LYS 148 142 ? ? ? F . n F 1 149 LEU 149 143 ? ? ? F . n F 1 150 ARG 150 144 ? ? ? F . n F 1 151 ARG 151 145 ? ? ? F . n F 1 152 GLN 152 146 ? ? ? F . n F 1 153 PHE 153 147 ? ? ? F . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code G 2 SO4 1 201 9 SO4 SO4 A . H 3 NA 1 202 8 NA NA A . I 2 SO4 1 201 11 SO4 SO4 B . J 4 M88 1 202 1 M88 M88 B . K 4 M88 1 203 2 M88 M88 B . L 4 M88 1 204 4 M88 M88 B . M 4 M88 1 205 5 M88 M88 B . N 2 SO4 1 201 5 SO4 SO4 C . O 3 NA 1 202 7 NA NA C . P 5 GOL 1 203 1 GOL GOL C . Q 2 SO4 1 201 8 SO4 SO4 D . R 3 NA 1 202 5 NA NA D . S 2 SO4 1 201 6 SO4 SO4 E . T 3 NA 1 202 6 NA NA E . U 5 GOL 1 203 2 GOL GOL E . V 6 SCN 1 204 3 SCN SCN E . W 7 K 1 205 1 K K E . X 2 SO4 1 201 10 SO4 SO4 F . Y 4 M88 1 202 3 M88 M88 F . Z 3 NA 1 203 4 NA NA F . AA 8 HOH 1 301 51 HOH HOH A . AA 8 HOH 2 302 150 HOH HOH A . AA 8 HOH 3 303 25 HOH HOH A . AA 8 HOH 4 304 53 HOH HOH A . AA 8 HOH 5 305 146 HOH HOH A . AA 8 HOH 6 306 52 HOH HOH A . AA 8 HOH 7 307 107 HOH HOH A . AA 8 HOH 8 308 80 HOH HOH A . AA 8 HOH 9 309 75 HOH HOH A . AA 8 HOH 10 310 38 HOH HOH A . AA 8 HOH 11 311 148 HOH HOH A . AA 8 HOH 12 312 39 HOH HOH A . AA 8 HOH 13 313 135 HOH HOH A . AA 8 HOH 14 314 128 HOH HOH A . AA 8 HOH 15 315 99 HOH HOH A . AA 8 HOH 16 316 85 HOH HOH A . AA 8 HOH 17 317 86 HOH HOH A . AA 8 HOH 18 318 123 HOH HOH A . BA 8 HOH 1 301 16 HOH HOH B . BA 8 HOH 2 302 118 HOH HOH B . BA 8 HOH 3 303 77 HOH HOH B . BA 8 HOH 4 304 78 HOH HOH B . BA 8 HOH 5 305 134 HOH HOH B . BA 8 HOH 6 306 137 HOH HOH B . CA 8 HOH 1 301 124 HOH HOH C . CA 8 HOH 2 302 70 HOH HOH C . CA 8 HOH 3 303 145 HOH HOH C . CA 8 HOH 4 304 92 HOH HOH C . CA 8 HOH 5 305 83 HOH HOH C . CA 8 HOH 6 306 125 HOH HOH C . CA 8 HOH 7 307 49 HOH HOH C . CA 8 HOH 8 308 84 HOH HOH C . CA 8 HOH 9 309 130 HOH HOH C . CA 8 HOH 10 310 154 HOH HOH C . CA 8 HOH 11 311 90 HOH HOH C . CA 8 HOH 12 312 131 HOH HOH C . CA 8 HOH 13 313 136 HOH HOH C . DA 8 HOH 1 301 64 HOH HOH D . DA 8 HOH 2 302 43 HOH HOH D . DA 8 HOH 3 303 42 HOH HOH D . DA 8 HOH 4 304 48 HOH HOH D . DA 8 HOH 5 305 127 HOH HOH D . DA 8 HOH 6 306 98 HOH HOH D . DA 8 HOH 7 307 95 HOH HOH D . DA 8 HOH 8 308 7 HOH HOH D . DA 8 HOH 9 309 114 HOH HOH D . DA 8 HOH 10 310 47 HOH HOH D . DA 8 HOH 11 311 46 HOH HOH D . EA 8 HOH 1 301 50 HOH HOH E . EA 8 HOH 2 302 152 HOH HOH E . EA 8 HOH 3 303 91 HOH HOH E . EA 8 HOH 4 304 139 HOH HOH E . EA 8 HOH 5 305 138 HOH HOH E . EA 8 HOH 6 306 94 HOH HOH E . EA 8 HOH 7 307 10 HOH HOH E . EA 8 HOH 8 308 151 HOH HOH E . EA 8 HOH 9 309 22 HOH HOH E . EA 8 HOH 10 310 24 HOH HOH E . EA 8 HOH 11 311 14 HOH HOH E . EA 8 HOH 12 312 155 HOH HOH E . EA 8 HOH 13 313 122 HOH HOH E . FA 8 HOH 1 301 103 HOH HOH F . FA 8 HOH 2 302 141 HOH HOH F . FA 8 HOH 3 303 149 HOH HOH F . FA 8 HOH 4 304 31 HOH HOH F . FA 8 HOH 5 305 153 HOH HOH F . FA 8 HOH 6 306 147 HOH HOH F . FA 8 HOH 7 307 29 HOH HOH F . FA 8 HOH 8 308 144 HOH HOH F . FA 8 HOH 9 309 26 HOH HOH F . FA 8 HOH 10 310 143 HOH HOH F . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ASN 4 ? CG ? A ASN 10 CG 2 1 Y 1 A ASN 4 ? OD1 ? A ASN 10 OD1 3 1 Y 1 A ASN 4 ? ND2 ? A ASN 10 ND2 4 1 Y 1 A LEU 24 ? CG ? A LEU 30 CG 5 1 Y 1 A LEU 24 ? CD1 ? A LEU 30 CD1 6 1 Y 1 A LEU 24 ? CD2 ? A LEU 30 CD2 7 1 Y 1 A LYS 34 ? CD ? A LYS 40 CD 8 1 Y 1 A LYS 34 ? CE ? A LYS 40 CE 9 1 Y 1 A LYS 34 ? NZ ? A LYS 40 NZ 10 1 Y 1 A ALA 127 ? CB ? A ALA 133 CB 11 1 Y 1 A GLU 133 ? CD ? A GLU 139 CD 12 1 Y 1 A GLU 133 ? OE1 ? A GLU 139 OE1 13 1 Y 1 A GLU 133 ? OE2 ? A GLU 139 OE2 14 1 Y 1 B LYS 28 ? CG ? B LYS 34 CG 15 1 Y 1 B LYS 28 ? CD ? B LYS 34 CD 16 1 Y 1 B LYS 28 ? CE ? B LYS 34 CE 17 1 Y 1 B LYS 28 ? NZ ? B LYS 34 NZ 18 1 Y 1 B GLU 45 ? OE1 ? B GLU 51 OE1 19 1 Y 1 B GLU 45 ? OE2 ? B GLU 51 OE2 20 1 Y 1 B GLU 47 ? OE1 ? B GLU 53 OE1 21 1 Y 1 B GLU 47 ? OE2 ? B GLU 53 OE2 22 1 Y 1 B GLU 99 ? CG ? B GLU 105 CG 23 1 Y 1 B GLU 99 ? CD ? B GLU 105 CD 24 1 Y 1 B GLU 99 ? OE1 ? B GLU 105 OE1 25 1 Y 1 B GLU 99 ? OE2 ? B GLU 105 OE2 26 1 Y 1 B LYS 102 ? NZ ? B LYS 108 NZ 27 1 Y 1 B LYS 103 ? CE ? B LYS 109 CE 28 1 Y 1 B LYS 103 ? NZ ? B LYS 109 NZ 29 1 Y 1 C ARG 109 ? NH1 ? C ARG 115 NH1 30 1 Y 1 C ARG 109 ? NH2 ? C ARG 115 NH2 31 1 Y 1 C TYR 134 ? CD1 ? C TYR 140 CD1 32 1 Y 1 C TYR 134 ? CD2 ? C TYR 140 CD2 33 1 Y 1 C TYR 134 ? CE1 ? C TYR 140 CE1 34 1 Y 1 C TYR 134 ? CE2 ? C TYR 140 CE2 35 1 Y 1 C TYR 134 ? CZ ? C TYR 140 CZ 36 1 Y 1 C TYR 134 ? OH ? C TYR 140 OH 37 1 Y 1 D LYS 28 ? CG ? D LYS 34 CG 38 1 Y 1 D LYS 28 ? CD ? D LYS 34 CD 39 1 Y 1 D LYS 28 ? CE ? D LYS 34 CE 40 1 Y 1 D LYS 28 ? NZ ? D LYS 34 NZ 41 1 Y 1 D LYS 34 ? CD ? D LYS 40 CD 42 1 Y 1 D LYS 34 ? CE ? D LYS 40 CE 43 1 Y 1 D LYS 34 ? NZ ? D LYS 40 NZ 44 1 Y 1 D LYS 102 ? CD ? D LYS 108 CD 45 1 Y 1 D LYS 102 ? CE ? D LYS 108 CE 46 1 Y 1 D LYS 102 ? NZ ? D LYS 108 NZ 47 1 Y 1 D LEU 131 ? CG ? D LEU 137 CG 48 1 Y 1 D LEU 131 ? CD1 ? D LEU 137 CD1 49 1 Y 1 D LEU 131 ? CD2 ? D LEU 137 CD2 50 1 Y 1 E LEU 24 ? CG ? E LEU 30 CG 51 1 Y 1 E LEU 24 ? CD1 ? E LEU 30 CD1 52 1 Y 1 E LEU 24 ? CD2 ? E LEU 30 CD2 53 1 Y 1 E LYS 34 ? CE ? E LYS 40 CE 54 1 Y 1 E LYS 34 ? NZ ? E LYS 40 NZ 55 1 Y 1 E LYS 102 ? CG ? E LYS 108 CG 56 1 Y 1 E LYS 102 ? CD ? E LYS 108 CD 57 1 Y 1 E LYS 102 ? CE ? E LYS 108 CE 58 1 Y 1 E LYS 102 ? NZ ? E LYS 108 NZ 59 1 Y 1 E PHE 130 ? CD1 ? E PHE 136 CD1 60 1 Y 1 E PHE 130 ? CD2 ? E PHE 136 CD2 61 1 Y 1 E PHE 130 ? CE1 ? E PHE 136 CE1 62 1 Y 1 E PHE 130 ? CE2 ? E PHE 136 CE2 63 1 Y 1 E PHE 130 ? CZ ? E PHE 136 CZ 64 1 Y 1 E GLU 133 ? CG ? E GLU 139 CG 65 1 Y 1 E GLU 133 ? CD ? E GLU 139 CD 66 1 Y 1 E GLU 133 ? OE1 ? E GLU 139 OE1 67 1 Y 1 E GLU 133 ? OE2 ? E GLU 139 OE2 68 1 Y 1 F LYS 28 ? NZ ? F LYS 34 NZ 69 1 Y 1 F LYS 32 ? NZ ? F LYS 38 NZ 70 1 Y 1 F GLU 99 ? CG ? F GLU 105 CG 71 1 Y 1 F GLU 99 ? CD ? F GLU 105 CD 72 1 Y 1 F GLU 99 ? OE1 ? F GLU 105 OE1 73 1 Y 1 F GLU 99 ? OE2 ? F GLU 105 OE2 74 1 Y 1 F ILE 105 ? CD1 ? F ILE 111 CD1 75 1 N 1 B M88 202 ? C07 ? J M88 1 C07 76 1 N 1 B M88 202 ? C08 ? J M88 1 C08 77 1 N 1 B M88 202 ? C09 ? J M88 1 C09 78 1 N 1 B M88 202 ? C10 ? J M88 1 C10 79 1 N 1 B M88 202 ? C06 ? J M88 1 C06 80 1 N 1 B M88 202 ? C05 ? J M88 1 C05 81 1 N 1 B M88 202 ? C04 ? J M88 1 C04 82 1 N 1 B M88 202 ? C03 ? J M88 1 C03 83 1 N 1 B M88 202 ? C02 ? J M88 1 C02 84 1 N 1 B M88 202 ? C01 ? J M88 1 C01 85 1 N 1 B M88 203 ? C06 ? K M88 1 C06 86 1 N 1 B M88 203 ? C05 ? K M88 1 C05 87 1 N 1 B M88 203 ? C04 ? K M88 1 C04 88 1 N 1 B M88 203 ? C03 ? K M88 1 C03 89 1 N 1 B M88 203 ? C02 ? K M88 1 C02 90 1 N 1 B M88 203 ? C01 ? K M88 1 C01 91 1 N 1 B M88 204 ? C06 ? L M88 1 C06 92 1 N 1 B M88 204 ? C05 ? L M88 1 C05 93 1 N 1 B M88 204 ? C04 ? L M88 1 C04 94 1 N 1 B M88 204 ? C03 ? L M88 1 C03 95 1 N 1 B M88 204 ? C02 ? L M88 1 C02 96 1 N 1 B M88 204 ? C01 ? L M88 1 C01 97 1 N 1 B M88 205 ? C07 ? M M88 1 C07 98 1 N 1 B M88 205 ? C08 ? M M88 1 C08 99 1 N 1 B M88 205 ? C09 ? M M88 1 C09 100 1 N 1 B M88 205 ? C10 ? M M88 1 C10 101 1 N 1 B M88 205 ? O17 ? M M88 1 O17 102 1 N 1 B M88 205 ? O18 ? M M88 1 O18 103 1 N 1 B M88 205 ? C19 ? M M88 1 C19 104 1 N 1 B M88 205 ? C20 ? M M88 1 C20 105 1 N 1 B M88 205 ? O21 ? M M88 1 O21 106 1 N 1 B M88 205 ? C22 ? M M88 1 C22 107 1 N 1 B M88 205 ? O23 ? M M88 1 O23 108 1 N 1 B M88 205 ? C06 ? M M88 1 C06 109 1 N 1 B M88 205 ? C05 ? M M88 1 C05 110 1 N 1 B M88 205 ? C04 ? M M88 1 C04 111 1 N 1 B M88 205 ? C03 ? M M88 1 C03 112 1 N 1 B M88 205 ? C02 ? M M88 1 C02 113 1 N 1 B M88 205 ? C01 ? M M88 1 C01 114 1 N 1 F M88 202 ? C06 ? Y M88 1 C06 115 1 N 1 F M88 202 ? C05 ? Y M88 1 C05 116 1 N 1 F M88 202 ? C04 ? Y M88 1 C04 117 1 N 1 F M88 202 ? C03 ? Y M88 1 C03 118 1 N 1 F M88 202 ? C02 ? Y M88 1 C02 119 1 N 1 F M88 202 ? C01 ? Y M88 1 C01 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.9_1683 1 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 5 # _cell.angle_alpha 67.930 _cell.angle_alpha_esd ? _cell.angle_beta 86.710 _cell.angle_beta_esd ? _cell.angle_gamma 86.860 _cell.angle_gamma_esd ? _cell.entry_id 6SSS _cell.details ? _cell.formula_units_Z ? _cell.length_a 54.886 _cell.length_a_esd ? _cell.length_b 72.162 _cell.length_b_esd ? _cell.length_c 72.692 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6SSS _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6SSS _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.01 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 59.19 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'LIPIDIC CUBIC PHASE' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 4.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;0.1M Sodium acetate pH 4.5 0.4M Sodium sulfate 0.1M Potassium thiocyanate 17% PEG 400 ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 2M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2015-12-07 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.8729 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE ID23-2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.8729 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ID23-2 _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6SSS _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.49 _reflns.d_resolution_low 43.3290 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 35150 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.29 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.5 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 5.31 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.989 _reflns.pdbx_R_split ? _reflns.pdbx_CC_star ? # _reflns_shell.d_res_high 2.49 _reflns_shell.d_res_low 2.58 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 0.99 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 35150 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.433 _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_CC_star ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 126.660 _refine.B_iso_mean 54.3550 _refine.B_iso_min 24.040 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6SSS _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.4980 _refine.ls_d_res_low 43.3290 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 35132 _refine.ls_number_reflns_R_free 1755 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.2400 _refine.ls_percent_reflns_R_free 5.0000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2209 _refine.ls_R_factor_R_free 0.2670 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2184 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.950 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 6SSR _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 29.9900 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3800 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.4980 _refine_hist.d_res_low 43.3290 _refine_hist.number_atoms_solvent 71 _refine_hist.number_atoms_total 6482 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 786 _refine_hist.pdbx_B_iso_mean_ligand 56.76 _refine_hist.pdbx_B_iso_mean_solvent 49.96 _refine_hist.pdbx_number_atoms_protein 6176 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 235 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.005 ? 6485 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.880 ? 8798 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.034 ? 977 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.004 ? 1077 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 14.135 ? 2232 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_restr_ncs.pdbx_refine_id _refine_ls_restr_ncs.dom_id _refine_ls_restr_ncs.ncs_model_details _refine_ls_restr_ncs.rms_dev_B_iso _refine_ls_restr_ncs.rms_dev_position _refine_ls_restr_ncs.weight_B_iso _refine_ls_restr_ncs.weight_position _refine_ls_restr_ncs.pdbx_ordinal _refine_ls_restr_ncs.pdbx_type _refine_ls_restr_ncs.pdbx_asym_id _refine_ls_restr_ncs.pdbx_auth_asym_id _refine_ls_restr_ncs.pdbx_number _refine_ls_restr_ncs.pdbx_rms _refine_ls_restr_ncs.pdbx_weight _refine_ls_restr_ncs.pdbx_ens_id 'X-RAY DIFFRACTION' 1 ? ? ? ? ? 1 TORSIONAL ? A 4746 10.228 ? 1 'X-RAY DIFFRACTION' 2 ? ? ? ? ? 2 TORSIONAL ? B 4746 10.228 ? 1 'X-RAY DIFFRACTION' 3 ? ? ? ? ? 3 TORSIONAL ? C 4746 10.228 ? 1 'X-RAY DIFFRACTION' 4 ? ? ? ? ? 4 TORSIONAL ? D 4746 10.228 ? 1 'X-RAY DIFFRACTION' 5 ? ? ? ? ? 5 TORSIONAL ? E 4746 10.228 ? 1 'X-RAY DIFFRACTION' 6 ? ? ? ? ? 6 TORSIONAL ? F 4746 10.228 ? 1 # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.4980 2.5651 . . 131 2481 96.0000 . . . 0.3520 0.0000 0.3054 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.5651 2.6406 . . 134 2553 98.0000 . . . 0.3458 0.0000 0.3013 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.6406 2.7258 . . 136 2590 98.0000 . . . 0.3738 0.0000 0.2839 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.7258 2.8232 . . 135 2560 99.0000 . . . 0.3198 0.0000 0.2685 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.8232 2.9362 . . 137 2592 98.0000 . . . 0.2720 0.0000 0.2520 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.9362 3.0698 . . 134 2560 98.0000 . . . 0.2910 0.0000 0.2433 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.0698 3.2316 . . 137 2596 98.0000 . . . 0.3076 0.0000 0.2296 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.2316 3.4340 . . 136 2582 99.0000 . . . 0.2765 0.0000 0.2166 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.4340 3.6990 . . 133 2543 98.0000 . . . 0.2738 0.0000 0.2227 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.6990 4.0710 . . 134 2564 98.0000 . . . 0.2353 0.0000 0.2018 . . . . . . . . . . 'X-RAY DIFFRACTION' 4.0710 4.6595 . . 137 2602 99.0000 . . . 0.2373 0.0000 0.1751 . . . . . . . . . . 'X-RAY DIFFRACTION' 4.6595 5.8682 . . 135 2573 99.0000 . . . 0.2542 0.0000 0.2044 . . . . . . . . . . 'X-RAY DIFFRACTION' 5.8682 . . . 136 2581 99.0000 . . . 0.2123 0.0000 0.1911 . . . . . . . . . . # loop_ _struct_ncs_dom.pdbx_ens_id _struct_ncs_dom.id _struct_ncs_dom.details 1 1 'chain A and segid' 1 2 'chain B and segid' 1 3 'chain C and segid' 1 4 'chain D and segid' 1 5 'chain E and segid' 1 6 'chain F and segid' # loop_ _struct_ncs_dom_lim.pdbx_ens_id _struct_ncs_dom_lim.dom_id _struct_ncs_dom_lim.pdbx_component_id _struct_ncs_dom_lim.beg_label_asym_id _struct_ncs_dom_lim.beg_label_comp_id _struct_ncs_dom_lim.beg_label_seq_id _struct_ncs_dom_lim.beg_label_alt_id _struct_ncs_dom_lim.end_label_asym_id _struct_ncs_dom_lim.end_label_comp_id _struct_ncs_dom_lim.end_label_seq_id _struct_ncs_dom_lim.end_label_alt_id _struct_ncs_dom_lim.beg_auth_asym_id _struct_ncs_dom_lim.beg_auth_comp_id _struct_ncs_dom_lim.beg_auth_seq_id _struct_ncs_dom_lim.end_auth_asym_id _struct_ncs_dom_lim.end_auth_comp_id _struct_ncs_dom_lim.end_auth_seq_id _struct_ncs_dom_lim.pdbx_refine_code _struct_ncs_dom_lim.selection_details 1 1 1 A ASN 10 . A LEU 137 . A ASN 4 A LEU 131 ? 'chain A and segid' 1 2 1 B ASN 10 . B LEU 137 . B ASN 4 B LEU 131 ? 'chain B and segid' 1 3 1 C ASN 10 . C LEU 137 . C ASN 4 C LEU 131 ? 'chain C and segid' 1 4 1 D ASN 10 . D LEU 137 . D ASN 4 D LEU 131 ? 'chain D and segid' 1 5 1 E ASN 10 . E LEU 137 . E ASN 4 E LEU 131 ? 'chain E and segid' 1 6 1 F ASN 10 . F LEU 137 . F ASN 4 F LEU 131 ? 'chain F and segid' # _struct_ncs_ens.id 1 _struct_ncs_ens.details ? # _struct.entry_id 6SSS _struct.title 'Crystal structure of Human Microsomal Glutathione S-Transferase 2' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6SSS _struct_keywords.text 'ER MEMBRANE PROTEIN, GLUTATHIONE TRANSFERASE, MAPEG, MGST2, INTEGRAL MEMBRANE ENZYME, TRANSFERASE' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 1 ? D N N 1 ? E N N 1 ? F N N 1 ? G N N 2 ? H N N 3 ? I N N 2 ? J N N 4 ? K N N 4 ? L N N 4 ? M N N 4 ? N N N 2 ? O N N 3 ? P N N 5 ? Q N N 2 ? R N N 3 ? S N N 2 ? T N N 3 ? U N N 5 ? V N N 6 ? W N N 7 ? X N N 2 ? Y N N 4 ? Z N N 3 ? AA N N 8 ? BA N N 8 ? CA N N 8 ? DA N N 8 ? EA N N 8 ? FA N N 8 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code MGST2_HUMAN _struct_ref.pdbx_db_accession Q99735 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;AGNSILLAAVSILSACQQSYFALQVGKARLKYKVTPPAVTGSPEFERVFRAQQNCVEFYPIFIITLWMAGWYFNQVFATC LGLVYIYGRHLYFWGYSEAAKKRITGFRLSLGILALLTLLGALGIANSFLDEYLDLNIAKKLRRQF ; _struct_ref.pdbx_align_begin 2 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 6SSS A 8 ? 153 ? Q99735 2 ? 147 ? 2 147 2 1 6SSS B 8 ? 153 ? Q99735 2 ? 147 ? 2 147 3 1 6SSS C 8 ? 153 ? Q99735 2 ? 147 ? 2 147 4 1 6SSS D 8 ? 153 ? Q99735 2 ? 147 ? 2 147 5 1 6SSS E 8 ? 153 ? Q99735 2 ? 147 ? 2 147 6 1 6SSS F 8 ? 153 ? Q99735 2 ? 147 ? 2 147 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6SSS MET A 1 ? UNP Q99735 ? ? 'initiating methionine' -5 1 1 6SSS HIS A 2 ? UNP Q99735 ? ? 'expression tag' -4 2 1 6SSS HIS A 3 ? UNP Q99735 ? ? 'expression tag' -3 3 1 6SSS HIS A 4 ? UNP Q99735 ? ? 'expression tag' -2 4 1 6SSS HIS A 5 ? UNP Q99735 ? ? 'expression tag' -1 5 1 6SSS HIS A 6 ? UNP Q99735 ? ? 'expression tag' 0 6 1 6SSS HIS A 7 ? UNP Q99735 ? ? 'expression tag' 1 7 2 6SSS MET B 1 ? UNP Q99735 ? ? 'initiating methionine' -5 8 2 6SSS HIS B 2 ? UNP Q99735 ? ? 'expression tag' -4 9 2 6SSS HIS B 3 ? UNP Q99735 ? ? 'expression tag' -3 10 2 6SSS HIS B 4 ? UNP Q99735 ? ? 'expression tag' -2 11 2 6SSS HIS B 5 ? UNP Q99735 ? ? 'expression tag' -1 12 2 6SSS HIS B 6 ? UNP Q99735 ? ? 'expression tag' 0 13 2 6SSS HIS B 7 ? UNP Q99735 ? ? 'expression tag' 1 14 3 6SSS MET C 1 ? UNP Q99735 ? ? 'initiating methionine' -5 15 3 6SSS HIS C 2 ? UNP Q99735 ? ? 'expression tag' -4 16 3 6SSS HIS C 3 ? UNP Q99735 ? ? 'expression tag' -3 17 3 6SSS HIS C 4 ? UNP Q99735 ? ? 'expression tag' -2 18 3 6SSS HIS C 5 ? UNP Q99735 ? ? 'expression tag' -1 19 3 6SSS HIS C 6 ? UNP Q99735 ? ? 'expression tag' 0 20 3 6SSS HIS C 7 ? UNP Q99735 ? ? 'expression tag' 1 21 4 6SSS MET D 1 ? UNP Q99735 ? ? 'initiating methionine' -5 22 4 6SSS HIS D 2 ? UNP Q99735 ? ? 'expression tag' -4 23 4 6SSS HIS D 3 ? UNP Q99735 ? ? 'expression tag' -3 24 4 6SSS HIS D 4 ? UNP Q99735 ? ? 'expression tag' -2 25 4 6SSS HIS D 5 ? UNP Q99735 ? ? 'expression tag' -1 26 4 6SSS HIS D 6 ? UNP Q99735 ? ? 'expression tag' 0 27 4 6SSS HIS D 7 ? UNP Q99735 ? ? 'expression tag' 1 28 5 6SSS MET E 1 ? UNP Q99735 ? ? 'initiating methionine' -5 29 5 6SSS HIS E 2 ? UNP Q99735 ? ? 'expression tag' -4 30 5 6SSS HIS E 3 ? UNP Q99735 ? ? 'expression tag' -3 31 5 6SSS HIS E 4 ? UNP Q99735 ? ? 'expression tag' -2 32 5 6SSS HIS E 5 ? UNP Q99735 ? ? 'expression tag' -1 33 5 6SSS HIS E 6 ? UNP Q99735 ? ? 'expression tag' 0 34 5 6SSS HIS E 7 ? UNP Q99735 ? ? 'expression tag' 1 35 6 6SSS MET F 1 ? UNP Q99735 ? ? 'initiating methionine' -5 36 6 6SSS HIS F 2 ? UNP Q99735 ? ? 'expression tag' -4 37 6 6SSS HIS F 3 ? UNP Q99735 ? ? 'expression tag' -3 38 6 6SSS HIS F 4 ? UNP Q99735 ? ? 'expression tag' -2 39 6 6SSS HIS F 5 ? UNP Q99735 ? ? 'expression tag' -1 40 6 6SSS HIS F 6 ? UNP Q99735 ? ? 'expression tag' 0 41 6 6SSS HIS F 7 ? UNP Q99735 ? ? 'expression tag' 1 42 # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_and_software_defined_assembly PISA trimeric 3 2 author_and_software_defined_assembly PISA trimeric 3 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 7070 ? 1 MORE -143 ? 1 'SSA (A^2)' 17340 ? 2 'ABSA (A^2)' 7280 ? 2 MORE -157 ? 2 'SSA (A^2)' 16490 ? # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B,C,G,H,I,J,K,L,M,N,O,P,AA,BA,CA 2 1 D,E,F,Q,R,S,T,U,V,W,X,Y,Z,DA,EA,FA # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'native gel electrophoresis' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 11 ? TYR A 39 ? SER A 5 TYR A 33 1 ? 29 HELX_P HELX_P2 AA2 SER A 49 ? PHE A 80 ? SER A 43 PHE A 74 1 ? 32 HELX_P HELX_P3 AA3 ASN A 81 ? ALA A 106 ? ASN A 75 ALA A 100 1 ? 26 HELX_P HELX_P4 AA4 ALA A 107 ? LYS A 109 ? ALA A 101 LYS A 103 5 ? 3 HELX_P HELX_P5 AA5 ARG A 110 ? TYR A 140 ? ARG A 104 TYR A 134 1 ? 31 HELX_P HELX_P6 AA6 SER B 11 ? TYR B 39 ? SER B 5 TYR B 33 1 ? 29 HELX_P HELX_P7 AA7 SER B 49 ? PHE B 80 ? SER B 43 PHE B 74 1 ? 32 HELX_P HELX_P8 AA8 ASN B 81 ? ALA B 106 ? ASN B 75 ALA B 100 1 ? 26 HELX_P HELX_P9 AA9 ALA B 107 ? LYS B 109 ? ALA B 101 LYS B 103 5 ? 3 HELX_P HELX_P10 AB1 ARG B 110 ? ASP B 138 ? ARG B 104 ASP B 132 1 ? 29 HELX_P HELX_P11 AB2 SER C 11 ? TYR C 39 ? SER C 5 TYR C 33 1 ? 29 HELX_P HELX_P12 AB3 SER C 49 ? PHE C 80 ? SER C 43 PHE C 74 1 ? 32 HELX_P HELX_P13 AB4 ASN C 81 ? ALA C 106 ? ASN C 75 ALA C 100 1 ? 26 HELX_P HELX_P14 AB5 ALA C 107 ? LYS C 109 ? ALA C 101 LYS C 103 5 ? 3 HELX_P HELX_P15 AB6 ARG C 110 ? LEU C 137 ? ARG C 104 LEU C 131 1 ? 28 HELX_P HELX_P16 AB7 ASP C 138 ? TYR C 140 ? ASP C 132 TYR C 134 5 ? 3 HELX_P HELX_P17 AB8 SER D 11 ? TYR D 39 ? SER D 5 TYR D 33 1 ? 29 HELX_P HELX_P18 AB9 SER D 49 ? PHE D 80 ? SER D 43 PHE D 74 1 ? 32 HELX_P HELX_P19 AC1 ASN D 81 ? ALA D 106 ? ASN D 75 ALA D 100 1 ? 26 HELX_P HELX_P20 AC2 ALA D 107 ? LYS D 109 ? ALA D 101 LYS D 103 5 ? 3 HELX_P HELX_P21 AC3 ARG D 110 ? LEU D 137 ? ARG D 104 LEU D 131 1 ? 28 HELX_P HELX_P22 AC4 SER E 11 ? TYR E 39 ? SER E 5 TYR E 33 1 ? 29 HELX_P HELX_P23 AC5 SER E 49 ? PHE E 80 ? SER E 43 PHE E 74 1 ? 32 HELX_P HELX_P24 AC6 ASN E 81 ? ALA E 106 ? ASN E 75 ALA E 100 1 ? 26 HELX_P HELX_P25 AC7 ALA E 107 ? LYS E 109 ? ALA E 101 LYS E 103 5 ? 3 HELX_P HELX_P26 AC8 ARG E 110 ? GLU E 139 ? ARG E 104 GLU E 133 1 ? 30 HELX_P HELX_P27 AC9 SER F 11 ? TYR F 39 ? SER F 5 TYR F 33 1 ? 29 HELX_P HELX_P28 AD1 SER F 49 ? PHE F 80 ? SER F 43 PHE F 74 1 ? 32 HELX_P HELX_P29 AD2 ASN F 81 ? ALA F 106 ? ASN F 75 ALA F 100 1 ? 26 HELX_P HELX_P30 AD3 ALA F 107 ? LYS F 109 ? ALA F 101 LYS F 103 5 ? 3 HELX_P HELX_P31 AD4 ARG F 110 ? ASP F 138 ? ARG F 104 ASP F 132 1 ? 29 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? C VAL 63 O ? ? ? 1_555 O NA . NA ? ? C VAL 57 C NA 202 1_555 ? ? ? ? ? ? ? 2.774 ? ? metalc2 metalc ? ? E CYS 62 O ? ? ? 1_555 W K . K ? ? E CYS 56 E K 205 1_555 ? ? ? ? ? ? ? 2.903 ? ? metalc3 metalc ? ? E TYR 92 OH ? ? ? 1_555 W K . K ? ? E TYR 86 E K 205 1_555 ? ? ? ? ? ? ? 2.717 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_struct_conn_angle.id 1 _pdbx_struct_conn_angle.ptnr1_label_atom_id O _pdbx_struct_conn_angle.ptnr1_label_alt_id ? _pdbx_struct_conn_angle.ptnr1_label_asym_id E _pdbx_struct_conn_angle.ptnr1_label_comp_id CYS _pdbx_struct_conn_angle.ptnr1_label_seq_id 62 _pdbx_struct_conn_angle.ptnr1_auth_atom_id ? _pdbx_struct_conn_angle.ptnr1_auth_asym_id E _pdbx_struct_conn_angle.ptnr1_auth_comp_id CYS _pdbx_struct_conn_angle.ptnr1_auth_seq_id 56 _pdbx_struct_conn_angle.ptnr1_PDB_ins_code ? _pdbx_struct_conn_angle.ptnr1_symmetry 1_555 _pdbx_struct_conn_angle.ptnr2_label_atom_id K _pdbx_struct_conn_angle.ptnr2_label_alt_id ? _pdbx_struct_conn_angle.ptnr2_label_asym_id W _pdbx_struct_conn_angle.ptnr2_label_comp_id K _pdbx_struct_conn_angle.ptnr2_label_seq_id . _pdbx_struct_conn_angle.ptnr2_auth_atom_id ? _pdbx_struct_conn_angle.ptnr2_auth_asym_id E _pdbx_struct_conn_angle.ptnr2_auth_comp_id K _pdbx_struct_conn_angle.ptnr2_auth_seq_id 205 _pdbx_struct_conn_angle.ptnr2_PDB_ins_code ? _pdbx_struct_conn_angle.ptnr2_symmetry 1_555 _pdbx_struct_conn_angle.ptnr3_label_atom_id OH _pdbx_struct_conn_angle.ptnr3_label_alt_id ? _pdbx_struct_conn_angle.ptnr3_label_asym_id E _pdbx_struct_conn_angle.ptnr3_label_comp_id TYR _pdbx_struct_conn_angle.ptnr3_label_seq_id 92 _pdbx_struct_conn_angle.ptnr3_auth_atom_id ? _pdbx_struct_conn_angle.ptnr3_auth_asym_id E _pdbx_struct_conn_angle.ptnr3_auth_comp_id TYR _pdbx_struct_conn_angle.ptnr3_auth_seq_id 86 _pdbx_struct_conn_angle.ptnr3_PDB_ins_code ? _pdbx_struct_conn_angle.ptnr3_symmetry 1_555 _pdbx_struct_conn_angle.value 143.8 _pdbx_struct_conn_angle.value_esd ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 PRO 43 A . ? PRO 37 A PRO 44 A ? PRO 38 A 1 2.34 2 PRO 43 B . ? PRO 37 B PRO 44 B ? PRO 38 B 1 3.03 3 PRO 43 C . ? PRO 37 C PRO 44 C ? PRO 38 C 1 2.46 4 PRO 43 D . ? PRO 37 D PRO 44 D ? PRO 38 D 1 2.75 5 PRO 43 E . ? PRO 37 E PRO 44 E ? PRO 38 E 1 1.47 6 PRO 43 F . ? PRO 37 F PRO 44 F ? PRO 38 F 1 3.77 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A SO4 201 ? 5 'binding site for residue SO4 A 201' AC2 Software A NA 202 ? 4 'binding site for residue NA A 202' AC3 Software B SO4 201 ? 4 'binding site for residue SO4 B 201' AC4 Software B M88 202 ? 7 'binding site for residue M88 B 202' AC5 Software B M88 203 ? 4 'binding site for residue M88 B 203' AC6 Software B M88 204 ? 2 'binding site for residue M88 B 204' AC7 Software B M88 205 ? 1 'binding site for residue M88 B 205' AC8 Software C SO4 201 ? 6 'binding site for residue SO4 C 201' AC9 Software C NA 202 ? 3 'binding site for residue NA C 202' AD1 Software C GOL 203 ? 3 'binding site for residue GOL C 203' AD2 Software D SO4 201 ? 6 'binding site for residue SO4 D 201' AD3 Software D NA 202 ? 3 'binding site for residue NA D 202' AD4 Software E SO4 201 ? 6 'binding site for residue SO4 E 201' AD5 Software E NA 202 ? 4 'binding site for residue NA E 202' AD6 Software E GOL 203 ? 2 'binding site for residue GOL E 203' AD7 Software E SCN 204 ? 3 'binding site for residue SCN E 204' AD8 Software E K 205 ? 5 'binding site for residue K E 205' AD9 Software F SO4 201 ? 4 'binding site for residue SO4 F 201' AE1 Software F M88 202 ? 4 'binding site for residue M88 F 202' AE2 Software F NA 203 ? 1 'binding site for residue NA F 203' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 ARG A 57 ? ARG A 51 . ? 1_555 ? 2 AC1 5 ASN A 61 ? ASN A 55 . ? 1_555 ? 3 AC1 5 TYR A 99 ? TYR A 93 . ? 1_555 ? 4 AC1 5 TYR A 103 ? TYR A 97 . ? 1_555 ? 5 AC1 5 ARG A 110 ? ARG A 104 . ? 1_555 ? 6 AC2 4 GLN A 24 ? GLN A 18 . ? 1_555 ? 7 AC2 4 PHE A 28 ? PHE A 22 . ? 1_555 ? 8 AC2 4 HIS A 97 ? HIS A 91 . ? 1_555 ? 9 AC2 4 TRP A 101 ? TRP A 95 . ? 1_555 ? 10 AC3 4 ARG B 57 ? ARG B 51 . ? 1_555 ? 11 AC3 4 TYR B 99 ? TYR B 93 . ? 1_555 ? 12 AC3 4 TYR B 103 ? TYR B 97 . ? 1_555 ? 13 AC3 4 ARG C 36 ? ARG C 30 . ? 1_555 ? 14 AC4 7 ARG B 115 ? ARG B 109 . ? 1_555 ? 15 AC4 7 GLY B 119 ? GLY B 113 . ? 1_555 ? 16 AC4 7 ILE B 120 ? ILE B 114 . ? 1_555 ? 17 AC4 7 LEU B 123 ? LEU B 117 . ? 1_555 ? 18 AC4 7 LEU E 130 ? LEU E 124 . ? 1_555 ? 19 AC4 7 ASN E 134 ? ASN E 128 . ? 1_555 ? 20 AC4 7 LEU E 137 ? LEU E 131 . ? 1_555 ? 21 AC5 4 ASN B 134 ? ASN B 128 . ? 1_555 ? 22 AC5 4 CYS F 87 ? CYS F 81 . ? 1_555 ? 23 AC5 4 LEU F 90 ? LEU F 84 . ? 1_555 ? 24 AC5 4 TYR F 94 ? TYR F 88 . ? 1_555 ? 25 AC6 2 ALA B 122 ? ALA B 116 . ? 1_555 ? 26 AC6 2 THR B 125 ? THR B 119 . ? 1_555 ? 27 AC7 1 PHE B 84 ? PHE B 78 . ? 1_555 ? 28 AC8 6 ARG A 36 ? ARG A 30 . ? 1_555 ? 29 AC8 6 ARG C 57 ? ARG C 51 . ? 1_555 ? 30 AC8 6 ASN C 61 ? ASN C 55 . ? 1_555 ? 31 AC8 6 TYR C 99 ? TYR C 93 . ? 1_555 ? 32 AC8 6 TYR C 103 ? TYR C 97 . ? 1_555 ? 33 AC8 6 ARG C 110 ? ARG C 104 . ? 1_555 ? 34 AC9 3 PRO B 67 ? PRO B 61 . ? 1_555 ? 35 AC9 3 VAL C 63 ? VAL C 57 . ? 1_555 ? 36 AC9 3 PRO C 67 ? PRO C 61 . ? 1_555 ? 37 AD1 3 TYR C 79 ? TYR C 73 . ? 1_555 ? 38 AD1 3 PHE C 80 ? PHE C 74 . ? 1_555 ? 39 AD1 3 ASN C 134 ? ASN C 128 . ? 1_555 ? 40 AD2 6 ARG D 57 ? ARG D 51 . ? 1_555 ? 41 AD2 6 ASN D 61 ? ASN D 55 . ? 1_555 ? 42 AD2 6 TYR D 99 ? TYR D 93 . ? 1_555 ? 43 AD2 6 TYR D 103 ? TYR D 97 . ? 1_555 ? 44 AD2 6 ARG D 110 ? ARG D 104 . ? 1_555 ? 45 AD2 6 ARG E 36 ? ARG E 30 . ? 1_555 ? 46 AD3 3 GLN D 24 ? GLN D 18 . ? 1_555 ? 47 AD3 3 HIS D 97 ? HIS D 91 . ? 1_555 ? 48 AD3 3 TRP D 101 ? TRP D 95 . ? 1_555 ? 49 AD4 6 ARG E 57 ? ARG E 51 . ? 1_555 ? 50 AD4 6 ASN E 61 ? ASN E 55 . ? 1_555 ? 51 AD4 6 TYR E 99 ? TYR E 93 . ? 1_555 ? 52 AD4 6 TYR E 103 ? TYR E 97 . ? 1_555 ? 53 AD4 6 ARG E 110 ? ARG E 104 . ? 1_555 ? 54 AD4 6 ARG F 36 ? ARG F 30 . ? 1_555 ? 55 AD5 4 GLN E 24 ? GLN E 18 . ? 1_555 ? 56 AD5 4 PHE E 28 ? PHE E 22 . ? 1_555 ? 57 AD5 4 HIS E 97 ? HIS E 91 . ? 1_555 ? 58 AD5 4 TRP E 101 ? TRP E 95 . ? 1_555 ? 59 AD6 2 LEU E 137 ? LEU E 131 . ? 1_555 ? 60 AD6 2 ASP E 138 ? ASP E 132 . ? 1_555 ? 61 AD7 3 GLN E 24 ? GLN E 18 . ? 1_555 ? 62 AD7 3 GLN E 25 ? GLN E 19 . ? 1_555 ? 63 AD7 3 K W . ? K E 205 . ? 1_555 ? 64 AD8 5 CYS E 62 ? CYS E 56 . ? 1_555 ? 65 AD8 5 PHE E 65 ? PHE E 59 . ? 1_555 ? 66 AD8 5 TYR E 66 ? TYR E 60 . ? 1_555 ? 67 AD8 5 TYR E 92 ? TYR E 86 . ? 1_555 ? 68 AD8 5 SCN V . ? SCN E 204 . ? 1_555 ? 69 AD9 4 ARG D 36 ? ARG D 30 . ? 1_555 ? 70 AD9 4 ARG F 57 ? ARG F 51 . ? 1_555 ? 71 AD9 4 ASN F 61 ? ASN F 55 . ? 1_555 ? 72 AD9 4 TYR F 103 ? TYR F 97 . ? 1_555 ? 73 AE1 4 LEU B 90 ? LEU B 84 . ? 1_655 ? 74 AE1 4 TYR B 94 ? TYR B 88 . ? 1_655 ? 75 AE1 4 ALA F 133 ? ALA F 127 . ? 1_555 ? 76 AE1 4 ASN F 134 ? ASN F 128 . ? 1_555 ? 77 AE2 1 GLN F 24 ? GLN F 18 . ? 1_555 ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A HOH 305 ? ? O A HOH 311 ? ? 2.02 2 1 O F HOH 305 ? ? O F HOH 306 ? ? 2.10 3 1 NH2 E ARG 30 ? ? O E ALA 39 ? ? 2.12 4 1 ND2 E ASN 55 ? B O4 E SO4 201 ? ? 2.19 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 C _pdbx_validate_symm_contact.auth_comp_id_1 HOH _pdbx_validate_symm_contact.auth_seq_id_1 309 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 E _pdbx_validate_symm_contact.auth_comp_id_2 HOH _pdbx_validate_symm_contact.auth_seq_id_2 308 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 1_546 _pdbx_validate_symm_contact.dist 2.13 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 TYR A 33 ? ? -101.83 52.92 2 1 LYS A 34 ? ? 4.01 49.38 3 1 PHE A 74 ? ? -114.24 -70.07 4 1 PHE B 74 ? ? -116.67 -71.27 5 1 LEU C 131 ? ? -64.41 2.90 6 1 SER D 5 ? ? -142.18 22.93 7 1 TYR D 33 ? ? -102.02 53.73 8 1 LYS D 34 ? ? 7.41 48.47 9 1 TYR E 33 ? ? -103.39 57.00 10 1 LYS E 34 ? ? 3.57 48.77 11 1 LYS F 34 ? ? -114.63 50.68 12 1 PHE F 74 ? ? -116.88 -71.47 # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined 12.9529 23.2347 -8.4399 0.3219 ? -0.0760 ? 0.0006 ? 0.3527 ? -0.0021 ? 0.3627 ? 0.0459 ? -0.2328 ? -0.3618 ? 0.3198 ? 0.3733 ? 0.4589 ? -0.0134 ? -0.2271 ? 0.0647 ? 0.1915 ? 0.1429 ? 0.3368 ? -0.2487 ? -0.1972 ? -0.0000 ? 2 'X-RAY DIFFRACTION' ? refined 16.7641 2.4930 -2.6108 0.6313 ? -0.0334 ? -0.0241 ? 0.4039 ? 0.1459 ? 0.3951 ? 1.6558 ? 1.5477 ? -0.4556 ? 1.7774 ? 0.0439 ? 0.6806 ? -0.2077 ? -0.3685 ? -0.7734 ? 0.7858 ? -0.2522 ? -1.0428 ? 0.6162 ? 0.2959 ? 0.0205 ? 3 'X-RAY DIFFRACTION' ? refined 6.0333 20.6939 -14.4967 0.2908 ? -0.0407 ? 0.0221 ? 0.3095 ? -0.0051 ? 0.3339 ? 0.5345 ? -0.0299 ? -0.1388 ? 0.1613 ? 0.0190 ? 0.5597 ? 0.0215 ? 0.0160 ? -0.0247 ? -0.0462 ? -0.1105 ? -0.0401 ? 0.0562 ? -0.0866 ? 0.0000 ? 4 'X-RAY DIFFRACTION' ? refined 0.6037 25.9806 -27.0309 0.3276 ? -0.0795 ? -0.0456 ? 0.3441 ? -0.0163 ? 0.3413 ? 0.9857 ? -0.3353 ? 0.5562 ? 0.9262 ? 0.5196 ? 0.7008 ? -0.1194 ? 0.1373 ? 0.2135 ? -0.2378 ? 0.4469 ? 0.3165 ? -0.0591 ? -0.7395 ? 0.0000 ? 5 'X-RAY DIFFRACTION' ? refined 6.5229 15.6230 -28.8351 0.2838 ? -0.0507 ? 0.0305 ? 0.3883 ? 0.0034 ? 0.4406 ? 0.5868 ? -0.3526 ? -0.1977 ? 0.5745 ? 0.6277 ? 0.5609 ? -0.1466 ? 0.0176 ? 0.0048 ? -0.2288 ? 0.3377 ? 0.3086 ? 0.1950 ? -0.1232 ? -0.0002 ? 6 'X-RAY DIFFRACTION' ? refined 13.5122 10.3762 -24.3473 0.3081 ? -0.0114 ? 0.0101 ? 0.3224 ? 0.0212 ? 0.2738 ? 1.4104 ? -0.5933 ? 0.2770 ? 0.5245 ? 0.1072 ? 0.3194 ? 0.0006 ? 0.0739 ? -0.1013 ? 0.1724 ? 0.1429 ? 0.0008 ? -0.0602 ? -0.1022 ? 0.0001 ? 7 'X-RAY DIFFRACTION' ? refined 20.8585 15.7814 -35.3165 0.3376 ? -0.0062 ? 0.0246 ? 0.3795 ? -0.0115 ? 0.3572 ? 0.6611 ? -0.1998 ? 0.0458 ? 0.3074 ? 0.1104 ? 0.8395 ? -0.0168 ? 0.1955 ? -0.1124 ? -0.3074 ? 0.2043 ? -0.0606 ? 0.0427 ? -0.0008 ? -0.0000 ? 8 'X-RAY DIFFRACTION' ? refined 26.9420 10.7655 -22.3507 0.4494 ? 0.0619 ? -0.0105 ? 0.3788 ? 0.0104 ? 0.4301 ? 0.8127 ? 0.1842 ? -0.5901 ? 0.2543 ? 0.1399 ? 0.5811 ? -0.0138 ? -0.0958 ? -0.0332 ? -0.3672 ? -0.1798 ? -0.4161 ? 0.2300 ? 0.2797 ? 0.0000 ? 9 'X-RAY DIFFRACTION' ? refined 24.9182 22.5702 -12.3956 0.3610 ? 0.0416 ? -0.0344 ? 0.4094 ? -0.0397 ? 0.3841 ? 1.0852 ? -0.2094 ? 0.1186 ? 0.4656 ? 0.2327 ? 1.0863 ? 0.1065 ? -0.2998 ? -0.0578 ? 0.1361 ? 0.0062 ? -0.1139 ? 0.0010 ? 0.2110 ? 0.0000 ? 10 'X-RAY DIFFRACTION' ? refined 55.7550 27.3457 -54.8601 0.4921 ? -0.0088 ? 0.0358 ? 0.4458 ? 0.0239 ? 0.4037 ? 0.5943 ? -0.4809 ? 0.3518 ? 0.2758 ? 0.0091 ? 0.4054 ? -0.1215 ? -0.0293 ? -0.0414 ? -0.6557 ? 0.3404 ? -0.0137 ? -0.0623 ? 0.2594 ? -0.0004 ? 11 'X-RAY DIFFRACTION' ? refined 52.6202 24.6294 -65.4085 0.4105 ? 0.0225 ? 0.0549 ? 0.3554 ? -0.0063 ? 0.3502 ? 0.5509 ? 0.2000 ? 0.2384 ? 0.5115 ? 0.3446 ? 0.5238 ? 0.0496 ? 0.2660 ? 0.0337 ? -0.2493 ? -0.0189 ? -0.1730 ? -0.0327 ? 0.1496 ? -0.0001 ? 12 'X-RAY DIFFRACTION' ? refined 40.2437 20.2837 -69.9019 0.4466 ? 0.0477 ? -0.0062 ? 0.4446 ? 0.0136 ? 0.4390 ? 0.0696 ? 0.3694 ? 0.4580 ? 0.5817 ? 0.5529 ? 0.6291 ? 0.2160 ? 0.7030 ? 0.0431 ? 0.2075 ? 0.2006 ? 0.5472 ? 0.0153 ? -0.0919 ? 0.0061 ? 13 'X-RAY DIFFRACTION' ? refined 43.8991 41.0629 -75.5215 0.7042 ? 0.0714 ? -0.0450 ? 0.4821 ? 0.0892 ? 0.6207 ? 0.2008 ? -0.2291 ? -0.5814 ? 0.4929 ? 1.0916 ? 2.4404 ? -0.2573 ? 0.0881 ? 0.5336 ? -1.0639 ? 0.4156 ? 0.1156 ? -0.7198 ? 0.2897 ? 0.1441 ? 14 'X-RAY DIFFRACTION' ? refined 33.3757 22.8268 -63.6851 0.3487 ? -0.0230 ? -0.0896 ? 0.3496 ? -0.0019 ? 0.3592 ? 0.7118 ? 0.1528 ? -0.5141 ? 0.5765 ? 0.0863 ? 0.5539 ? 0.0310 ? 0.1194 ? -0.0399 ? -0.2873 ? -0.2061 ? 0.1374 ? 0.1196 ? -0.1244 ? -0.0002 ? 15 'X-RAY DIFFRACTION' ? refined 27.1124 19.4349 -54.5259 0.4075 ? 0.0846 ? 0.0271 ? 0.4899 ? 0.0430 ? 0.4063 ? 1.0347 ? 0.2589 ? -0.2595 ? 0.3253 ? 0.3798 ? 0.6021 ? -0.2614 ? -0.0418 ? 0.0001 ? 0.2041 ? 0.4525 ? 0.3520 ? -0.1031 ? -0.7924 ? -0.0012 ? 16 'X-RAY DIFFRACTION' ? refined 33.9123 27.6717 -49.4048 0.3102 ? -0.0089 ? -0.0425 ? 0.3404 ? -0.0206 ? 0.2873 ? 1.1771 ? 0.9727 ? -0.0866 ? 1.1202 ? 0.7257 ? 1.2060 ? -0.0018 ? 0.3320 ? 0.0480 ? 0.1800 ? -0.2351 ? -0.1756 ? -0.0272 ? 0.1738 ? 0.0001 ? 17 'X-RAY DIFFRACTION' ? refined 40.7846 33.2367 -53.8855 0.3298 ? 0.0104 ? 0.0204 ? 0.3337 ? -0.0089 ? 0.3289 ? 0.8662 ? 0.4009 ? 0.2334 ? 0.2199 ? 0.0834 ? 0.5101 ? 0.1411 ? 0.0522 ? 0.0967 ? -0.1452 ? 0.0121 ? 0.3674 ? 0.0702 ? -0.1223 ? 0.0000 ? 18 'X-RAY DIFFRACTION' ? refined 42.4390 29.7461 -41.8167 0.3350 ? -0.0029 ? -0.0165 ? 0.3852 ? -0.0302 ? 0.3995 ? 0.2073 ? -0.1051 ? 0.2406 ? 0.0726 ? -0.0529 ? 0.1378 ? -0.0228 ? -0.6471 ? 0.2032 ? -0.0191 ? 0.1629 ? -0.0111 ? -0.0341 ? -0.3201 ? -0.0001 ? 19 'X-RAY DIFFRACTION' ? refined 53.2800 26.5683 -43.7537 0.2554 ? -0.0167 ? 0.0275 ? 0.3388 ? 0.0385 ? 0.3463 ? 0.5502 ? 0.3584 ? 0.2488 ? 0.1203 ? 0.1843 ? 0.8805 ? -0.0587 ? 0.1486 ? 0.4029 ? 0.3918 ? 0.0713 ? -0.7352 ? -0.0704 ? 0.0955 ? -0.0006 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? A 3 ? ? A 32 ? ;chain 'A' and (resid 3 through 32 ) ; 2 'X-RAY DIFFRACTION' 2 ? ? A 33 ? ? A 43 ? ;chain 'A' and (resid 33 through 43 ) ; 3 'X-RAY DIFFRACTION' 3 ? ? A 44 ? ? A 100 ? ;chain 'A' and (resid 44 through 100 ) ; 4 'X-RAY DIFFRACTION' 4 ? ? A 101 ? ? A 138 ? ;chain 'A' and (resid 101 through 138 ) ; 5 'X-RAY DIFFRACTION' 5 ? ? B 4 ? ? B 32 ? ;chain 'B' and (resid 4 through 32 ) ; 6 'X-RAY DIFFRACTION' 6 ? ? B 33 ? ? B 73 ? ;chain 'B' and (resid 33 through 73 ) ; 7 'X-RAY DIFFRACTION' 7 ? ? B 74 ? ? B 133 ? ;chain 'B' and (resid 74 through 133 ) ; 8 'X-RAY DIFFRACTION' 8 ? ? C 3 ? ? C 43 ? ;chain 'C' and (resid 3 through 43 ) ; 9 'X-RAY DIFFRACTION' 9 ? ? C 44 ? ? C 135 ? ;chain 'C' and (resid 44 through 135 ) ; 10 'X-RAY DIFFRACTION' 10 ? ? D 4 ? ? D 32 ? ;chain 'D' and (resid 4 through 32 ) ; 11 'X-RAY DIFFRACTION' 11 ? ? D 33 ? ? D 131 ? ;chain 'D' and (resid 33 through 131 ) ; 12 'X-RAY DIFFRACTION' 12 ? ? E 4 ? ? E 32 ? ;chain 'E' and (resid 4 through 32 ) ; 13 'X-RAY DIFFRACTION' 13 ? ? E 33 ? ? E 43 ? ;chain 'E' and (resid 33 through 43 ) ; 14 'X-RAY DIFFRACTION' 14 ? ? E 44 ? ? E 100 ? ;chain 'E' and (resid 44 through 100 ) ; 15 'X-RAY DIFFRACTION' 15 ? ? E 101 ? ? E 133 ? ;chain 'E' and (resid 101 through 133 ) ; 16 'X-RAY DIFFRACTION' 16 ? ? F 4 ? ? F 32 ? ;chain 'F' and (resid 4 through 32 ) ; 17 'X-RAY DIFFRACTION' 17 ? ? F 33 ? ? F 73 ? ;chain 'F' and (resid 33 through 73 ) ; 18 'X-RAY DIFFRACTION' 18 ? ? F 74 ? ? F 100 ? ;chain 'F' and (resid 74 through 100 ) ; 19 'X-RAY DIFFRACTION' 19 ? ? F 101 ? ? F 132 ? ;chain 'F' and (resid 101 through 132 ) ; # _pdbx_entry_details.entry_id 6SSS _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_distant_solvent_atoms.id _pdbx_distant_solvent_atoms.PDB_model_num _pdbx_distant_solvent_atoms.auth_atom_id _pdbx_distant_solvent_atoms.label_alt_id _pdbx_distant_solvent_atoms.auth_asym_id _pdbx_distant_solvent_atoms.auth_comp_id _pdbx_distant_solvent_atoms.auth_seq_id _pdbx_distant_solvent_atoms.PDB_ins_code _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance _pdbx_distant_solvent_atoms.neighbor_ligand_distance 1 1 O ? B HOH 306 ? 15.42 . 2 1 O ? C HOH 312 ? 6.22 . 3 1 O ? C HOH 313 ? 6.41 . 4 1 O ? E HOH 313 ? 6.94 . 5 1 O ? F HOH 308 ? 7.59 . 6 1 O ? F HOH 309 ? 9.69 . 7 1 O ? F HOH 310 ? 14.70 . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -5 ? A MET 1 2 1 Y 1 A HIS -4 ? A HIS 2 3 1 Y 1 A HIS -3 ? A HIS 3 4 1 Y 1 A HIS -2 ? A HIS 4 5 1 Y 1 A HIS -1 ? A HIS 5 6 1 Y 1 A HIS 0 ? A HIS 6 7 1 Y 1 A HIS 1 ? A HIS 7 8 1 Y 1 A ALA 2 ? A ALA 8 9 1 Y 1 A ILE 139 ? A ILE 145 10 1 Y 1 A ALA 140 ? A ALA 146 11 1 Y 1 A LYS 141 ? A LYS 147 12 1 Y 1 A LYS 142 ? A LYS 148 13 1 Y 1 A LEU 143 ? A LEU 149 14 1 Y 1 A ARG 144 ? A ARG 150 15 1 Y 1 A ARG 145 ? A ARG 151 16 1 Y 1 A GLN 146 ? A GLN 152 17 1 Y 1 A PHE 147 ? A PHE 153 18 1 Y 1 B MET -5 ? B MET 1 19 1 Y 1 B HIS -4 ? B HIS 2 20 1 Y 1 B HIS -3 ? B HIS 3 21 1 Y 1 B HIS -2 ? B HIS 4 22 1 Y 1 B HIS -1 ? B HIS 5 23 1 Y 1 B HIS 0 ? B HIS 6 24 1 Y 1 B HIS 1 ? B HIS 7 25 1 Y 1 B ALA 2 ? B ALA 8 26 1 Y 1 B GLY 3 ? B GLY 9 27 1 Y 1 B TYR 134 ? B TYR 140 28 1 Y 1 B LEU 135 ? B LEU 141 29 1 Y 1 B ASP 136 ? B ASP 142 30 1 Y 1 B LEU 137 ? B LEU 143 31 1 Y 1 B ASN 138 ? B ASN 144 32 1 Y 1 B ILE 139 ? B ILE 145 33 1 Y 1 B ALA 140 ? B ALA 146 34 1 Y 1 B LYS 141 ? B LYS 147 35 1 Y 1 B LYS 142 ? B LYS 148 36 1 Y 1 B LEU 143 ? B LEU 149 37 1 Y 1 B ARG 144 ? B ARG 150 38 1 Y 1 B ARG 145 ? B ARG 151 39 1 Y 1 B GLN 146 ? B GLN 152 40 1 Y 1 B PHE 147 ? B PHE 153 41 1 Y 1 C MET -5 ? C MET 1 42 1 Y 1 C HIS -4 ? C HIS 2 43 1 Y 1 C HIS -3 ? C HIS 3 44 1 Y 1 C HIS -2 ? C HIS 4 45 1 Y 1 C HIS -1 ? C HIS 5 46 1 Y 1 C HIS 0 ? C HIS 6 47 1 Y 1 C HIS 1 ? C HIS 7 48 1 Y 1 C ALA 2 ? C ALA 8 49 1 Y 1 C ASP 136 ? C ASP 142 50 1 Y 1 C LEU 137 ? C LEU 143 51 1 Y 1 C ASN 138 ? C ASN 144 52 1 Y 1 C ILE 139 ? C ILE 145 53 1 Y 1 C ALA 140 ? C ALA 146 54 1 Y 1 C LYS 141 ? C LYS 147 55 1 Y 1 C LYS 142 ? C LYS 148 56 1 Y 1 C LEU 143 ? C LEU 149 57 1 Y 1 C ARG 144 ? C ARG 150 58 1 Y 1 C ARG 145 ? C ARG 151 59 1 Y 1 C GLN 146 ? C GLN 152 60 1 Y 1 C PHE 147 ? C PHE 153 61 1 Y 1 D MET -5 ? D MET 1 62 1 Y 1 D HIS -4 ? D HIS 2 63 1 Y 1 D HIS -3 ? D HIS 3 64 1 Y 1 D HIS -2 ? D HIS 4 65 1 Y 1 D HIS -1 ? D HIS 5 66 1 Y 1 D HIS 0 ? D HIS 6 67 1 Y 1 D HIS 1 ? D HIS 7 68 1 Y 1 D ALA 2 ? D ALA 8 69 1 Y 1 D GLY 3 ? D GLY 9 70 1 Y 1 D ASP 132 ? D ASP 138 71 1 Y 1 D GLU 133 ? D GLU 139 72 1 Y 1 D TYR 134 ? D TYR 140 73 1 Y 1 D LEU 135 ? D LEU 141 74 1 Y 1 D ASP 136 ? D ASP 142 75 1 Y 1 D LEU 137 ? D LEU 143 76 1 Y 1 D ASN 138 ? D ASN 144 77 1 Y 1 D ILE 139 ? D ILE 145 78 1 Y 1 D ALA 140 ? D ALA 146 79 1 Y 1 D LYS 141 ? D LYS 147 80 1 Y 1 D LYS 142 ? D LYS 148 81 1 Y 1 D LEU 143 ? D LEU 149 82 1 Y 1 D ARG 144 ? D ARG 150 83 1 Y 1 D ARG 145 ? D ARG 151 84 1 Y 1 D GLN 146 ? D GLN 152 85 1 Y 1 D PHE 147 ? D PHE 153 86 1 Y 1 E MET -5 ? E MET 1 87 1 Y 1 E HIS -4 ? E HIS 2 88 1 Y 1 E HIS -3 ? E HIS 3 89 1 Y 1 E HIS -2 ? E HIS 4 90 1 Y 1 E HIS -1 ? E HIS 5 91 1 Y 1 E HIS 0 ? E HIS 6 92 1 Y 1 E HIS 1 ? E HIS 7 93 1 Y 1 E ALA 2 ? E ALA 8 94 1 Y 1 E GLY 3 ? E GLY 9 95 1 Y 1 E TYR 134 ? E TYR 140 96 1 Y 1 E LEU 135 ? E LEU 141 97 1 Y 1 E ASP 136 ? E ASP 142 98 1 Y 1 E LEU 137 ? E LEU 143 99 1 Y 1 E ASN 138 ? E ASN 144 100 1 Y 1 E ILE 139 ? E ILE 145 101 1 Y 1 E ALA 140 ? E ALA 146 102 1 Y 1 E LYS 141 ? E LYS 147 103 1 Y 1 E LYS 142 ? E LYS 148 104 1 Y 1 E LEU 143 ? E LEU 149 105 1 Y 1 E ARG 144 ? E ARG 150 106 1 Y 1 E ARG 145 ? E ARG 151 107 1 Y 1 E GLN 146 ? E GLN 152 108 1 Y 1 E PHE 147 ? E PHE 153 109 1 Y 1 F MET -5 ? F MET 1 110 1 Y 1 F HIS -4 ? F HIS 2 111 1 Y 1 F HIS -3 ? F HIS 3 112 1 Y 1 F HIS -2 ? F HIS 4 113 1 Y 1 F HIS -1 ? F HIS 5 114 1 Y 1 F HIS 0 ? F HIS 6 115 1 Y 1 F HIS 1 ? F HIS 7 116 1 Y 1 F ALA 2 ? F ALA 8 117 1 Y 1 F GLY 3 ? F GLY 9 118 1 Y 1 F GLU 133 ? F GLU 139 119 1 Y 1 F TYR 134 ? F TYR 140 120 1 Y 1 F LEU 135 ? F LEU 141 121 1 Y 1 F ASP 136 ? F ASP 142 122 1 Y 1 F LEU 137 ? F LEU 143 123 1 Y 1 F ASN 138 ? F ASN 144 124 1 Y 1 F ILE 139 ? F ILE 145 125 1 Y 1 F ALA 140 ? F ALA 146 126 1 Y 1 F LYS 141 ? F LYS 147 127 1 Y 1 F LYS 142 ? F LYS 148 128 1 Y 1 F LEU 143 ? F LEU 149 129 1 Y 1 F ARG 144 ? F ARG 150 130 1 Y 1 F ARG 145 ? F ARG 151 131 1 Y 1 F GLN 146 ? F GLN 152 132 1 Y 1 F PHE 147 ? F PHE 153 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 GOL C1 C N N 137 GOL O1 O N N 138 GOL C2 C N N 139 GOL O2 O N N 140 GOL C3 C N N 141 GOL O3 O N N 142 GOL H11 H N N 143 GOL H12 H N N 144 GOL HO1 H N N 145 GOL H2 H N N 146 GOL HO2 H N N 147 GOL H31 H N N 148 GOL H32 H N N 149 GOL HO3 H N N 150 HIS N N N N 151 HIS CA C N S 152 HIS C C N N 153 HIS O O N N 154 HIS CB C N N 155 HIS CG C Y N 156 HIS ND1 N Y N 157 HIS CD2 C Y N 158 HIS CE1 C Y N 159 HIS NE2 N Y N 160 HIS OXT O N N 161 HIS H H N N 162 HIS H2 H N N 163 HIS HA H N N 164 HIS HB2 H N N 165 HIS HB3 H N N 166 HIS HD1 H N N 167 HIS HD2 H N N 168 HIS HE1 H N N 169 HIS HE2 H N N 170 HIS HXT H N N 171 HOH O O N N 172 HOH H1 H N N 173 HOH H2 H N N 174 ILE N N N N 175 ILE CA C N S 176 ILE C C N N 177 ILE O O N N 178 ILE CB C N S 179 ILE CG1 C N N 180 ILE CG2 C N N 181 ILE CD1 C N N 182 ILE OXT O N N 183 ILE H H N N 184 ILE H2 H N N 185 ILE HA H N N 186 ILE HB H N N 187 ILE HG12 H N N 188 ILE HG13 H N N 189 ILE HG21 H N N 190 ILE HG22 H N N 191 ILE HG23 H N N 192 ILE HD11 H N N 193 ILE HD12 H N N 194 ILE HD13 H N N 195 ILE HXT H N N 196 K K K N N 197 LEU N N N N 198 LEU CA C N S 199 LEU C C N N 200 LEU O O N N 201 LEU CB C N N 202 LEU CG C N N 203 LEU CD1 C N N 204 LEU CD2 C N N 205 LEU OXT O N N 206 LEU H H N N 207 LEU H2 H N N 208 LEU HA H N N 209 LEU HB2 H N N 210 LEU HB3 H N N 211 LEU HG H N N 212 LEU HD11 H N N 213 LEU HD12 H N N 214 LEU HD13 H N N 215 LEU HD21 H N N 216 LEU HD22 H N N 217 LEU HD23 H N N 218 LEU HXT H N N 219 LYS N N N N 220 LYS CA C N S 221 LYS C C N N 222 LYS O O N N 223 LYS CB C N N 224 LYS CG C N N 225 LYS CD C N N 226 LYS CE C N N 227 LYS NZ N N N 228 LYS OXT O N N 229 LYS H H N N 230 LYS H2 H N N 231 LYS HA H N N 232 LYS HB2 H N N 233 LYS HB3 H N N 234 LYS HG2 H N N 235 LYS HG3 H N N 236 LYS HD2 H N N 237 LYS HD3 H N N 238 LYS HE2 H N N 239 LYS HE3 H N N 240 LYS HZ1 H N N 241 LYS HZ2 H N N 242 LYS HZ3 H N N 243 LYS HXT H N N 244 M88 C07 C N N 245 M88 C08 C N N 246 M88 C09 C N N 247 M88 C10 C N N 248 M88 C11 C N N 249 M88 C12 C N N 250 M88 C13 C N N 251 M88 C14 C N N 252 M88 C15 C N N 253 M88 C16 C N N 254 M88 O17 O N N 255 M88 O18 O N N 256 M88 C19 C N N 257 M88 C20 C N S 258 M88 O21 O N N 259 M88 C22 C N N 260 M88 O23 O N N 261 M88 H2 H N N 262 M88 H1 H N N 263 M88 H081 H N N 264 M88 H091 H N N 265 M88 H101 H N N 266 M88 H102 H N N 267 M88 H112 H N N 268 M88 H111 H N N 269 M88 H122 H N N 270 M88 H121 H N N 271 M88 H131 H N N 272 M88 H132 H N N 273 M88 H142 H N N 274 M88 H141 H N N 275 M88 H151 H N N 276 M88 H152 H N N 277 M88 H192 H N N 278 M88 H191 H N N 279 M88 H201 H N N 280 M88 H211 H N N 281 M88 H222 H N N 282 M88 H221 H N N 283 M88 H231 H N N 284 M88 C06 C N N 285 M88 C05 C N N 286 M88 C04 C N N 287 M88 C03 C N N 288 M88 C02 C N N 289 M88 C01 C N N 290 M88 H3 H N N 291 M88 H4 H N N 292 M88 H5 H N N 293 M88 H6 H N N 294 M88 H7 H N N 295 M88 H8 H N N 296 M88 H9 H N N 297 M88 H10 H N N 298 M88 H11 H N N 299 M88 H12 H N N 300 M88 H13 H N N 301 M88 H14 H N N 302 M88 H15 H N N 303 MET N N N N 304 MET CA C N S 305 MET C C N N 306 MET O O N N 307 MET CB C N N 308 MET CG C N N 309 MET SD S N N 310 MET CE C N N 311 MET OXT O N N 312 MET H H N N 313 MET H2 H N N 314 MET HA H N N 315 MET HB2 H N N 316 MET HB3 H N N 317 MET HG2 H N N 318 MET HG3 H N N 319 MET HE1 H N N 320 MET HE2 H N N 321 MET HE3 H N N 322 MET HXT H N N 323 NA NA NA N N 324 PHE N N N N 325 PHE CA C N S 326 PHE C C N N 327 PHE O O N N 328 PHE CB C N N 329 PHE CG C Y N 330 PHE CD1 C Y N 331 PHE CD2 C Y N 332 PHE CE1 C Y N 333 PHE CE2 C Y N 334 PHE CZ C Y N 335 PHE OXT O N N 336 PHE H H N N 337 PHE H2 H N N 338 PHE HA H N N 339 PHE HB2 H N N 340 PHE HB3 H N N 341 PHE HD1 H N N 342 PHE HD2 H N N 343 PHE HE1 H N N 344 PHE HE2 H N N 345 PHE HZ H N N 346 PHE HXT H N N 347 PRO N N N N 348 PRO CA C N S 349 PRO C C N N 350 PRO O O N N 351 PRO CB C N N 352 PRO CG C N N 353 PRO CD C N N 354 PRO OXT O N N 355 PRO H H N N 356 PRO HA H N N 357 PRO HB2 H N N 358 PRO HB3 H N N 359 PRO HG2 H N N 360 PRO HG3 H N N 361 PRO HD2 H N N 362 PRO HD3 H N N 363 PRO HXT H N N 364 SCN S S N N 365 SCN C C N N 366 SCN N N N N 367 SER N N N N 368 SER CA C N S 369 SER C C N N 370 SER O O N N 371 SER CB C N N 372 SER OG O N N 373 SER OXT O N N 374 SER H H N N 375 SER H2 H N N 376 SER HA H N N 377 SER HB2 H N N 378 SER HB3 H N N 379 SER HG H N N 380 SER HXT H N N 381 SO4 S S N N 382 SO4 O1 O N N 383 SO4 O2 O N N 384 SO4 O3 O N N 385 SO4 O4 O N N 386 THR N N N N 387 THR CA C N S 388 THR C C N N 389 THR O O N N 390 THR CB C N R 391 THR OG1 O N N 392 THR CG2 C N N 393 THR OXT O N N 394 THR H H N N 395 THR H2 H N N 396 THR HA H N N 397 THR HB H N N 398 THR HG1 H N N 399 THR HG21 H N N 400 THR HG22 H N N 401 THR HG23 H N N 402 THR HXT H N N 403 TRP N N N N 404 TRP CA C N S 405 TRP C C N N 406 TRP O O N N 407 TRP CB C N N 408 TRP CG C Y N 409 TRP CD1 C Y N 410 TRP CD2 C Y N 411 TRP NE1 N Y N 412 TRP CE2 C Y N 413 TRP CE3 C Y N 414 TRP CZ2 C Y N 415 TRP CZ3 C Y N 416 TRP CH2 C Y N 417 TRP OXT O N N 418 TRP H H N N 419 TRP H2 H N N 420 TRP HA H N N 421 TRP HB2 H N N 422 TRP HB3 H N N 423 TRP HD1 H N N 424 TRP HE1 H N N 425 TRP HE3 H N N 426 TRP HZ2 H N N 427 TRP HZ3 H N N 428 TRP HH2 H N N 429 TRP HXT H N N 430 TYR N N N N 431 TYR CA C N S 432 TYR C C N N 433 TYR O O N N 434 TYR CB C N N 435 TYR CG C Y N 436 TYR CD1 C Y N 437 TYR CD2 C Y N 438 TYR CE1 C Y N 439 TYR CE2 C Y N 440 TYR CZ C Y N 441 TYR OH O N N 442 TYR OXT O N N 443 TYR H H N N 444 TYR H2 H N N 445 TYR HA H N N 446 TYR HB2 H N N 447 TYR HB3 H N N 448 TYR HD1 H N N 449 TYR HD2 H N N 450 TYR HE1 H N N 451 TYR HE2 H N N 452 TYR HH H N N 453 TYR HXT H N N 454 VAL N N N N 455 VAL CA C N S 456 VAL C C N N 457 VAL O O N N 458 VAL CB C N N 459 VAL CG1 C N N 460 VAL CG2 C N N 461 VAL OXT O N N 462 VAL H H N N 463 VAL H2 H N N 464 VAL HA H N N 465 VAL HB H N N 466 VAL HG11 H N N 467 VAL HG12 H N N 468 VAL HG13 H N N 469 VAL HG21 H N N 470 VAL HG22 H N N 471 VAL HG23 H N N 472 VAL HXT H N N 473 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 GOL C1 O1 sing N N 129 GOL C1 C2 sing N N 130 GOL C1 H11 sing N N 131 GOL C1 H12 sing N N 132 GOL O1 HO1 sing N N 133 GOL C2 O2 sing N N 134 GOL C2 C3 sing N N 135 GOL C2 H2 sing N N 136 GOL O2 HO2 sing N N 137 GOL C3 O3 sing N N 138 GOL C3 H31 sing N N 139 GOL C3 H32 sing N N 140 GOL O3 HO3 sing N N 141 HIS N CA sing N N 142 HIS N H sing N N 143 HIS N H2 sing N N 144 HIS CA C sing N N 145 HIS CA CB sing N N 146 HIS CA HA sing N N 147 HIS C O doub N N 148 HIS C OXT sing N N 149 HIS CB CG sing N N 150 HIS CB HB2 sing N N 151 HIS CB HB3 sing N N 152 HIS CG ND1 sing Y N 153 HIS CG CD2 doub Y N 154 HIS ND1 CE1 doub Y N 155 HIS ND1 HD1 sing N N 156 HIS CD2 NE2 sing Y N 157 HIS CD2 HD2 sing N N 158 HIS CE1 NE2 sing Y N 159 HIS CE1 HE1 sing N N 160 HIS NE2 HE2 sing N N 161 HIS OXT HXT sing N N 162 HOH O H1 sing N N 163 HOH O H2 sing N N 164 ILE N CA sing N N 165 ILE N H sing N N 166 ILE N H2 sing N N 167 ILE CA C sing N N 168 ILE CA CB sing N N 169 ILE CA HA sing N N 170 ILE C O doub N N 171 ILE C OXT sing N N 172 ILE CB CG1 sing N N 173 ILE CB CG2 sing N N 174 ILE CB HB sing N N 175 ILE CG1 CD1 sing N N 176 ILE CG1 HG12 sing N N 177 ILE CG1 HG13 sing N N 178 ILE CG2 HG21 sing N N 179 ILE CG2 HG22 sing N N 180 ILE CG2 HG23 sing N N 181 ILE CD1 HD11 sing N N 182 ILE CD1 HD12 sing N N 183 ILE CD1 HD13 sing N N 184 ILE OXT HXT sing N N 185 LEU N CA sing N N 186 LEU N H sing N N 187 LEU N H2 sing N N 188 LEU CA C sing N N 189 LEU CA CB sing N N 190 LEU CA HA sing N N 191 LEU C O doub N N 192 LEU C OXT sing N N 193 LEU CB CG sing N N 194 LEU CB HB2 sing N N 195 LEU CB HB3 sing N N 196 LEU CG CD1 sing N N 197 LEU CG CD2 sing N N 198 LEU CG HG sing N N 199 LEU CD1 HD11 sing N N 200 LEU CD1 HD12 sing N N 201 LEU CD1 HD13 sing N N 202 LEU CD2 HD21 sing N N 203 LEU CD2 HD22 sing N N 204 LEU CD2 HD23 sing N N 205 LEU OXT HXT sing N N 206 LYS N CA sing N N 207 LYS N H sing N N 208 LYS N H2 sing N N 209 LYS CA C sing N N 210 LYS CA CB sing N N 211 LYS CA HA sing N N 212 LYS C O doub N N 213 LYS C OXT sing N N 214 LYS CB CG sing N N 215 LYS CB HB2 sing N N 216 LYS CB HB3 sing N N 217 LYS CG CD sing N N 218 LYS CG HG2 sing N N 219 LYS CG HG3 sing N N 220 LYS CD CE sing N N 221 LYS CD HD2 sing N N 222 LYS CD HD3 sing N N 223 LYS CE NZ sing N N 224 LYS CE HE2 sing N N 225 LYS CE HE3 sing N N 226 LYS NZ HZ1 sing N N 227 LYS NZ HZ2 sing N N 228 LYS NZ HZ3 sing N N 229 LYS OXT HXT sing N N 230 M88 C08 C07 sing N N 231 M88 C08 C09 doub N Z 232 M88 C09 C10 sing N N 233 M88 C10 C11 sing N N 234 M88 C11 C12 sing N N 235 M88 C12 C13 sing N N 236 M88 C13 C14 sing N N 237 M88 C14 C15 sing N N 238 M88 C15 C16 sing N N 239 M88 O17 C16 doub N N 240 M88 C16 O18 sing N N 241 M88 O18 C19 sing N N 242 M88 C19 C20 sing N N 243 M88 C20 O21 sing N N 244 M88 C20 C22 sing N N 245 M88 O23 C22 sing N N 246 M88 C07 H2 sing N N 247 M88 C07 H1 sing N N 248 M88 C08 H081 sing N N 249 M88 C09 H091 sing N N 250 M88 C10 H101 sing N N 251 M88 C10 H102 sing N N 252 M88 C11 H112 sing N N 253 M88 C11 H111 sing N N 254 M88 C12 H122 sing N N 255 M88 C12 H121 sing N N 256 M88 C13 H131 sing N N 257 M88 C13 H132 sing N N 258 M88 C14 H142 sing N N 259 M88 C14 H141 sing N N 260 M88 C15 H151 sing N N 261 M88 C15 H152 sing N N 262 M88 C19 H192 sing N N 263 M88 C19 H191 sing N N 264 M88 C20 H201 sing N N 265 M88 O21 H211 sing N N 266 M88 C22 H222 sing N N 267 M88 C22 H221 sing N N 268 M88 O23 H231 sing N N 269 M88 C07 C06 sing N N 270 M88 C06 C05 sing N N 271 M88 C05 C04 sing N N 272 M88 C04 C03 sing N N 273 M88 C03 C02 sing N N 274 M88 C02 C01 sing N N 275 M88 C06 H3 sing N N 276 M88 C06 H4 sing N N 277 M88 C05 H5 sing N N 278 M88 C05 H6 sing N N 279 M88 C04 H7 sing N N 280 M88 C04 H8 sing N N 281 M88 C03 H9 sing N N 282 M88 C03 H10 sing N N 283 M88 C02 H11 sing N N 284 M88 C02 H12 sing N N 285 M88 C01 H13 sing N N 286 M88 C01 H14 sing N N 287 M88 C01 H15 sing N N 288 MET N CA sing N N 289 MET N H sing N N 290 MET N H2 sing N N 291 MET CA C sing N N 292 MET CA CB sing N N 293 MET CA HA sing N N 294 MET C O doub N N 295 MET C OXT sing N N 296 MET CB CG sing N N 297 MET CB HB2 sing N N 298 MET CB HB3 sing N N 299 MET CG SD sing N N 300 MET CG HG2 sing N N 301 MET CG HG3 sing N N 302 MET SD CE sing N N 303 MET CE HE1 sing N N 304 MET CE HE2 sing N N 305 MET CE HE3 sing N N 306 MET OXT HXT sing N N 307 PHE N CA sing N N 308 PHE N H sing N N 309 PHE N H2 sing N N 310 PHE CA C sing N N 311 PHE CA CB sing N N 312 PHE CA HA sing N N 313 PHE C O doub N N 314 PHE C OXT sing N N 315 PHE CB CG sing N N 316 PHE CB HB2 sing N N 317 PHE CB HB3 sing N N 318 PHE CG CD1 doub Y N 319 PHE CG CD2 sing Y N 320 PHE CD1 CE1 sing Y N 321 PHE CD1 HD1 sing N N 322 PHE CD2 CE2 doub Y N 323 PHE CD2 HD2 sing N N 324 PHE CE1 CZ doub Y N 325 PHE CE1 HE1 sing N N 326 PHE CE2 CZ sing Y N 327 PHE CE2 HE2 sing N N 328 PHE CZ HZ sing N N 329 PHE OXT HXT sing N N 330 PRO N CA sing N N 331 PRO N CD sing N N 332 PRO N H sing N N 333 PRO CA C sing N N 334 PRO CA CB sing N N 335 PRO CA HA sing N N 336 PRO C O doub N N 337 PRO C OXT sing N N 338 PRO CB CG sing N N 339 PRO CB HB2 sing N N 340 PRO CB HB3 sing N N 341 PRO CG CD sing N N 342 PRO CG HG2 sing N N 343 PRO CG HG3 sing N N 344 PRO CD HD2 sing N N 345 PRO CD HD3 sing N N 346 PRO OXT HXT sing N N 347 SCN S C sing N N 348 SCN C N trip N N 349 SER N CA sing N N 350 SER N H sing N N 351 SER N H2 sing N N 352 SER CA C sing N N 353 SER CA CB sing N N 354 SER CA HA sing N N 355 SER C O doub N N 356 SER C OXT sing N N 357 SER CB OG sing N N 358 SER CB HB2 sing N N 359 SER CB HB3 sing N N 360 SER OG HG sing N N 361 SER OXT HXT sing N N 362 SO4 S O1 doub N N 363 SO4 S O2 doub N N 364 SO4 S O3 sing N N 365 SO4 S O4 sing N N 366 THR N CA sing N N 367 THR N H sing N N 368 THR N H2 sing N N 369 THR CA C sing N N 370 THR CA CB sing N N 371 THR CA HA sing N N 372 THR C O doub N N 373 THR C OXT sing N N 374 THR CB OG1 sing N N 375 THR CB CG2 sing N N 376 THR CB HB sing N N 377 THR OG1 HG1 sing N N 378 THR CG2 HG21 sing N N 379 THR CG2 HG22 sing N N 380 THR CG2 HG23 sing N N 381 THR OXT HXT sing N N 382 TRP N CA sing N N 383 TRP N H sing N N 384 TRP N H2 sing N N 385 TRP CA C sing N N 386 TRP CA CB sing N N 387 TRP CA HA sing N N 388 TRP C O doub N N 389 TRP C OXT sing N N 390 TRP CB CG sing N N 391 TRP CB HB2 sing N N 392 TRP CB HB3 sing N N 393 TRP CG CD1 doub Y N 394 TRP CG CD2 sing Y N 395 TRP CD1 NE1 sing Y N 396 TRP CD1 HD1 sing N N 397 TRP CD2 CE2 doub Y N 398 TRP CD2 CE3 sing Y N 399 TRP NE1 CE2 sing Y N 400 TRP NE1 HE1 sing N N 401 TRP CE2 CZ2 sing Y N 402 TRP CE3 CZ3 doub Y N 403 TRP CE3 HE3 sing N N 404 TRP CZ2 CH2 doub Y N 405 TRP CZ2 HZ2 sing N N 406 TRP CZ3 CH2 sing Y N 407 TRP CZ3 HZ3 sing N N 408 TRP CH2 HH2 sing N N 409 TRP OXT HXT sing N N 410 TYR N CA sing N N 411 TYR N H sing N N 412 TYR N H2 sing N N 413 TYR CA C sing N N 414 TYR CA CB sing N N 415 TYR CA HA sing N N 416 TYR C O doub N N 417 TYR C OXT sing N N 418 TYR CB CG sing N N 419 TYR CB HB2 sing N N 420 TYR CB HB3 sing N N 421 TYR CG CD1 doub Y N 422 TYR CG CD2 sing Y N 423 TYR CD1 CE1 sing Y N 424 TYR CD1 HD1 sing N N 425 TYR CD2 CE2 doub Y N 426 TYR CD2 HD2 sing N N 427 TYR CE1 CZ doub Y N 428 TYR CE1 HE1 sing N N 429 TYR CE2 CZ sing Y N 430 TYR CE2 HE2 sing N N 431 TYR CZ OH sing N N 432 TYR OH HH sing N N 433 TYR OXT HXT sing N N 434 VAL N CA sing N N 435 VAL N H sing N N 436 VAL N H2 sing N N 437 VAL CA C sing N N 438 VAL CA CB sing N N 439 VAL CA HA sing N N 440 VAL C O doub N N 441 VAL C OXT sing N N 442 VAL CB CG1 sing N N 443 VAL CB CG2 sing N N 444 VAL CB HB sing N N 445 VAL CG1 HG11 sing N N 446 VAL CG1 HG12 sing N N 447 VAL CG1 HG13 sing N N 448 VAL CG2 HG21 sing N N 449 VAL CG2 HG22 sing N N 450 VAL CG2 HG23 sing N N 451 VAL OXT HXT sing N N 452 # _pdbx_audit_support.funding_organization 'Swedish Research Council' _pdbx_audit_support.country Sweden _pdbx_audit_support.grant_number 10350 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 6SSR _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 6SSS _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.018220 _atom_sites.fract_transf_matrix[1][2] -0.001000 _atom_sites.fract_transf_matrix[1][3] -0.000725 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013879 _atom_sites.fract_transf_matrix[2][3] -0.005593 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.014856 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H K N NA O S # loop_