data_6SVH # _entry.id 6SVH # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6SVH pdb_00006svh 10.2210/pdb6svh/pdb WWPDB D_1292104376 ? ? BMRB 34434 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB 'apo WW domain' 6SVC unspecified PDB 'WW domain/pCdc25C' 6SVE unspecified BMRB ;Protein allostery of the WW domain at atomic resolution ; 34434 unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 6SVH _pdbx_database_status.recvd_initial_deposition_date 2019-09-18 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Strotz, D.' 1 ? 'Orts, J.' 2 ? 'Friedmann, M.' 3 ? 'Guntert, P.' 4 ? 'Vogeli, B.' 5 ? 'Riek, R.' 6 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country GE _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Angew.Chem.Int.Ed.Engl. _citation.journal_id_ASTM ACIEAY _citation.journal_id_CSD 0179 _citation.journal_id_ISSN 1521-3773 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 59 _citation.language ? _citation.page_first 22132 _citation.page_last 22139 _citation.title 'Protein Allostery at Atomic Resolution.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1002/anie.202008734 _citation.pdbx_database_id_PubMed 32797659 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Strotz, D.' 1 ? primary 'Orts, J.' 2 ? primary 'Kadavath, H.' 3 ? primary 'Friedmann, M.' 4 ? primary 'Ghosh, D.' 5 ? primary 'Olsson, S.' 6 ? primary 'Chi, C.N.' 7 ? primary 'Pokharna, A.' 8 ? primary 'Guntert, P.' 9 ? primary 'Vogeli, B.' 10 ? primary 'Riek, R.' 11 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 6SVH _cell.details ? _cell.formula_units_Z ? _cell.length_a 1.000 _cell.length_a_esd ? _cell.length_b 1.000 _cell.length_b_esd ? _cell.length_c 1.000 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB ? _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6SVH _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1' _entity.formula_weight 4105.579 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 5.2.1.8 _entity.pdbx_mutation 'S18N, W34F' _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Peptidyl-prolyl cis-trans isomerase Pin1,PPIase Pin1,Rotamase Pin1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code SKLPPGWEKRMSRNSGRVYYFNHITNASQFERPSG _entity_poly.pdbx_seq_one_letter_code_can SKLPPGWEKRMSRNSGRVYYFNHITNASQFERPSG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 LYS n 1 3 LEU n 1 4 PRO n 1 5 PRO n 1 6 GLY n 1 7 TRP n 1 8 GLU n 1 9 LYS n 1 10 ARG n 1 11 MET n 1 12 SER n 1 13 ARG n 1 14 ASN n 1 15 SER n 1 16 GLY n 1 17 ARG n 1 18 VAL n 1 19 TYR n 1 20 TYR n 1 21 PHE n 1 22 ASN n 1 23 HIS n 1 24 ILE n 1 25 THR n 1 26 ASN n 1 27 ALA n 1 28 SER n 1 29 GLN n 1 30 PHE n 1 31 GLU n 1 32 ARG n 1 33 PRO n 1 34 SER n 1 35 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 35 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene PIN1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PIN1_HUMAN _struct_ref.pdbx_db_accession Q13526 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code KLPPGWEKRMSRSSGRVYYFNHITNASQWERPSG _struct_ref.pdbx_align_begin 6 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6SVH _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 35 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q13526 _struct_ref_seq.db_align_beg 6 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 39 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 6 _struct_ref_seq.pdbx_auth_seq_align_end 39 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6SVH SER A 1 ? UNP Q13526 ? ? 'expression tag' 5 1 1 6SVH ASN A 14 ? UNP Q13526 SER 18 'engineered mutation' 18 2 1 6SVH PHE A 30 ? UNP Q13526 TRP 34 'engineered mutation' 34 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_nmr_exptl.experiment_id 1 _pdbx_nmr_exptl.conditions_id 1 _pdbx_nmr_exptl.solution_id 1 _pdbx_nmr_exptl.type NOESY _pdbx_nmr_exptl.spectrometer_id 1 _pdbx_nmr_exptl.sample_state isotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 277.15 _pdbx_nmr_exptl_sample_conditions.pressure_units bar _pdbx_nmr_exptl_sample_conditions.pressure AMBIENT _pdbx_nmr_exptl_sample_conditions.pH 6.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.15 _pdbx_nmr_exptl_sample_conditions.details '10 mM K2PO4, 100 mM NaCl, 0.02 % NaN3' _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units M _pdbx_nmr_exptl_sample_conditions.label 'FFpSPR WW domain' _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.2 mM [U-100% 13C; U-100% 15N] Pin1 WW domain, 12 mM FFpSPR, 97% H2O/3% D2O' _pdbx_nmr_sample_details.solvent_system '97% H2O/3% D2O' _pdbx_nmr_sample_details.label '15N/13C sample' _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details 'Pin1 WW domain FFpSPR bound' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AVANCE III' _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 700 _pdbx_nmr_spectrometer.details ? # _pdbx_nmr_refine.entry_id 6SVH _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 6SVH _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 6SVH _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 'structure calculation' CYANA 3.98.12 Guntert,Buchner 2 processing NMRPipe ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 3 'peak picking' NMRDraw ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 4 'chemical shift assignment' 'CcpNmr Analysis' ? CCPN # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6SVH _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 6SVH _struct.title 'Protein allostery of the WW domain at atomic resolution: FFpSPR bound structure' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6SVH _struct_keywords.text 'STRUCTURE FROM CYANA 3.98.12, PEPTIDE BINDING PROTEIN' _struct_keywords.pdbx_keywords 'PEPTIDE BINDING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id AA1 _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLU A 8 ? MET A 11 ? GLU A 12 MET A 15 AA1 2 VAL A 18 ? PHE A 21 ? VAL A 22 PHE A 25 # _pdbx_struct_sheet_hbond.sheet_id AA1 _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id ARG _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 10 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id ARG _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 14 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id TYR _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 19 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id TYR _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 23 # _database_PDB_matrix.entry_id 6SVH _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 6SVH _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 5 5 SER SER A . n A 1 2 LYS 2 6 6 LYS LYS A . n A 1 3 LEU 3 7 7 LEU LEU A . n A 1 4 PRO 4 8 8 PRO PRO A . n A 1 5 PRO 5 9 9 PRO PRO A . n A 1 6 GLY 6 10 10 GLY GLY A . n A 1 7 TRP 7 11 11 TRP TRP A . n A 1 8 GLU 8 12 12 GLU GLU A . n A 1 9 LYS 9 13 13 LYS LYS A . n A 1 10 ARG 10 14 14 ARG ARG A . n A 1 11 MET 11 15 15 MET MET A . n A 1 12 SER 12 16 16 SER SER A . n A 1 13 ARG 13 17 17 ARG ARG A . n A 1 14 ASN 14 18 18 ASN ASN A . n A 1 15 SER 15 19 19 SER SER A . n A 1 16 GLY 16 20 20 GLY GLY A . n A 1 17 ARG 17 21 21 ARG ARG A . n A 1 18 VAL 18 22 22 VAL VAL A . n A 1 19 TYR 19 23 23 TYR TYR A . n A 1 20 TYR 20 24 24 TYR TYR A . n A 1 21 PHE 21 25 25 PHE PHE A . n A 1 22 ASN 22 26 26 ASN ASN A . n A 1 23 HIS 23 27 27 HIS HIS A . n A 1 24 ILE 24 28 28 ILE ILE A . n A 1 25 THR 25 29 29 THR THR A . n A 1 26 ASN 26 30 30 ASN ASN A . n A 1 27 ALA 27 31 31 ALA ALA A . n A 1 28 SER 28 32 32 SER SER A . n A 1 29 GLN 29 33 33 GLN GLN A . n A 1 30 PHE 30 34 34 PHE PHE A . n A 1 31 GLU 31 35 35 GLU GLU A . n A 1 32 ARG 32 36 36 ARG ARG A . n A 1 33 PRO 33 37 37 PRO PRO A . n A 1 34 SER 34 38 38 SER SER A . n A 1 35 GLY 35 39 39 GLY GLY A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 3340 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-09-30 2 'Structure model' 1 1 2020-10-21 3 'Structure model' 1 2 2020-12-16 4 'Structure model' 1 3 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Database references' 4 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 3 'Structure model' citation_author 5 4 'Structure model' database_2 6 4 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.pdbx_database_id_DOI' 7 2 'Structure model' '_citation.pdbx_database_id_PubMed' 8 2 'Structure model' '_citation.title' 9 2 'Structure model' '_citation.year' 10 3 'Structure model' '_citation.journal_volume' 11 3 'Structure model' '_citation.page_first' 12 3 'Structure model' '_citation.page_last' 13 3 'Structure model' '_citation_author.identifier_ORCID' 14 4 'Structure model' '_database_2.pdbx_DOI' 15 4 'Structure model' '_database_2.pdbx_database_accession' 16 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 'Pin1 WW domain' 1.2 ? mM '[U-100% 13C; U-100% 15N]' 1 FFpSPR 12 ? mM 'natural abundance' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 6 ? B -106.24 47.96 2 1 PRO A 9 ? A -69.74 88.09 3 1 SER A 16 ? B -57.94 170.53 4 1 ASN A 18 ? A -117.12 50.89 5 1 SER A 19 ? A -171.51 -70.65 6 1 SER A 19 ? B -102.98 -64.09 7 1 ARG A 21 ? A -55.73 179.42 8 1 HIS A 27 ? A -93.12 35.67 9 1 ASN A 30 ? B 63.66 60.46 10 1 ARG A 36 ? B -51.87 109.05 11 2 LYS A 6 ? B -103.91 48.64 12 2 PRO A 9 ? A -69.76 86.29 13 2 SER A 19 ? A -172.69 -71.12 14 2 SER A 19 ? B -104.18 -64.20 15 2 ARG A 21 ? A -54.14 175.66 16 2 HIS A 27 ? A -91.64 36.19 17 2 ASN A 30 ? B 63.87 62.44 18 3 PRO A 9 ? A -69.83 86.50 19 3 SER A 16 ? B -57.54 170.08 20 3 ASN A 18 ? A -115.93 52.04 21 3 SER A 19 ? A -175.83 -70.22 22 3 SER A 19 ? B -104.01 -63.36 23 3 ARG A 21 ? A -55.64 178.84 24 3 HIS A 27 ? A -91.22 35.62 25 3 ALA A 31 ? A -75.70 -75.50 26 3 SER A 32 ? A 65.90 112.09 27 3 ARG A 36 ? B -51.51 109.03 28 4 ARG A 17 ? A 75.01 -60.38 29 4 ARG A 17 ? B -94.95 33.68 30 4 ASN A 18 ? A -88.01 49.88 31 4 ASN A 18 ? B -133.68 -60.79 32 4 SER A 19 ? A 179.08 -68.73 33 4 ARG A 21 ? A -57.04 -176.82 34 4 HIS A 27 ? A -91.18 34.50 35 4 ASN A 30 ? A 44.53 83.55 36 5 SER A 16 ? B -57.79 170.72 37 5 SER A 19 ? A -171.31 -71.99 38 5 SER A 19 ? B -103.63 -62.88 39 5 ARG A 21 ? A -55.62 179.36 40 5 SER A 32 ? A -159.79 80.51 41 6 PRO A 9 ? A -69.74 86.15 42 6 ASN A 18 ? A -114.85 55.30 43 6 SER A 19 ? A -176.05 -74.24 44 6 SER A 19 ? B -104.66 -64.71 45 6 ARG A 21 ? A -55.49 179.58 46 6 HIS A 27 ? A -92.30 35.67 47 6 ASN A 30 ? B 63.66 62.31 48 6 ARG A 36 ? B -51.21 108.70 49 7 LYS A 6 ? A -141.72 50.55 50 7 SER A 19 ? A -174.15 -71.45 51 7 SER A 19 ? B -104.47 -63.79 52 7 ARG A 21 ? A -55.55 179.41 53 7 ASN A 30 ? A 39.24 45.02 54 7 SER A 38 ? A -61.02 -171.28 55 8 LYS A 6 ? A -99.10 33.00 56 8 PRO A 9 ? A -69.80 87.74 57 8 SER A 16 ? B -57.32 170.58 58 8 ASN A 18 ? A -116.60 53.96 59 8 SER A 19 ? A -175.13 -71.64 60 8 SER A 19 ? B -103.24 -63.47 61 8 ARG A 21 ? A -57.68 -176.20 62 8 HIS A 27 ? A -92.14 39.37 63 8 ILE A 28 ? A -130.92 -41.08 64 8 ASN A 30 ? B 62.88 62.04 65 8 SER A 32 ? A -161.00 107.97 66 8 ARG A 36 ? B -51.53 108.86 67 9 PRO A 9 ? A -69.68 82.90 68 9 ASN A 18 ? A -143.66 34.69 69 9 SER A 19 ? A -177.73 -60.86 70 9 SER A 19 ? B -103.72 -67.78 71 9 ARG A 21 ? A -56.42 -179.45 72 9 HIS A 27 ? A -91.23 37.63 73 9 ASN A 30 ? B 63.37 61.34 74 9 SER A 32 ? A -165.41 102.54 75 9 ARG A 36 ? B -51.11 108.91 76 10 SER A 16 ? B -56.08 171.19 77 10 SER A 19 ? A -174.81 -65.39 78 10 SER A 19 ? B -103.89 -63.77 79 10 ARG A 21 ? A -57.10 -177.71 80 10 HIS A 27 ? A -90.35 45.61 81 10 ILE A 28 ? A -136.61 -40.58 82 10 ASN A 30 ? B 65.12 60.13 83 10 SER A 32 ? A -161.21 76.65 84 11 LEU A 7 ? A 63.75 150.60 85 11 PRO A 9 ? A -69.77 89.34 86 11 ASN A 18 ? A -115.83 51.86 87 11 SER A 19 ? A -172.22 -70.54 88 11 SER A 19 ? B -104.66 -65.51 89 11 ARG A 21 ? A -56.32 -179.28 90 11 HIS A 27 ? A -91.79 35.78 91 11 ASN A 30 ? B 63.47 61.58 92 11 SER A 32 ? A -161.24 89.83 93 11 ARG A 36 ? B -51.13 108.84 94 12 MET A 15 ? A -115.05 -169.17 95 12 SER A 16 ? B -58.01 -176.79 96 12 ARG A 17 ? A -146.19 35.77 97 12 ARG A 17 ? B -131.87 -38.02 98 12 ASN A 18 ? A -141.02 -57.61 99 12 SER A 19 ? B -157.73 -64.07 100 12 ARG A 21 ? A 177.19 -168.04 101 12 HIS A 27 ? A -90.15 45.84 102 12 ILE A 28 ? A -136.85 -41.67 103 12 ASN A 30 ? B 64.04 60.23 104 12 SER A 32 ? A -161.38 76.48 105 13 PRO A 9 ? A -69.65 89.21 106 13 ASN A 18 ? A -142.02 34.13 107 13 SER A 19 ? A -176.51 -67.46 108 13 SER A 19 ? B -102.77 -67.06 109 13 ARG A 21 ? A -54.87 177.75 110 13 HIS A 27 ? A -93.28 32.71 111 13 ASN A 30 ? A 48.35 29.95 112 13 ASN A 30 ? B 63.83 64.86 113 14 LYS A 6 ? A -162.83 82.92 114 14 PRO A 9 ? A -69.70 81.60 115 14 ASN A 18 ? A -130.75 -73.36 116 14 SER A 19 ? B -93.53 -65.45 117 14 ARG A 21 ? A 55.69 -178.50 118 14 VAL A 22 ? A -154.89 84.95 119 14 ILE A 28 ? A -138.77 -42.29 120 14 ASN A 30 ? B 63.79 61.64 121 15 LYS A 6 ? A -150.05 75.87 122 15 SER A 19 ? A -177.36 -60.20 123 15 ARG A 21 ? A 178.68 -168.35 124 15 HIS A 27 ? A -91.21 31.81 125 16 LEU A 7 ? A 64.36 149.21 126 16 PRO A 9 ? A -69.71 92.49 127 16 SER A 16 ? B -58.26 170.91 128 16 ASN A 18 ? A -113.97 53.56 129 16 SER A 19 ? A -175.12 -64.20 130 16 SER A 19 ? B -104.02 -65.22 131 16 ARG A 21 ? A -56.07 179.36 132 16 HIS A 27 ? A -92.24 35.29 133 16 ASN A 30 ? B 63.91 61.21 134 16 ARG A 36 ? B -51.88 109.38 135 17 LYS A 6 ? B -97.57 49.28 136 17 PRO A 9 ? A -69.65 87.54 137 17 SER A 16 ? B -59.62 -173.17 138 17 ARG A 17 ? B -141.41 -41.03 139 17 ASN A 18 ? A -143.67 -57.91 140 17 SER A 19 ? B -155.14 -65.87 141 17 ARG A 21 ? A 176.04 -168.57 142 17 HIS A 27 ? A -93.31 35.73 143 17 ASN A 30 ? B 63.72 61.25 144 17 SER A 32 ? A -164.35 88.65 145 17 ARG A 36 ? B -51.66 109.07 146 18 ASN A 18 ? A -124.86 -75.88 147 18 SER A 19 ? B -122.29 -66.97 148 18 ARG A 21 ? A 179.55 137.36 149 18 HIS A 27 ? A -91.91 43.02 150 18 ILE A 28 ? A -132.04 -40.34 151 18 ASN A 30 ? B 63.87 63.39 152 18 SER A 32 ? A -159.49 81.14 153 19 PRO A 9 ? A -69.65 91.37 154 19 ARG A 17 ? B -95.59 33.46 155 19 ASN A 18 ? B -132.91 -72.33 156 19 ASN A 30 ? B 62.71 64.03 157 20 LYS A 6 ? B -98.66 50.13 158 20 SER A 16 ? B -57.13 -178.87 159 20 ASN A 18 ? A -143.94 -54.42 160 20 SER A 19 ? B -157.99 -59.85 161 20 ARG A 21 ? A -53.37 175.39 162 20 HIS A 27 ? A -91.26 31.36 163 20 ASN A 30 ? A 38.64 45.93 164 20 SER A 32 ? A -150.06 82.75 # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #