data_6SWF # _entry.id 6SWF # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.333 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 6SWF WWPDB D_1292104426 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6SWF _pdbx_database_status.recvd_initial_deposition_date 2019-09-20 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Lansky, S.' 1 ? 'Lavid, N.' 2 ? 'Shoham, Y.' 3 ? 'Shoham, G.' 4 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Selenomethionine derivative of the REC domain of AraT, a response regulator from Geobacillus stearothermophilus' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Lansky, S.' 1 ? primary 'Lavid, N.' 2 ? primary 'Shoham, Y.' 3 ? primary 'Shoham, G.' 4 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 97.290 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6SWF _cell.details ? _cell.formula_units_Z ? _cell.length_a 48.131 _cell.length_a_esd ? _cell.length_b 32.892 _cell.length_b_esd ? _cell.length_c 78.656 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6SWF _symmetry.cell_setting ? _symmetry.Int_Tables_number 4 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1 21 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Two-component response regulator' 15788.048 2 ? ? ? ? 2 water nat water 18.015 43 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)(MSE)VWKVLIADDEAIIREGIRESIDWNEFN(MSE)EVVAEAEDGEEALELALRHRVDVLFVDLS(MSE)PI (MSE)DGLTL(MSE)KYAREKLPNCH(MSE)IVITGYDEFSYAQEAIRLQVDDYLLKPTDPQRLREVVAKVKEKLEQEQK EK ; _entity_poly.pdbx_seq_one_letter_code_can ;MMVWKVLIADDEAIIREGIRESIDWNEFNMEVVAEAEDGEEALELALRHRVDVLFVDLSMPIMDGLTLMKYAREKLPNCH MIVITGYDEFSYAQEAIRLQVDDYLLKPTDPQRLREVVAKVKEKLEQEQKEK ; _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 MSE n 1 3 VAL n 1 4 TRP n 1 5 LYS n 1 6 VAL n 1 7 LEU n 1 8 ILE n 1 9 ALA n 1 10 ASP n 1 11 ASP n 1 12 GLU n 1 13 ALA n 1 14 ILE n 1 15 ILE n 1 16 ARG n 1 17 GLU n 1 18 GLY n 1 19 ILE n 1 20 ARG n 1 21 GLU n 1 22 SER n 1 23 ILE n 1 24 ASP n 1 25 TRP n 1 26 ASN n 1 27 GLU n 1 28 PHE n 1 29 ASN n 1 30 MSE n 1 31 GLU n 1 32 VAL n 1 33 VAL n 1 34 ALA n 1 35 GLU n 1 36 ALA n 1 37 GLU n 1 38 ASP n 1 39 GLY n 1 40 GLU n 1 41 GLU n 1 42 ALA n 1 43 LEU n 1 44 GLU n 1 45 LEU n 1 46 ALA n 1 47 LEU n 1 48 ARG n 1 49 HIS n 1 50 ARG n 1 51 VAL n 1 52 ASP n 1 53 VAL n 1 54 LEU n 1 55 PHE n 1 56 VAL n 1 57 ASP n 1 58 LEU n 1 59 SER n 1 60 MSE n 1 61 PRO n 1 62 ILE n 1 63 MSE n 1 64 ASP n 1 65 GLY n 1 66 LEU n 1 67 THR n 1 68 LEU n 1 69 MSE n 1 70 LYS n 1 71 TYR n 1 72 ALA n 1 73 ARG n 1 74 GLU n 1 75 LYS n 1 76 LEU n 1 77 PRO n 1 78 ASN n 1 79 CYS n 1 80 HIS n 1 81 MSE n 1 82 ILE n 1 83 VAL n 1 84 ILE n 1 85 THR n 1 86 GLY n 1 87 TYR n 1 88 ASP n 1 89 GLU n 1 90 PHE n 1 91 SER n 1 92 TYR n 1 93 ALA n 1 94 GLN n 1 95 GLU n 1 96 ALA n 1 97 ILE n 1 98 ARG n 1 99 LEU n 1 100 GLN n 1 101 VAL n 1 102 ASP n 1 103 ASP n 1 104 TYR n 1 105 LEU n 1 106 LEU n 1 107 LYS n 1 108 PRO n 1 109 THR n 1 110 ASP n 1 111 PRO n 1 112 GLN n 1 113 ARG n 1 114 LEU n 1 115 ARG n 1 116 GLU n 1 117 VAL n 1 118 VAL n 1 119 ALA n 1 120 LYS n 1 121 VAL n 1 122 LYS n 1 123 GLU n 1 124 LYS n 1 125 LEU n 1 126 GLU n 1 127 GLN n 1 128 GLU n 1 129 GLN n 1 130 LYS n 1 131 GLU n 1 132 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 132 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene araT _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Geobacillus stearothermophilus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1422 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code B3EYL7_GEOSE _struct_ref.pdbx_db_accession B3EYL7 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;VWKVLIADDEAIIREGIRESIDWNEFNMEVVAEAEDGEEALELALRHRVDVLFVDLSMPIMDGLTLMKYAREKLPNCHMI VITGYDEFSYAQEAIRLQVDDYLLKPTDPQRLREVVAKVKEKLEQEQKEK ; _struct_ref.pdbx_align_begin 3 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 6SWF A 3 ? 132 ? B3EYL7 3 ? 132 ? 3 132 2 1 6SWF B 3 ? 132 ? B3EYL7 3 ? 132 ? 3 132 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6SWF MSE A 1 ? UNP B3EYL7 ? ? 'initiating methionine' 1 1 1 6SWF MSE A 2 ? UNP B3EYL7 ? ? 'expression tag' 2 2 2 6SWF MSE B 1 ? UNP B3EYL7 ? ? 'initiating methionine' 1 3 2 6SWF MSE B 2 ? UNP B3EYL7 ? ? 'expression tag' 2 4 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6SWF _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.01 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 38.94 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '41% PPG 425 and 0.1 M Bis-Tris pH 6' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'MARMOSAIC 225 mm CCD' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2015-07-15 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.98 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE BM14' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.98 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BM14 _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6SWF _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.60 _reflns.d_resolution_low 50.00 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 7778 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.3 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.9 _reflns.pdbx_Rmerge_I_obs 0.135 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 13.3 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.60 _reflns_shell.d_res_low 2.64 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.7 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 765 _reflns_shell.percent_possible_all 98.2 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.525 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 143.550 _refine.B_iso_mean 30.0137 _refine.B_iso_min 7.010 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6SWF _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.6010 _refine.ls_d_res_low 39.0100 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 7741 _refine.ls_number_reflns_R_free 725 _refine.ls_number_reflns_R_work 7016 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.3100 _refine.ls_percent_reflns_R_free 9.3700 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2434 _refine.ls_R_factor_R_free 0.3253 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2354 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.350 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 37.4200 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3800 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.6010 _refine_hist.d_res_low 39.0100 _refine_hist.number_atoms_solvent 43 _refine_hist.number_atoms_total 2151 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 258 _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent 29.29 _refine_hist.pdbx_number_atoms_protein 2108 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.601 2.8014 . . 146 1379 99.0000 . . . 0.3528 0.0000 0.2687 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.8014 3.0832 . . 137 1380 100.0000 . . . 0.3804 0.0000 0.2697 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.0832 3.5291 . . 143 1402 99.0000 . . . 0.3465 0.0000 0.2450 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.5291 4.4453 . . 125 1426 99.0000 . . . 0.2948 0.0000 0.2152 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.4453 39.01 . . 174 1429 99.0000 . . . 0.3043 0.0000 0.2196 . . . . . . . . . . . # _struct.entry_id 6SWF _struct.title 'Selenomethionine derivative of the REC domain of AraT, a response regulator from Geobacillus stearothermophilus' _struct.pdbx_descriptor 'Two-component response regulator' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6SWF _struct_keywords.text 'Response regulator, two component sensing system, Geobacillus stearothermophilus, arabinan utilization system, TRANSCRIPTION' _struct_keywords.pdbx_keywords TRANSCRIPTION # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLU A 12 ? SER A 22 ? GLU A 12 SER A 22 1 ? 11 HELX_P HELX_P2 AA2 ASP A 24 ? PHE A 28 ? ASP A 24 PHE A 28 5 ? 5 HELX_P HELX_P3 AA3 ASP A 38 ? HIS A 49 ? ASP A 38 HIS A 49 1 ? 12 HELX_P HELX_P4 AA4 ASP A 64 ? LEU A 76 ? ASP A 64 LEU A 76 1 ? 13 HELX_P HELX_P5 AA5 GLY A 86 ? GLN A 100 ? GLY A 86 GLN A 100 5 ? 15 HELX_P HELX_P6 AA6 ASP A 110 ? GLN A 129 ? ASP A 110 GLN A 129 1 ? 20 HELX_P HELX_P7 AA7 GLU B 12 ? GLU B 21 ? GLU B 12 GLU B 21 1 ? 10 HELX_P HELX_P8 AA8 TRP B 25 ? PHE B 28 ? TRP B 25 PHE B 28 5 ? 4 HELX_P HELX_P9 AA9 ASP B 38 ? HIS B 49 ? ASP B 38 HIS B 49 1 ? 12 HELX_P HELX_P10 AB1 ASP B 64 ? LEU B 76 ? ASP B 64 LEU B 76 1 ? 13 HELX_P HELX_P11 AB2 TYR B 92 ? GLN B 100 ? TYR B 92 GLN B 100 5 ? 9 HELX_P HELX_P12 AB3 ASP B 110 ? GLU B 128 ? ASP B 110 GLU B 128 1 ? 19 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A MSE 2 C ? ? ? 1_555 A VAL 3 N ? ? A MSE 2 A VAL 3 1_555 ? ? ? ? ? ? ? 1.317 ? ? covale2 covale both ? A ASN 29 C ? ? ? 1_555 A MSE 30 N ? ? A ASN 29 A MSE 30 1_555 ? ? ? ? ? ? ? 1.318 ? ? covale3 covale both ? A MSE 30 C ? ? ? 1_555 A GLU 31 N ? ? A MSE 30 A GLU 31 1_555 ? ? ? ? ? ? ? 1.323 ? ? covale4 covale both ? A SER 59 C ? ? ? 1_555 A MSE 60 N ? ? A SER 59 A MSE 60 1_555 ? ? ? ? ? ? ? 1.310 ? ? covale5 covale both ? A MSE 60 C ? ? ? 1_555 A PRO 61 N ? ? A MSE 60 A PRO 61 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale6 covale both ? A ILE 62 C ? ? ? 1_555 A MSE 63 N ? ? A ILE 62 A MSE 63 1_555 ? ? ? ? ? ? ? 1.324 ? ? covale7 covale both ? A MSE 63 C ? ? ? 1_555 A ASP 64 N ? ? A MSE 63 A ASP 64 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale8 covale both ? A LEU 68 C ? ? ? 1_555 A MSE 69 N ? ? A LEU 68 A MSE 69 1_555 ? ? ? ? ? ? ? 1.335 ? ? covale9 covale both ? A MSE 69 C ? ? ? 1_555 A LYS 70 N ? ? A MSE 69 A LYS 70 1_555 ? ? ? ? ? ? ? 1.340 ? ? covale10 covale both ? A HIS 80 C ? ? ? 1_555 A MSE 81 N ? ? A HIS 80 A MSE 81 1_555 ? ? ? ? ? ? ? 1.320 ? ? covale11 covale both ? A MSE 81 C ? ? ? 1_555 A ILE 82 N ? ? A MSE 81 A ILE 82 1_555 ? ? ? ? ? ? ? 1.331 ? ? covale12 covale both ? B MSE 2 C ? ? ? 1_555 B VAL 3 N ? ? B MSE 2 B VAL 3 1_555 ? ? ? ? ? ? ? 1.319 ? ? covale13 covale both ? B ASN 29 C ? ? ? 1_555 B MSE 30 N ? ? B ASN 29 B MSE 30 1_555 ? ? ? ? ? ? ? 1.320 ? ? covale14 covale both ? B MSE 30 C ? ? ? 1_555 B GLU 31 N ? ? B MSE 30 B GLU 31 1_555 ? ? ? ? ? ? ? 1.324 ? ? covale15 covale both ? B SER 59 C ? ? ? 1_555 B MSE 60 N ? ? B SER 59 B MSE 60 1_555 ? ? ? ? ? ? ? 1.324 ? ? covale16 covale both ? B MSE 60 C ? ? ? 1_555 B PRO 61 N ? ? B MSE 60 B PRO 61 1_555 ? ? ? ? ? ? ? 1.324 ? ? covale17 covale both ? B ILE 62 C ? ? ? 1_555 B MSE 63 N ? ? B ILE 62 B MSE 63 1_555 ? ? ? ? ? ? ? 1.332 ? ? covale18 covale both ? B MSE 63 C ? ? ? 1_555 B ASP 64 N ? ? B MSE 63 B ASP 64 1_555 ? ? ? ? ? ? ? 1.337 ? ? covale19 covale both ? B LEU 68 C ? ? ? 1_555 B MSE 69 N ? ? B LEU 68 B MSE 69 1_555 ? ? ? ? ? ? ? 1.333 ? ? covale20 covale both ? B MSE 69 C ? ? ? 1_555 B LYS 70 N ? ? B MSE 69 B LYS 70 1_555 ? ? ? ? ? ? ? 1.338 ? ? covale21 covale both ? B HIS 80 C ? ? ? 1_555 B MSE 81 N ? ? B HIS 80 B MSE 81 1_555 ? ? ? ? ? ? ? 1.322 ? ? covale22 covale both ? B MSE 81 C ? ? ? 1_555 B ILE 82 N ? ? B MSE 81 B ILE 82 1_555 ? ? ? ? ? ? ? 1.335 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 LYS 107 A . ? LYS 107 A PRO 108 A ? PRO 108 A 1 -1.26 2 LYS 107 B . ? LYS 107 B PRO 108 B ? PRO 108 B 1 2.34 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA2 1 2 ? parallel AA2 2 3 ? parallel AA2 3 4 ? parallel AA2 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 MSE A 30 ? ALA A 36 ? MSE A 30 ALA A 36 AA1 2 TRP A 4 ? ALA A 9 ? TRP A 4 ALA A 9 AA1 3 VAL A 53 ? VAL A 56 ? VAL A 53 VAL A 56 AA1 4 HIS A 80 ? THR A 85 ? HIS A 80 THR A 85 AA1 5 ASP A 103 ? LEU A 106 ? ASP A 103 LEU A 106 AA2 1 MSE B 30 ? ALA B 36 ? MSE B 30 ALA B 36 AA2 2 TRP B 4 ? ALA B 9 ? TRP B 4 ALA B 9 AA2 3 VAL B 53 ? VAL B 56 ? VAL B 53 VAL B 56 AA2 4 HIS B 80 ? GLY B 86 ? HIS B 80 GLY B 86 AA2 5 ASP B 103 ? LYS B 107 ? ASP B 103 LYS B 107 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O GLU A 31 ? O GLU A 31 N VAL A 6 ? N VAL A 6 AA1 2 3 N LEU A 7 ? N LEU A 7 O PHE A 55 ? O PHE A 55 AA1 3 4 N VAL A 56 ? N VAL A 56 O ILE A 84 ? O ILE A 84 AA1 4 5 N THR A 85 ? N THR A 85 O LEU A 105 ? O LEU A 105 AA2 1 2 O GLU B 31 ? O GLU B 31 N VAL B 6 ? N VAL B 6 AA2 2 3 N LEU B 7 ? N LEU B 7 O PHE B 55 ? O PHE B 55 AA2 3 4 N LEU B 54 ? N LEU B 54 O ILE B 82 ? O ILE B 82 AA2 4 5 N THR B 85 ? N THR B 85 O LEU B 105 ? O LEU B 105 # _atom_sites.entry_id 6SWF _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.020777 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.002658 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.030403 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012817 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 1 ? ? ? A . n A 1 2 MSE 2 2 2 MSE MSE A . n A 1 3 VAL 3 3 3 VAL VAL A . n A 1 4 TRP 4 4 4 TRP TRP A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 ILE 8 8 8 ILE ILE A . n A 1 9 ALA 9 9 9 ALA ALA A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 ASP 11 11 11 ASP ASP A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 ILE 14 14 14 ILE ILE A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 ARG 16 16 16 ARG ARG A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 ILE 19 19 19 ILE ILE A . n A 1 20 ARG 20 20 20 ARG ARG A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 ASP 24 24 24 ASP ASP A . n A 1 25 TRP 25 25 25 TRP TRP A . n A 1 26 ASN 26 26 26 ASN ASN A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 PHE 28 28 28 PHE PHE A . n A 1 29 ASN 29 29 29 ASN ASN A . n A 1 30 MSE 30 30 30 MSE MSE A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 ASP 38 38 38 ASP ASP A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 ARG 48 48 48 ARG ARG A . n A 1 49 HIS 49 49 49 HIS HIS A . n A 1 50 ARG 50 50 50 ARG ARG A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 ASP 52 52 52 ASP ASP A . n A 1 53 VAL 53 53 53 VAL VAL A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 PHE 55 55 55 PHE PHE A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 ASP 57 57 57 ASP ASP A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 SER 59 59 59 SER SER A . n A 1 60 MSE 60 60 60 MSE MSE A . n A 1 61 PRO 61 61 61 PRO PRO A . n A 1 62 ILE 62 62 62 ILE ILE A . n A 1 63 MSE 63 63 63 MSE MSE A . n A 1 64 ASP 64 64 64 ASP ASP A . n A 1 65 GLY 65 65 65 GLY GLY A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 THR 67 67 67 THR THR A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 MSE 69 69 69 MSE MSE A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 TYR 71 71 71 TYR TYR A . n A 1 72 ALA 72 72 72 ALA ALA A . n A 1 73 ARG 73 73 73 ARG ARG A . n A 1 74 GLU 74 74 74 GLU GLU A . n A 1 75 LYS 75 75 75 LYS LYS A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 PRO 77 77 77 PRO PRO A . n A 1 78 ASN 78 78 78 ASN ASN A . n A 1 79 CYS 79 79 79 CYS CYS A . n A 1 80 HIS 80 80 80 HIS HIS A . n A 1 81 MSE 81 81 81 MSE MSE A . n A 1 82 ILE 82 82 82 ILE ILE A . n A 1 83 VAL 83 83 83 VAL VAL A . n A 1 84 ILE 84 84 84 ILE ILE A . n A 1 85 THR 85 85 85 THR THR A . n A 1 86 GLY 86 86 86 GLY GLY A . n A 1 87 TYR 87 87 87 TYR TYR A . n A 1 88 ASP 88 88 88 ASP ASP A . n A 1 89 GLU 89 89 89 GLU GLU A . n A 1 90 PHE 90 90 90 PHE PHE A . n A 1 91 SER 91 91 91 SER SER A . n A 1 92 TYR 92 92 92 TYR TYR A . n A 1 93 ALA 93 93 93 ALA ALA A . n A 1 94 GLN 94 94 94 GLN GLN A . n A 1 95 GLU 95 95 95 GLU GLU A . n A 1 96 ALA 96 96 96 ALA ALA A . n A 1 97 ILE 97 97 97 ILE ILE A . n A 1 98 ARG 98 98 98 ARG ARG A . n A 1 99 LEU 99 99 99 LEU LEU A . n A 1 100 GLN 100 100 100 GLN GLN A . n A 1 101 VAL 101 101 101 VAL VAL A . n A 1 102 ASP 102 102 102 ASP ASP A . n A 1 103 ASP 103 103 103 ASP ASP A . n A 1 104 TYR 104 104 104 TYR TYR A . n A 1 105 LEU 105 105 105 LEU LEU A . n A 1 106 LEU 106 106 106 LEU LEU A . n A 1 107 LYS 107 107 107 LYS LYS A . n A 1 108 PRO 108 108 108 PRO PRO A . n A 1 109 THR 109 109 109 THR THR A . n A 1 110 ASP 110 110 110 ASP ASP A . n A 1 111 PRO 111 111 111 PRO PRO A . n A 1 112 GLN 112 112 112 GLN GLN A . n A 1 113 ARG 113 113 113 ARG ARG A . n A 1 114 LEU 114 114 114 LEU LEU A . n A 1 115 ARG 115 115 115 ARG ARG A . n A 1 116 GLU 116 116 116 GLU GLU A . n A 1 117 VAL 117 117 117 VAL VAL A . n A 1 118 VAL 118 118 118 VAL VAL A . n A 1 119 ALA 119 119 119 ALA ALA A . n A 1 120 LYS 120 120 120 LYS LYS A . n A 1 121 VAL 121 121 121 VAL VAL A . n A 1 122 LYS 122 122 122 LYS LYS A . n A 1 123 GLU 123 123 123 GLU GLU A . n A 1 124 LYS 124 124 124 LYS LYS A . n A 1 125 LEU 125 125 125 LEU LEU A . n A 1 126 GLU 126 126 126 GLU GLU A . n A 1 127 GLN 127 127 127 GLN GLN A . n A 1 128 GLU 128 128 128 GLU GLU A . n A 1 129 GLN 129 129 129 GLN GLN A . n A 1 130 LYS 130 130 130 LYS LYS A . n A 1 131 GLU 131 131 ? ? ? A . n A 1 132 LYS 132 132 ? ? ? A . n B 1 1 MSE 1 1 ? ? ? B . n B 1 2 MSE 2 2 2 MSE MSE B . n B 1 3 VAL 3 3 3 VAL VAL B . n B 1 4 TRP 4 4 4 TRP TRP B . n B 1 5 LYS 5 5 5 LYS LYS B . n B 1 6 VAL 6 6 6 VAL VAL B . n B 1 7 LEU 7 7 7 LEU LEU B . n B 1 8 ILE 8 8 8 ILE ILE B . n B 1 9 ALA 9 9 9 ALA ALA B . n B 1 10 ASP 10 10 10 ASP ASP B . n B 1 11 ASP 11 11 11 ASP ASP B . n B 1 12 GLU 12 12 12 GLU GLU B . n B 1 13 ALA 13 13 13 ALA ALA B . n B 1 14 ILE 14 14 14 ILE ILE B . n B 1 15 ILE 15 15 15 ILE ILE B . n B 1 16 ARG 16 16 16 ARG ARG B . n B 1 17 GLU 17 17 17 GLU GLU B . n B 1 18 GLY 18 18 18 GLY GLY B . n B 1 19 ILE 19 19 19 ILE ILE B . n B 1 20 ARG 20 20 20 ARG ARG B . n B 1 21 GLU 21 21 21 GLU GLU B . n B 1 22 SER 22 22 22 SER SER B . n B 1 23 ILE 23 23 23 ILE ILE B . n B 1 24 ASP 24 24 24 ASP ASP B . n B 1 25 TRP 25 25 25 TRP TRP B . n B 1 26 ASN 26 26 26 ASN ASN B . n B 1 27 GLU 27 27 27 GLU GLU B . n B 1 28 PHE 28 28 28 PHE PHE B . n B 1 29 ASN 29 29 29 ASN ASN B . n B 1 30 MSE 30 30 30 MSE MSE B . n B 1 31 GLU 31 31 31 GLU GLU B . n B 1 32 VAL 32 32 32 VAL VAL B . n B 1 33 VAL 33 33 33 VAL VAL B . n B 1 34 ALA 34 34 34 ALA ALA B . n B 1 35 GLU 35 35 35 GLU GLU B . n B 1 36 ALA 36 36 36 ALA ALA B . n B 1 37 GLU 37 37 37 GLU GLU B . n B 1 38 ASP 38 38 38 ASP ASP B . n B 1 39 GLY 39 39 39 GLY GLY B . n B 1 40 GLU 40 40 40 GLU GLU B . n B 1 41 GLU 41 41 41 GLU GLU B . n B 1 42 ALA 42 42 42 ALA ALA B . n B 1 43 LEU 43 43 43 LEU LEU B . n B 1 44 GLU 44 44 44 GLU GLU B . n B 1 45 LEU 45 45 45 LEU LEU B . n B 1 46 ALA 46 46 46 ALA ALA B . n B 1 47 LEU 47 47 47 LEU LEU B . n B 1 48 ARG 48 48 48 ARG ARG B . n B 1 49 HIS 49 49 49 HIS HIS B . n B 1 50 ARG 50 50 50 ARG ARG B . n B 1 51 VAL 51 51 51 VAL VAL B . n B 1 52 ASP 52 52 52 ASP ASP B . n B 1 53 VAL 53 53 53 VAL VAL B . n B 1 54 LEU 54 54 54 LEU LEU B . n B 1 55 PHE 55 55 55 PHE PHE B . n B 1 56 VAL 56 56 56 VAL VAL B . n B 1 57 ASP 57 57 57 ASP ASP B . n B 1 58 LEU 58 58 58 LEU LEU B . n B 1 59 SER 59 59 59 SER SER B . n B 1 60 MSE 60 60 60 MSE MSE B . n B 1 61 PRO 61 61 61 PRO PRO B . n B 1 62 ILE 62 62 62 ILE ILE B . n B 1 63 MSE 63 63 63 MSE MSE B . n B 1 64 ASP 64 64 64 ASP ASP B . n B 1 65 GLY 65 65 65 GLY GLY B . n B 1 66 LEU 66 66 66 LEU LEU B . n B 1 67 THR 67 67 67 THR THR B . n B 1 68 LEU 68 68 68 LEU LEU B . n B 1 69 MSE 69 69 69 MSE MSE B . n B 1 70 LYS 70 70 70 LYS LYS B . n B 1 71 TYR 71 71 71 TYR TYR B . n B 1 72 ALA 72 72 72 ALA ALA B . n B 1 73 ARG 73 73 73 ARG ARG B . n B 1 74 GLU 74 74 74 GLU GLU B . n B 1 75 LYS 75 75 75 LYS LYS B . n B 1 76 LEU 76 76 76 LEU LEU B . n B 1 77 PRO 77 77 77 PRO PRO B . n B 1 78 ASN 78 78 78 ASN ASN B . n B 1 79 CYS 79 79 79 CYS CYS B . n B 1 80 HIS 80 80 80 HIS HIS B . n B 1 81 MSE 81 81 81 MSE MSE B . n B 1 82 ILE 82 82 82 ILE ILE B . n B 1 83 VAL 83 83 83 VAL VAL B . n B 1 84 ILE 84 84 84 ILE ILE B . n B 1 85 THR 85 85 85 THR THR B . n B 1 86 GLY 86 86 86 GLY GLY B . n B 1 87 TYR 87 87 87 TYR TYR B . n B 1 88 ASP 88 88 88 ASP ASP B . n B 1 89 GLU 89 89 89 GLU GLU B . n B 1 90 PHE 90 90 90 PHE PHE B . n B 1 91 SER 91 91 91 SER SER B . n B 1 92 TYR 92 92 92 TYR TYR B . n B 1 93 ALA 93 93 93 ALA ALA B . n B 1 94 GLN 94 94 94 GLN GLN B . n B 1 95 GLU 95 95 95 GLU GLU B . n B 1 96 ALA 96 96 96 ALA ALA B . n B 1 97 ILE 97 97 97 ILE ILE B . n B 1 98 ARG 98 98 98 ARG ARG B . n B 1 99 LEU 99 99 99 LEU LEU B . n B 1 100 GLN 100 100 100 GLN GLN B . n B 1 101 VAL 101 101 101 VAL VAL B . n B 1 102 ASP 102 102 102 ASP ASP B . n B 1 103 ASP 103 103 103 ASP ASP B . n B 1 104 TYR 104 104 104 TYR TYR B . n B 1 105 LEU 105 105 105 LEU LEU B . n B 1 106 LEU 106 106 106 LEU LEU B . n B 1 107 LYS 107 107 107 LYS LYS B . n B 1 108 PRO 108 108 108 PRO PRO B . n B 1 109 THR 109 109 109 THR THR B . n B 1 110 ASP 110 110 110 ASP ASP B . n B 1 111 PRO 111 111 111 PRO PRO B . n B 1 112 GLN 112 112 112 GLN GLN B . n B 1 113 ARG 113 113 113 ARG ARG B . n B 1 114 LEU 114 114 114 LEU LEU B . n B 1 115 ARG 115 115 115 ARG ARG B . n B 1 116 GLU 116 116 116 GLU GLU B . n B 1 117 VAL 117 117 117 VAL VAL B . n B 1 118 VAL 118 118 118 VAL VAL B . n B 1 119 ALA 119 119 119 ALA ALA B . n B 1 120 LYS 120 120 120 LYS LYS B . n B 1 121 VAL 121 121 121 VAL VAL B . n B 1 122 LYS 122 122 122 LYS LYS B . n B 1 123 GLU 123 123 123 GLU GLU B . n B 1 124 LYS 124 124 124 LYS LYS B . n B 1 125 LEU 125 125 125 LEU LEU B . n B 1 126 GLU 126 126 126 GLU GLU B . n B 1 127 GLN 127 127 127 GLN GLN B . n B 1 128 GLU 128 128 128 GLU GLU B . n B 1 129 GLN 129 129 129 GLN GLN B . n B 1 130 LYS 130 130 130 LYS LYS B . n B 1 131 GLU 131 131 ? ? ? B . n B 1 132 LYS 132 132 ? ? ? B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 2 HOH 1 201 7 HOH HOH A . C 2 HOH 2 202 15 HOH HOH A . C 2 HOH 3 203 31 HOH HOH A . C 2 HOH 4 204 16 HOH HOH A . C 2 HOH 5 205 11 HOH HOH A . C 2 HOH 6 206 8 HOH HOH A . C 2 HOH 7 207 29 HOH HOH A . C 2 HOH 8 208 34 HOH HOH A . C 2 HOH 9 209 42 HOH HOH A . C 2 HOH 10 210 20 HOH HOH A . C 2 HOH 11 211 19 HOH HOH A . C 2 HOH 12 212 23 HOH HOH A . C 2 HOH 13 213 40 HOH HOH A . C 2 HOH 14 214 3 HOH HOH A . C 2 HOH 15 215 30 HOH HOH A . C 2 HOH 16 216 33 HOH HOH A . C 2 HOH 17 217 18 HOH HOH A . C 2 HOH 18 218 27 HOH HOH A . C 2 HOH 19 219 41 HOH HOH A . D 2 HOH 1 201 21 HOH HOH B . D 2 HOH 2 202 26 HOH HOH B . D 2 HOH 3 203 6 HOH HOH B . D 2 HOH 4 204 12 HOH HOH B . D 2 HOH 5 205 9 HOH HOH B . D 2 HOH 6 206 17 HOH HOH B . D 2 HOH 7 207 10 HOH HOH B . D 2 HOH 8 208 28 HOH HOH B . D 2 HOH 9 209 2 HOH HOH B . D 2 HOH 10 210 32 HOH HOH B . D 2 HOH 11 211 35 HOH HOH B . D 2 HOH 12 212 14 HOH HOH B . D 2 HOH 13 213 36 HOH HOH B . D 2 HOH 14 214 25 HOH HOH B . D 2 HOH 15 215 13 HOH HOH B . D 2 HOH 16 216 24 HOH HOH B . D 2 HOH 17 217 5 HOH HOH B . D 2 HOH 18 218 43 HOH HOH B . D 2 HOH 19 219 22 HOH HOH B . D 2 HOH 20 220 4 HOH HOH B . D 2 HOH 21 221 1 HOH HOH B . D 2 HOH 22 222 38 HOH HOH B . D 2 HOH 23 223 39 HOH HOH B . D 2 HOH 24 224 37 HOH HOH B . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 30 A MSE 30 ? MET 'modified residue' 2 A MSE 60 A MSE 60 ? MET 'modified residue' 3 A MSE 63 A MSE 63 ? MET 'modified residue' 4 A MSE 69 A MSE 69 ? MET 'modified residue' 5 A MSE 81 A MSE 81 ? MET 'modified residue' 6 B MSE 30 B MSE 30 ? MET 'modified residue' 7 B MSE 60 B MSE 60 ? MET 'modified residue' 8 B MSE 63 B MSE 63 ? MET 'modified residue' 9 B MSE 69 B MSE 69 ? MET 'modified residue' 10 B MSE 81 B MSE 81 ? MET 'modified residue' # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_defined_assembly ? monomeric 1 2 author_defined_assembly ? monomeric 1 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,C 2 1 B,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2020-10-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.15.2_3472 1 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _pdbx_entry_details.entry_id 6SWF _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest N # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A LEU 125 ? ? OE1 A GLN 129 ? ? 1.68 2 1 NH2 B ARG 98 ? ? O B HOH 201 ? ? 2.12 3 1 N B LEU 58 ? ? O B HOH 202 ? ? 2.13 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 3 ? ? -33.83 123.59 2 1 ALA A 34 ? ? -176.94 130.98 3 1 ARG A 50 ? ? 36.84 59.39 4 1 LEU A 58 ? ? 75.66 -47.94 5 1 ILE A 62 ? ? 69.65 -76.86 6 1 GLN A 100 ? ? 57.71 80.33 7 1 LEU B 58 ? ? 76.71 -57.34 8 1 ILE B 62 ? ? 71.64 -72.71 9 1 GLN B 100 ? ? 45.43 71.36 10 1 GLN B 129 ? ? -108.41 53.95 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 1 ASN A 78 ? ? CYS A 79 ? ? 148.77 2 1 GLU B 89 ? ? PHE B 90 ? ? 145.80 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MSE 1 ? A MSE 1 2 1 Y 1 A GLU 131 ? A GLU 131 3 1 Y 1 A LYS 132 ? A LYS 132 4 1 Y 1 B MSE 1 ? B MSE 1 5 1 Y 1 B GLU 131 ? B GLU 131 6 1 Y 1 B LYS 132 ? B LYS 132 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support homology _pdbx_struct_assembly_auth_evidence.details ? #