data_6SWG # _entry.id 6SWG # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6SWG pdb_00006swg 10.2210/pdb6swg/pdb WWPDB D_1292104413 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-08-05 2 'Structure model' 2 0 2020-08-12 3 'Structure model' 2 1 2020-09-16 4 'Structure model' 2 2 2020-10-07 5 'Structure model' 2 3 2020-10-21 6 'Structure model' 2 4 2024-05-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Polymer sequence' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Database references' 4 5 'Structure model' 'Database references' 5 6 'Structure model' 'Data collection' 6 6 'Structure model' 'Database references' 7 6 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' entity_poly 2 3 'Structure model' citation 3 3 'Structure model' citation_author 4 4 'Structure model' citation 5 4 'Structure model' citation_author 6 5 'Structure model' citation 7 6 'Structure model' chem_comp_atom 8 6 'Structure model' chem_comp_bond 9 6 'Structure model' citation 10 6 'Structure model' database_2 11 6 'Structure model' struct_ncs_dom_lim # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_entity_poly.pdbx_target_identifier' 2 4 'Structure model' '_citation.pdbx_database_id_DOI' 3 4 'Structure model' '_citation.pdbx_database_id_PubMed' 4 4 'Structure model' '_citation.title' 5 4 'Structure model' '_citation_author.identifier_ORCID' 6 4 'Structure model' '_citation_author.name' 7 5 'Structure model' '_citation.journal_volume' 8 5 'Structure model' '_citation.page_first' 9 5 'Structure model' '_citation.page_last' 10 6 'Structure model' '_citation.journal_id_ISSN' 11 6 'Structure model' '_database_2.pdbx_DOI' 12 6 'Structure model' '_database_2.pdbx_database_accession' 13 6 'Structure model' '_struct_ncs_dom_lim.beg_auth_comp_id' 14 6 'Structure model' '_struct_ncs_dom_lim.beg_label_asym_id' 15 6 'Structure model' '_struct_ncs_dom_lim.beg_label_comp_id' 16 6 'Structure model' '_struct_ncs_dom_lim.beg_label_seq_id' 17 6 'Structure model' '_struct_ncs_dom_lim.end_auth_comp_id' 18 6 'Structure model' '_struct_ncs_dom_lim.end_label_asym_id' 19 6 'Structure model' '_struct_ncs_dom_lim.end_label_comp_id' 20 6 'Structure model' '_struct_ncs_dom_lim.end_label_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6SWG _pdbx_database_status.recvd_initial_deposition_date 2019-09-20 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category CAPRI _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Prigozhin, D.M.' 1 0000-0003-2075-0231 'Freund, S.M.V.' 2 0000-0002-7031-9872 'Modis, Y.' 3 0000-0002-6084-0429 # loop_ _citation.abstract _citation.abstract_id_CAS _citation.book_id_ISBN _citation.book_publisher _citation.book_publisher_city _citation.book_title _citation.coordinate_linkage _citation.country _citation.database_id_Medline _citation.details _citation.id _citation.journal_abbrev _citation.journal_id_ASTM _citation.journal_id_CSD _citation.journal_id_ISSN _citation.journal_full _citation.journal_issue _citation.journal_volume _citation.language _citation.page_first _citation.page_last _citation.title _citation.year _citation.database_id_CSD _citation.pdbx_database_id_DOI _citation.pdbx_database_id_PubMed _citation.unpublished_flag ? ? ? ? ? ? ? UK ? ? primary 'Nucleic Acids Res.' NARHAD 0389 1362-4962 ? ? 48 ? 10313 10328 'Periphilin self-association underpins epigenetic silencing by the HUSH complex.' 2020 ? 10.1093/nar/gkaa785 32976585 ? ? ? ? ? ? ? ? US ? ? 1 Biorxiv ? ? 2692-8205 ? ? ? ? ? ? 'TASOR is a pseudo-PARP that directs HUSH complex assembly and epigenetic transposon control' 2020 ? 10.1101/2020.03.09.974832v1 ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Prigozhin, D.M.' 1 ? primary 'Douse, C.H.' 2 ? primary 'Farleigh, L.E.' 3 ? primary 'Albecka, A.' 4 ? primary 'Tchasovnikarova, I.A.' 5 ? primary 'Timms, R.T.' 6 ? primary 'Oda, S.I.' 7 ? primary 'Adolf, F.' 8 ? primary 'Freund, S.M.V.' 9 ? primary 'Maslen, S.' 10 ? primary 'Lehner, P.J.' 11 ? primary 'Modis, Y.' 12 ? 1 'Prigozhin, D.M.' 13 0000-0003-2075-0231 1 'Albecka, A.' 14 ? 1 'Douse, C.H.' 15 0000-0002-1604-8944 1 'Tchasovnikarova, I.A.' 16 ? 1 'Timms, R.T.' 17 ? 1 'Farleigh, L.E.' 18 ? 1 'Freund, S.M.V.' 19 0000-0002-7031-9872 1 'Lehner, P.J.' 20 ? 1 'Modis, Y.' 21 0000-0002-6084-0429 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Periphilin-1 11035.414 2 ? ? ? 'TASOR binding region of Periphilin (residues 292-367)' 2 polymer man 'Protein TASOR' 9490.903 1 ? ? ? 'Periphilin binding region of TASOR (residues 1014-1095)' 3 non-polymer syn 'SULFATE ION' 96.063 1 ? ? ? ? # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;MGSSHHHHHHSQENLYFQSQLTTRSKAIASKTKEIEQVYRQDCETFGMVVKMLIEKDPSLEKSIQFALRQNLHEIGERCV EELKHFIAEYDTST ; ;MGSSHHHHHHSQENLYFQSQLTTRSKAIASKTKEIEQVYRQDCETFGMVVKMLIEKDPSLEKSIQFALRQNLHEIGERCV EELKHFIAEYDTST ; A,B ? 2 'polypeptide(L)' no no ;MSETTERTVLGEYNLFSRKIEEILKQKNVSYVSTVSTPIFSTQEKMKRLSEFIYSKTSKAGVQEFVDGLHEKLNTIIIKA SAK ; ;MSETTERTVLGEYNLFSRKIEEILKQKNVSYVSTVSTPIFSTQEKMKRLSEFIYSKTSKAGVQEFVDGLHEKLNTIIIKA SAK ; C ? # _pdbx_entity_nonpoly.entity_id 3 _pdbx_entity_nonpoly.name 'SULFATE ION' _pdbx_entity_nonpoly.comp_id SO4 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 SER n 1 12 GLN n 1 13 GLU n 1 14 ASN n 1 15 LEU n 1 16 TYR n 1 17 PHE n 1 18 GLN n 1 19 SER n 1 20 GLN n 1 21 LEU n 1 22 THR n 1 23 THR n 1 24 ARG n 1 25 SER n 1 26 LYS n 1 27 ALA n 1 28 ILE n 1 29 ALA n 1 30 SER n 1 31 LYS n 1 32 THR n 1 33 LYS n 1 34 GLU n 1 35 ILE n 1 36 GLU n 1 37 GLN n 1 38 VAL n 1 39 TYR n 1 40 ARG n 1 41 GLN n 1 42 ASP n 1 43 CYS n 1 44 GLU n 1 45 THR n 1 46 PHE n 1 47 GLY n 1 48 MET n 1 49 VAL n 1 50 VAL n 1 51 LYS n 1 52 MET n 1 53 LEU n 1 54 ILE n 1 55 GLU n 1 56 LYS n 1 57 ASP n 1 58 PRO n 1 59 SER n 1 60 LEU n 1 61 GLU n 1 62 LYS n 1 63 SER n 1 64 ILE n 1 65 GLN n 1 66 PHE n 1 67 ALA n 1 68 LEU n 1 69 ARG n 1 70 GLN n 1 71 ASN n 1 72 LEU n 1 73 HIS n 1 74 GLU n 1 75 ILE n 1 76 GLY n 1 77 GLU n 1 78 ARG n 1 79 CYS n 1 80 VAL n 1 81 GLU n 1 82 GLU n 1 83 LEU n 1 84 LYS n 1 85 HIS n 1 86 PHE n 1 87 ILE n 1 88 ALA n 1 89 GLU n 1 90 TYR n 1 91 ASP n 1 92 THR n 1 93 SER n 1 94 THR n 2 1 MET n 2 2 SER n 2 3 GLU n 2 4 THR n 2 5 THR n 2 6 GLU n 2 7 ARG n 2 8 THR n 2 9 VAL n 2 10 LEU n 2 11 GLY n 2 12 GLU n 2 13 TYR n 2 14 ASN n 2 15 LEU n 2 16 PHE n 2 17 SER n 2 18 ARG n 2 19 LYS n 2 20 ILE n 2 21 GLU n 2 22 GLU n 2 23 ILE n 2 24 LEU n 2 25 LYS n 2 26 GLN n 2 27 LYS n 2 28 ASN n 2 29 VAL n 2 30 SER n 2 31 TYR n 2 32 VAL n 2 33 SER n 2 34 THR n 2 35 VAL n 2 36 SER n 2 37 THR n 2 38 PRO n 2 39 ILE n 2 40 PHE n 2 41 SER n 2 42 THR n 2 43 GLN n 2 44 GLU n 2 45 LYS n 2 46 MET n 2 47 LYS n 2 48 ARG n 2 49 LEU n 2 50 SER n 2 51 GLU n 2 52 PHE n 2 53 ILE n 2 54 TYR n 2 55 SER n 2 56 LYS n 2 57 THR n 2 58 SER n 2 59 LYS n 2 60 ALA n 2 61 GLY n 2 62 VAL n 2 63 GLN n 2 64 GLU n 2 65 PHE n 2 66 VAL n 2 67 ASP n 2 68 GLY n 2 69 LEU n 2 70 HIS n 2 71 GLU n 2 72 LYS n 2 73 LEU n 2 74 ASN n 2 75 THR n 2 76 ILE n 2 77 ILE n 2 78 ILE n 2 79 LYS n 2 80 ALA n 2 81 SER n 2 82 ALA n 2 83 LYS n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 94 Human ? 'PPHLN1, HSPC206, HSPC232' ? ? ? ? ? ? 'Homo sapiens' 9606 'Isoform 2 (identifier: Q8NEY8-2)' ? ? ? ? ? ? ? 'Escherichia coli BL21' 511693 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2 1 sample 'Biological sequence' 1 83 Human ? 'TASOR, C3orf63, FAM208A, KIAA1105' ? ? ? ? ? ? 'Homo sapiens' 9606 'Isoform 1' ? ? ? ? ? ? ? 'Escherichia coli BL21' 511693 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 274 ? ? ? A . n A 1 2 GLY 2 275 ? ? ? A . n A 1 3 SER 3 276 ? ? ? A . n A 1 4 SER 4 277 ? ? ? A . n A 1 5 HIS 5 278 ? ? ? A . n A 1 6 HIS 6 279 ? ? ? A . n A 1 7 HIS 7 280 ? ? ? A . n A 1 8 HIS 8 281 ? ? ? A . n A 1 9 HIS 9 282 ? ? ? A . n A 1 10 HIS 10 283 ? ? ? A . n A 1 11 SER 11 284 ? ? ? A . n A 1 12 GLN 12 285 ? ? ? A . n A 1 13 GLU 13 286 ? ? ? A . n A 1 14 ASN 14 287 ? ? ? A . n A 1 15 LEU 15 288 ? ? ? A . n A 1 16 TYR 16 289 ? ? ? A . n A 1 17 PHE 17 290 ? ? ? A . n A 1 18 GLN 18 291 ? ? ? A . n A 1 19 SER 19 292 ? ? ? A . n A 1 20 GLN 20 293 ? ? ? A . n A 1 21 LEU 21 294 ? ? ? A . n A 1 22 THR 22 295 295 THR THR A . n A 1 23 THR 23 296 296 THR THR A . n A 1 24 ARG 24 297 297 ARG ARG A . n A 1 25 SER 25 298 298 SER SER A . n A 1 26 LYS 26 299 299 LYS LYS A . n A 1 27 ALA 27 300 300 ALA ALA A . n A 1 28 ILE 28 301 301 ILE ILE A . n A 1 29 ALA 29 302 302 ALA ALA A . n A 1 30 SER 30 303 303 SER SER A . n A 1 31 LYS 31 304 304 LYS LYS A . n A 1 32 THR 32 305 305 THR THR A . n A 1 33 LYS 33 306 306 LYS LYS A . n A 1 34 GLU 34 307 307 GLU GLU A . n A 1 35 ILE 35 308 308 ILE ILE A . n A 1 36 GLU 36 309 309 GLU GLU A . n A 1 37 GLN 37 310 310 GLN GLN A . n A 1 38 VAL 38 311 311 VAL VAL A . n A 1 39 TYR 39 312 312 TYR TYR A . n A 1 40 ARG 40 313 313 ARG ARG A . n A 1 41 GLN 41 314 314 GLN GLN A . n A 1 42 ASP 42 315 315 ASP ASP A . n A 1 43 CYS 43 316 316 CYS CYS A . n A 1 44 GLU 44 317 317 GLU GLU A . n A 1 45 THR 45 318 318 THR THR A . n A 1 46 PHE 46 319 319 PHE PHE A . n A 1 47 GLY 47 320 320 GLY GLY A . n A 1 48 MET 48 321 321 MET MET A . n A 1 49 VAL 49 322 322 VAL VAL A . n A 1 50 VAL 50 323 323 VAL VAL A . n A 1 51 LYS 51 324 324 LYS LYS A . n A 1 52 MET 52 325 325 MET MET A . n A 1 53 LEU 53 326 326 LEU LEU A . n A 1 54 ILE 54 327 327 ILE ILE A . n A 1 55 GLU 55 328 328 GLU GLU A . n A 1 56 LYS 56 329 329 LYS LYS A . n A 1 57 ASP 57 330 330 ASP ASP A . n A 1 58 PRO 58 331 331 PRO PRO A . n A 1 59 SER 59 332 332 SER SER A . n A 1 60 LEU 60 333 333 LEU LEU A . n A 1 61 GLU 61 334 334 GLU GLU A . n A 1 62 LYS 62 335 335 LYS LYS A . n A 1 63 SER 63 336 336 SER SER A . n A 1 64 ILE 64 337 337 ILE ILE A . n A 1 65 GLN 65 338 338 GLN GLN A . n A 1 66 PHE 66 339 339 PHE PHE A . n A 1 67 ALA 67 340 340 ALA ALA A . n A 1 68 LEU 68 341 341 LEU LEU A . n A 1 69 ARG 69 342 342 ARG ARG A . n A 1 70 GLN 70 343 343 GLN GLN A . n A 1 71 ASN 71 344 344 ASN ASN A . n A 1 72 LEU 72 345 345 LEU LEU A . n A 1 73 HIS 73 346 346 HIS HIS A . n A 1 74 GLU 74 347 347 GLU GLU A . n A 1 75 ILE 75 348 348 ILE ILE A . n A 1 76 GLY 76 349 349 GLY GLY A . n A 1 77 GLU 77 350 350 GLU GLU A . n A 1 78 ARG 78 351 351 ARG ARG A . n A 1 79 CYS 79 352 352 CYS CYS A . n A 1 80 VAL 80 353 353 VAL VAL A . n A 1 81 GLU 81 354 354 GLU GLU A . n A 1 82 GLU 82 355 355 GLU GLU A . n A 1 83 LEU 83 356 356 LEU LEU A . n A 1 84 LYS 84 357 357 LYS LYS A . n A 1 85 HIS 85 358 358 HIS HIS A . n A 1 86 PHE 86 359 359 PHE PHE A . n A 1 87 ILE 87 360 360 ILE ILE A . n A 1 88 ALA 88 361 361 ALA ALA A . n A 1 89 GLU 89 362 362 GLU GLU A . n A 1 90 TYR 90 363 363 TYR TYR A . n A 1 91 ASP 91 364 364 ASP ASP A . n A 1 92 THR 92 365 365 THR THR A . n A 1 93 SER 93 366 366 SER SER A . n A 1 94 THR 94 367 ? ? ? A . n B 1 1 MET 1 274 ? ? ? B . n B 1 2 GLY 2 275 ? ? ? B . n B 1 3 SER 3 276 ? ? ? B . n B 1 4 SER 4 277 ? ? ? B . n B 1 5 HIS 5 278 ? ? ? B . n B 1 6 HIS 6 279 ? ? ? B . n B 1 7 HIS 7 280 ? ? ? B . n B 1 8 HIS 8 281 ? ? ? B . n B 1 9 HIS 9 282 ? ? ? B . n B 1 10 HIS 10 283 ? ? ? B . n B 1 11 SER 11 284 ? ? ? B . n B 1 12 GLN 12 285 ? ? ? B . n B 1 13 GLU 13 286 ? ? ? B . n B 1 14 ASN 14 287 ? ? ? B . n B 1 15 LEU 15 288 ? ? ? B . n B 1 16 TYR 16 289 ? ? ? B . n B 1 17 PHE 17 290 ? ? ? B . n B 1 18 GLN 18 291 ? ? ? B . n B 1 19 SER 19 292 ? ? ? B . n B 1 20 GLN 20 293 ? ? ? B . n B 1 21 LEU 21 294 294 LEU LEU B . n B 1 22 THR 22 295 295 THR THR B . n B 1 23 THR 23 296 296 THR THR B . n B 1 24 ARG 24 297 297 ARG ARG B . n B 1 25 SER 25 298 298 SER SER B . n B 1 26 LYS 26 299 299 LYS LYS B . n B 1 27 ALA 27 300 300 ALA ALA B . n B 1 28 ILE 28 301 301 ILE ILE B . n B 1 29 ALA 29 302 302 ALA ALA B . n B 1 30 SER 30 303 303 SER SER B . n B 1 31 LYS 31 304 304 LYS LYS B . n B 1 32 THR 32 305 305 THR THR B . n B 1 33 LYS 33 306 306 LYS LYS B . n B 1 34 GLU 34 307 307 GLU GLU B . n B 1 35 ILE 35 308 308 ILE ILE B . n B 1 36 GLU 36 309 309 GLU GLU B . n B 1 37 GLN 37 310 310 GLN GLN B . n B 1 38 VAL 38 311 311 VAL VAL B . n B 1 39 TYR 39 312 312 TYR TYR B . n B 1 40 ARG 40 313 313 ARG ARG B . n B 1 41 GLN 41 314 314 GLN GLN B . n B 1 42 ASP 42 315 315 ASP ASP B . n B 1 43 CYS 43 316 316 CYS CYS B . n B 1 44 GLU 44 317 317 GLU GLU B . n B 1 45 THR 45 318 318 THR THR B . n B 1 46 PHE 46 319 319 PHE PHE B . n B 1 47 GLY 47 320 320 GLY GLY B . n B 1 48 MET 48 321 321 MET MET B . n B 1 49 VAL 49 322 322 VAL VAL B . n B 1 50 VAL 50 323 323 VAL VAL B . n B 1 51 LYS 51 324 324 LYS LYS B . n B 1 52 MET 52 325 325 MET MET B . n B 1 53 LEU 53 326 326 LEU LEU B . n B 1 54 ILE 54 327 327 ILE ILE B . n B 1 55 GLU 55 328 328 GLU GLU B . n B 1 56 LYS 56 329 329 LYS LYS B . n B 1 57 ASP 57 330 330 ASP ASP B . n B 1 58 PRO 58 331 331 PRO PRO B . n B 1 59 SER 59 332 332 SER SER B . n B 1 60 LEU 60 333 333 LEU LEU B . n B 1 61 GLU 61 334 334 GLU GLU B . n B 1 62 LYS 62 335 335 LYS LYS B . n B 1 63 SER 63 336 336 SER SER B . n B 1 64 ILE 64 337 337 ILE ILE B . n B 1 65 GLN 65 338 338 GLN GLN B . n B 1 66 PHE 66 339 339 PHE PHE B . n B 1 67 ALA 67 340 340 ALA ALA B . n B 1 68 LEU 68 341 341 LEU LEU B . n B 1 69 ARG 69 342 342 ARG ARG B . n B 1 70 GLN 70 343 343 GLN GLN B . n B 1 71 ASN 71 344 344 ASN ASN B . n B 1 72 LEU 72 345 345 LEU LEU B . n B 1 73 HIS 73 346 346 HIS HIS B . n B 1 74 GLU 74 347 347 GLU GLU B . n B 1 75 ILE 75 348 348 ILE ILE B . n B 1 76 GLY 76 349 349 GLY GLY B . n B 1 77 GLU 77 350 350 GLU GLU B . n B 1 78 ARG 78 351 351 ARG ARG B . n B 1 79 CYS 79 352 352 CYS CYS B . n B 1 80 VAL 80 353 353 VAL VAL B . n B 1 81 GLU 81 354 354 GLU GLU B . n B 1 82 GLU 82 355 355 GLU GLU B . n B 1 83 LEU 83 356 356 LEU LEU B . n B 1 84 LYS 84 357 357 LYS LYS B . n B 1 85 HIS 85 358 358 HIS HIS B . n B 1 86 PHE 86 359 359 PHE PHE B . n B 1 87 ILE 87 360 360 ILE ILE B . n B 1 88 ALA 88 361 361 ALA ALA B . n B 1 89 GLU 89 362 362 GLU GLU B . n B 1 90 TYR 90 363 363 TYR TYR B . n B 1 91 ASP 91 364 364 ASP ASP B . n B 1 92 THR 92 365 365 THR THR B . n B 1 93 SER 93 366 366 SER SER B . n B 1 94 THR 94 367 367 THR THR B . n C 2 1 MET 1 1013 ? ? ? C . n C 2 2 SER 2 1014 1014 SER SER C . n C 2 3 GLU 3 1015 1015 GLU GLU C . n C 2 4 THR 4 1016 1016 THR THR C . n C 2 5 THR 5 1017 1017 THR THR C . n C 2 6 GLU 6 1018 1018 GLU GLU C . n C 2 7 ARG 7 1019 1019 ARG ARG C . n C 2 8 THR 8 1020 1020 THR THR C . n C 2 9 VAL 9 1021 1021 VAL VAL C . n C 2 10 LEU 10 1022 1022 LEU LEU C . n C 2 11 GLY 11 1023 1023 GLY GLY C . n C 2 12 GLU 12 1024 1024 GLU GLU C . n C 2 13 TYR 13 1025 1025 TYR TYR C . n C 2 14 ASN 14 1026 1026 ASN ASN C . n C 2 15 LEU 15 1027 1027 LEU LEU C . n C 2 16 PHE 16 1028 1028 PHE PHE C . n C 2 17 SER 17 1029 1029 SER SER C . n C 2 18 ARG 18 1030 1030 ARG ARG C . n C 2 19 LYS 19 1031 1031 LYS LYS C . n C 2 20 ILE 20 1032 1032 ILE ILE C . n C 2 21 GLU 21 1033 1033 GLU GLU C . n C 2 22 GLU 22 1034 1034 GLU GLU C . n C 2 23 ILE 23 1035 1035 ILE ILE C . n C 2 24 LEU 24 1036 1036 LEU LEU C . n C 2 25 LYS 25 1037 1037 LYS LYS C . n C 2 26 GLN 26 1038 1038 GLN GLN C . n C 2 27 LYS 27 1039 1039 LYS LYS C . n C 2 28 ASN 28 1040 1040 ASN ASN C . n C 2 29 VAL 29 1041 1041 VAL VAL C . n C 2 30 SER 30 1042 1042 SER SER C . n C 2 31 TYR 31 1043 1043 TYR TYR C . n C 2 32 VAL 32 1044 1044 VAL VAL C . n C 2 33 SER 33 1045 1045 SER SER C . n C 2 34 THR 34 1046 1046 THR THR C . n C 2 35 VAL 35 1047 1047 VAL VAL C . n C 2 36 SER 36 1048 1048 SER SER C . n C 2 37 THR 37 1049 1049 THR THR C . n C 2 38 PRO 38 1050 1050 PRO PRO C . n C 2 39 ILE 39 1051 1051 ILE ILE C . n C 2 40 PHE 40 1052 1052 PHE PHE C . n C 2 41 SER 41 1053 1053 SER SER C . n C 2 42 THR 42 1054 1054 THR THR C . n C 2 43 GLN 43 1055 ? ? ? C . n C 2 44 GLU 44 1056 ? ? ? C . n C 2 45 LYS 45 1057 ? ? ? C . n C 2 46 MET 46 1058 ? ? ? C . n C 2 47 LYS 47 1059 ? ? ? C . n C 2 48 ARG 48 1060 ? ? ? C . n C 2 49 LEU 49 1061 ? ? ? C . n C 2 50 SER 50 1062 ? ? ? C . n C 2 51 GLU 51 1063 ? ? ? C . n C 2 52 PHE 52 1064 ? ? ? C . n C 2 53 ILE 53 1065 ? ? ? C . n C 2 54 TYR 54 1066 ? ? ? C . n C 2 55 SER 55 1067 ? ? ? C . n C 2 56 LYS 56 1068 ? ? ? C . n C 2 57 THR 57 1069 ? ? ? C . n C 2 58 SER 58 1070 ? ? ? C . n C 2 59 LYS 59 1071 ? ? ? C . n C 2 60 ALA 60 1072 1072 ALA ALA C . n C 2 61 GLY 61 1073 1073 GLY GLY C . n C 2 62 VAL 62 1074 1074 VAL VAL C . n C 2 63 GLN 63 1075 1075 GLN GLN C . n C 2 64 GLU 64 1076 1076 GLU GLU C . n C 2 65 PHE 65 1077 1077 PHE PHE C . n C 2 66 VAL 66 1078 1078 VAL VAL C . n C 2 67 ASP 67 1079 1079 ASP ASP C . n C 2 68 GLY 68 1080 1080 GLY GLY C . n C 2 69 LEU 69 1081 1081 LEU LEU C . n C 2 70 HIS 70 1082 1082 HIS HIS C . n C 2 71 GLU 71 1083 1083 GLU GLU C . n C 2 72 LYS 72 1084 1084 LYS LYS C . n C 2 73 LEU 73 1085 1085 LEU LEU C . n C 2 74 ASN 74 1086 1086 ASN ASN C . n C 2 75 THR 75 1087 1087 THR THR C . n C 2 76 ILE 76 1088 1088 ILE ILE C . n C 2 77 ILE 77 1089 1089 ILE ILE C . n C 2 78 ILE 78 1090 1090 ILE ILE C . n C 2 79 LYS 79 1091 1091 LYS LYS C . n C 2 80 ALA 80 1092 1092 ALA ALA C . n C 2 81 SER 81 1093 1093 SER SER C . n C 2 82 ALA 82 1094 ? ? ? C . n C 2 83 LYS 83 1095 ? ? ? C . n # _pdbx_nonpoly_scheme.asym_id D _pdbx_nonpoly_scheme.entity_id 3 _pdbx_nonpoly_scheme.mon_id SO4 _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 1101 _pdbx_nonpoly_scheme.auth_seq_num 1 _pdbx_nonpoly_scheme.pdb_mon_id SO4 _pdbx_nonpoly_scheme.auth_mon_id SO4 _pdbx_nonpoly_scheme.pdb_strand_id C _pdbx_nonpoly_scheme.pdb_ins_code . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.16_3549 1 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? 'version 11' 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 'version 0.5.32' 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? CRANK2 ? ? ? 'version 2.0.148' 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 6SWG _cell.details ? _cell.formula_units_Z ? _cell.length_a 93.570 _cell.length_a_esd ? _cell.length_b 93.570 _cell.length_b_esd ? _cell.length_c 84.970 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6SWG _symmetry.cell_setting ? _symmetry.Int_Tables_number 154 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 32 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6SWG _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 4.40 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 72.08 _exptl_crystal.description 'Hexagonal rods' _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '1M ammonium sulfate, 100 mM sodium citrate; protein buffer: PBS' _exptl_crystal_grow.pdbx_pH_range '4.0 - 5.0' # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details 'Torroidal mirror' _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M-F' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-01-08 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'single bounce monochromator' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.91587 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I04-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.91587 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I04-1 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6SWG _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.510 _reflns.d_resolution_low 41.0 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 15081 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.900 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 10.000 _reflns.pdbx_Rmerge_I_obs 0.085 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 15.000 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.089 _reflns.pdbx_Rpim_I_all 0.029 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.998 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.510 _reflns_shell.d_res_low 2.580 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1113 _reflns_shell.percent_possible_all 100.000 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 1.087 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 10.000 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 1.146 _reflns_shell.pdbx_Rpim_I_all 0.360 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.735 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 271.290 _refine.B_iso_mean 123 _refine.B_iso_min 70.240 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6SWG _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.5100 _refine.ls_d_res_low 40.9830 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 15064 _refine.ls_number_reflns_R_free 785 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.9100 _refine.ls_percent_reflns_R_free 5.2100 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2303 _refine.ls_R_factor_R_free 0.2706 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2280 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.340 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 34.2400 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3700 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.5100 _refine_hist.d_res_low 40.9830 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 1689 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 209 _refine_hist.pdbx_B_iso_mean_ligand 151.48 _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1684 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 5 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr_ncs.pdbx_refine_id _refine_ls_restr_ncs.dom_id _refine_ls_restr_ncs.ncs_model_details _refine_ls_restr_ncs.rms_dev_B_iso _refine_ls_restr_ncs.rms_dev_position _refine_ls_restr_ncs.weight_B_iso _refine_ls_restr_ncs.weight_position _refine_ls_restr_ncs.pdbx_ordinal _refine_ls_restr_ncs.pdbx_type _refine_ls_restr_ncs.pdbx_asym_id _refine_ls_restr_ncs.pdbx_auth_asym_id _refine_ls_restr_ncs.pdbx_number _refine_ls_restr_ncs.pdbx_rms _refine_ls_restr_ncs.pdbx_weight _refine_ls_restr_ncs.pdbx_ens_id 'X-RAY DIFFRACTION' 1 ? ? ? ? ? 1 TORSIONAL ? A 578 10.836 ? 1 'X-RAY DIFFRACTION' 2 ? ? ? ? ? 2 TORSIONAL ? B 578 10.836 ? 1 # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.5105 2.6677 . . 132 2349 100.0000 . . . 0.3794 0.0000 0.2983 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.6677 2.8737 . . 118 2349 100.0000 . . . 0.3353 0.0000 0.3048 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.8737 3.1628 . . 114 2377 100.0000 . . . 0.3599 0.0000 0.2954 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.1628 3.6202 . . 129 2359 100.0000 . . . 0.3268 0.0000 0.2601 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.6202 4.5601 . . 132 2375 100.0000 . . . 0.2579 0.0000 0.2029 . . . . . . . . . . 'X-RAY DIFFRACTION' 4.5601 40.98 . . 160 2470 100.0000 . . . 0.2442 0.0000 0.2119 . . . . . . . . . . # loop_ _struct_ncs_dom.pdbx_ens_id _struct_ncs_dom.id _struct_ncs_dom.details 1 1 ;(chain A and (resid 295 or resid 297 through 298 or resid 300 through 312 or resid 314 through 341 or resid 343 through 357 or resid 359 through 365)) ; 1 2 ;(chain B and (resid 295 or resid 297 through 298 or resid 300 through 312 or resid 314 through 341 or resid 343 through 357 or resid 359 through 365)) ; # loop_ _struct_ncs_dom_lim.pdbx_ens_id _struct_ncs_dom_lim.dom_id _struct_ncs_dom_lim.pdbx_component_id _struct_ncs_dom_lim.beg_label_asym_id _struct_ncs_dom_lim.beg_label_comp_id _struct_ncs_dom_lim.beg_label_seq_id _struct_ncs_dom_lim.beg_label_alt_id _struct_ncs_dom_lim.end_label_asym_id _struct_ncs_dom_lim.end_label_comp_id _struct_ncs_dom_lim.end_label_seq_id _struct_ncs_dom_lim.end_label_alt_id _struct_ncs_dom_lim.beg_auth_asym_id _struct_ncs_dom_lim.beg_auth_comp_id _struct_ncs_dom_lim.beg_auth_seq_id _struct_ncs_dom_lim.end_auth_asym_id _struct_ncs_dom_lim.end_auth_comp_id _struct_ncs_dom_lim.end_auth_seq_id _struct_ncs_dom_lim.pdbx_refine_code _struct_ncs_dom_lim.selection_details 1 1 1 A THR 22 . A THR 22 . A THR 295 A THR 295 ? ;(chain A and (resid 295 or resid 297 through 298 or resid 300 through 312 or resid 314 through 341 or resid 343 through 357 or resid 359 through 365)) ; 1 1 2 A ARG 24 . A SER 25 . A ARG 297 A SER 298 ? ;(chain A and (resid 295 or resid 297 through 298 or resid 300 through 312 or resid 314 through 341 or resid 343 through 357 or resid 359 through 365)) ; 1 1 3 A ALA 27 . A TYR 39 . A ALA 300 A TYR 312 ? ;(chain A and (resid 295 or resid 297 through 298 or resid 300 through 312 or resid 314 through 341 or resid 343 through 357 or resid 359 through 365)) ; 1 1 4 A GLN 41 . A LEU 68 . A GLN 314 A LEU 341 ? ;(chain A and (resid 295 or resid 297 through 298 or resid 300 through 312 or resid 314 through 341 or resid 343 through 357 or resid 359 through 365)) ; 1 1 5 A GLN 70 . A LYS 84 . A GLN 343 A LYS 357 ? ;(chain A and (resid 295 or resid 297 through 298 or resid 300 through 312 or resid 314 through 341 or resid 343 through 357 or resid 359 through 365)) ; 1 1 6 A PHE 86 . A THR 92 . A PHE 359 A THR 365 ? ;(chain A and (resid 295 or resid 297 through 298 or resid 300 through 312 or resid 314 through 341 or resid 343 through 357 or resid 359 through 365)) ; 1 2 1 B THR 22 . B THR 22 . B THR 295 B THR 295 ? ;(chain B and (resid 295 or resid 297 through 298 or resid 300 through 312 or resid 314 through 341 or resid 343 through 357 or resid 359 through 365)) ; 1 2 2 B ARG 24 . B SER 25 . B ARG 297 B SER 298 ? ;(chain B and (resid 295 or resid 297 through 298 or resid 300 through 312 or resid 314 through 341 or resid 343 through 357 or resid 359 through 365)) ; 1 2 3 B ALA 27 . B TYR 39 . B ALA 300 B TYR 312 ? ;(chain B and (resid 295 or resid 297 through 298 or resid 300 through 312 or resid 314 through 341 or resid 343 through 357 or resid 359 through 365)) ; 1 2 4 B GLN 41 . B LEU 68 . B GLN 314 B LEU 341 ? ;(chain B and (resid 295 or resid 297 through 298 or resid 300 through 312 or resid 314 through 341 or resid 343 through 357 or resid 359 through 365)) ; 1 2 5 B GLN 70 . B LYS 84 . B GLN 343 B LYS 357 ? ;(chain B and (resid 295 or resid 297 through 298 or resid 300 through 312 or resid 314 through 341 or resid 343 through 357 or resid 359 through 365)) ; 1 2 6 B PHE 86 . B THR 92 . B PHE 359 B THR 365 ? ;(chain B and (resid 295 or resid 297 through 298 or resid 300 through 312 or resid 314 through 341 or resid 343 through 357 or resid 359 through 365)) ; # _struct_ncs_ens.id 1 _struct_ncs_ens.details ? # _struct.entry_id 6SWG _struct.title 'Crystal structure of the TASOR-Periphilin core complex' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6SWG _struct_keywords.text ;Nuclear protein; Transcriptional repressor; epigenetic silencing; histone H3 lysine 9 methylation (H3K9me3); transposable element; LINE1 element; low-complexity sequence; liquid-liquid phase separation (LLPS); membrane-less compartment; RNA-binding protein, GENE REGULATION ; _struct_keywords.pdbx_keywords 'GENE REGULATION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 3 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP PPHLN_HUMAN Q8NEY8 Q8NEY8-2 1 SQLTTRSKAIASKTKEIEQVYRQDCETFGMVVKMLIEKDPSLEKSIQFALRQNLHEIGERCVEELKHFIAEYDTST 292 2 UNP TASOR_HUMAN Q9UK61 ? 2 ;SETTERTVLGEYNLFSRKIEEILKQKNVSYVSTVSTPIFSTQEKMKRLSEFIYSKTSKAGVQEFVDGLHEKLNTIIIKAS AK ; 1014 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 6SWG A 19 ? 94 ? Q8NEY8 292 ? 367 ? 292 367 2 1 6SWG B 19 ? 94 ? Q8NEY8 292 ? 367 ? 292 367 3 2 6SWG C 2 ? 83 ? Q9UK61 1014 ? 1095 ? 1014 1095 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6SWG MET A 1 ? UNP Q8NEY8 ? ? 'initiating methionine' 274 1 1 6SWG GLY A 2 ? UNP Q8NEY8 ? ? 'expression tag' 275 2 1 6SWG SER A 3 ? UNP Q8NEY8 ? ? 'expression tag' 276 3 1 6SWG SER A 4 ? UNP Q8NEY8 ? ? 'expression tag' 277 4 1 6SWG HIS A 5 ? UNP Q8NEY8 ? ? 'expression tag' 278 5 1 6SWG HIS A 6 ? UNP Q8NEY8 ? ? 'expression tag' 279 6 1 6SWG HIS A 7 ? UNP Q8NEY8 ? ? 'expression tag' 280 7 1 6SWG HIS A 8 ? UNP Q8NEY8 ? ? 'expression tag' 281 8 1 6SWG HIS A 9 ? UNP Q8NEY8 ? ? 'expression tag' 282 9 1 6SWG HIS A 10 ? UNP Q8NEY8 ? ? 'expression tag' 283 10 1 6SWG SER A 11 ? UNP Q8NEY8 ? ? 'expression tag' 284 11 1 6SWG GLN A 12 ? UNP Q8NEY8 ? ? 'expression tag' 285 12 1 6SWG GLU A 13 ? UNP Q8NEY8 ? ? 'expression tag' 286 13 1 6SWG ASN A 14 ? UNP Q8NEY8 ? ? 'expression tag' 287 14 1 6SWG LEU A 15 ? UNP Q8NEY8 ? ? 'expression tag' 288 15 1 6SWG TYR A 16 ? UNP Q8NEY8 ? ? 'expression tag' 289 16 1 6SWG PHE A 17 ? UNP Q8NEY8 ? ? 'expression tag' 290 17 1 6SWG GLN A 18 ? UNP Q8NEY8 ? ? 'expression tag' 291 18 2 6SWG MET B 1 ? UNP Q8NEY8 ? ? 'initiating methionine' 274 19 2 6SWG GLY B 2 ? UNP Q8NEY8 ? ? 'expression tag' 275 20 2 6SWG SER B 3 ? UNP Q8NEY8 ? ? 'expression tag' 276 21 2 6SWG SER B 4 ? UNP Q8NEY8 ? ? 'expression tag' 277 22 2 6SWG HIS B 5 ? UNP Q8NEY8 ? ? 'expression tag' 278 23 2 6SWG HIS B 6 ? UNP Q8NEY8 ? ? 'expression tag' 279 24 2 6SWG HIS B 7 ? UNP Q8NEY8 ? ? 'expression tag' 280 25 2 6SWG HIS B 8 ? UNP Q8NEY8 ? ? 'expression tag' 281 26 2 6SWG HIS B 9 ? UNP Q8NEY8 ? ? 'expression tag' 282 27 2 6SWG HIS B 10 ? UNP Q8NEY8 ? ? 'expression tag' 283 28 2 6SWG SER B 11 ? UNP Q8NEY8 ? ? 'expression tag' 284 29 2 6SWG GLN B 12 ? UNP Q8NEY8 ? ? 'expression tag' 285 30 2 6SWG GLU B 13 ? UNP Q8NEY8 ? ? 'expression tag' 286 31 2 6SWG ASN B 14 ? UNP Q8NEY8 ? ? 'expression tag' 287 32 2 6SWG LEU B 15 ? UNP Q8NEY8 ? ? 'expression tag' 288 33 2 6SWG TYR B 16 ? UNP Q8NEY8 ? ? 'expression tag' 289 34 2 6SWG PHE B 17 ? UNP Q8NEY8 ? ? 'expression tag' 290 35 2 6SWG GLN B 18 ? UNP Q8NEY8 ? ? 'expression tag' 291 36 3 6SWG MET C 1 ? UNP Q9UK61 ? ? 'initiating methionine' 1013 37 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details trimeric _pdbx_struct_assembly.oligomeric_count 3 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 5680 ? 1 MORE -47 ? 1 'SSA (A^2)' 13040 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_auth_evidence.id _pdbx_struct_assembly_auth_evidence.assembly_id _pdbx_struct_assembly_auth_evidence.experimental_support _pdbx_struct_assembly_auth_evidence.details 1 1 'light scattering' ? 2 1 'mass spectrometry' ? 3 1 'gel filtration' ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ARG A 24 ? ASP A 57 ? ARG A 297 ASP A 330 1 ? 34 HELX_P HELX_P2 AA2 SER A 59 ? ASP A 91 ? SER A 332 ASP A 364 1 ? 33 HELX_P HELX_P3 AA3 THR B 22 ? ASP B 57 ? THR B 295 ASP B 330 1 ? 36 HELX_P HELX_P4 AA4 LEU B 60 ? THR B 94 ? LEU B 333 THR B 367 1 ? 35 HELX_P HELX_P5 AA5 GLU C 3 ? LYS C 27 ? GLU C 1015 LYS C 1039 1 ? 25 HELX_P HELX_P6 AA6 VAL C 62 ? ALA C 80 ? VAL C 1074 ALA C 1092 1 ? 19 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id LYS _struct_mon_prot_cis.label_seq_id 27 _struct_mon_prot_cis.label_asym_id C _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id LYS _struct_mon_prot_cis.auth_seq_id 1039 _struct_mon_prot_cis.auth_asym_id C _struct_mon_prot_cis.pdbx_label_comp_id_2 ASN _struct_mon_prot_cis.pdbx_label_seq_id_2 28 _struct_mon_prot_cis.pdbx_label_asym_id_2 C _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 ASN _struct_mon_prot_cis.pdbx_auth_seq_id_2 1040 _struct_mon_prot_cis.pdbx_auth_asym_id_2 C _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -3.86 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id C _struct_site.pdbx_auth_comp_id SO4 _struct_site.pdbx_auth_seq_id 1101 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 3 _struct_site.details 'binding site for residue SO4 C 1101' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 3 THR B 22 ? THR B 295 . ? 4_566 ? 2 AC1 3 ARG B 24 ? ARG B 297 . ? 4_566 ? 3 AC1 3 ARG C 7 ? ARG C 1019 . ? 1_555 ? # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 OE1 _pdbx_validate_symm_contact.auth_asym_id_1 B _pdbx_validate_symm_contact.auth_comp_id_1 GLU _pdbx_validate_symm_contact.auth_seq_id_1 354 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 HH21 _pdbx_validate_symm_contact.auth_asym_id_2 C _pdbx_validate_symm_contact.auth_comp_id_2 ARG _pdbx_validate_symm_contact.auth_seq_id_2 1030 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 4_456 _pdbx_validate_symm_contact.dist 1.52 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 CA _pdbx_validate_rmsd_angle.auth_asym_id_1 B _pdbx_validate_rmsd_angle.auth_comp_id_1 LEU _pdbx_validate_rmsd_angle.auth_seq_id_1 294 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CB _pdbx_validate_rmsd_angle.auth_asym_id_2 B _pdbx_validate_rmsd_angle.auth_comp_id_2 LEU _pdbx_validate_rmsd_angle.auth_seq_id_2 294 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 CG _pdbx_validate_rmsd_angle.auth_asym_id_3 B _pdbx_validate_rmsd_angle.auth_comp_id_3 LEU _pdbx_validate_rmsd_angle.auth_seq_id_3 294 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 135.04 _pdbx_validate_rmsd_angle.angle_target_value 115.30 _pdbx_validate_rmsd_angle.angle_deviation 19.74 _pdbx_validate_rmsd_angle.angle_standard_deviation 2.30 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 364 ? ? -87.02 30.60 2 1 SER B 366 ? ? -156.40 24.59 3 1 VAL C 1041 ? ? 47.15 -148.46 4 1 SER C 1042 ? ? 90.87 -178.04 5 1 THR C 1046 ? ? -141.07 29.99 # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined -37.5821 33.4017 37.9641 0.7502 ? -0.0394 ? 0.1683 ? 0.8071 ? -0.0560 ? 1.0617 ? 0.9943 ? 0.4528 ? 0.2703 ? 0.8302 ? 1.1368 ? 1.1216 ? 0.2581 ? -0.1267 ? -0.1105 ? -0.1658 ? -0.5078 ? 0.8445 ? 0.3448 ? -0.0067 ? -0.0000 ? 2 'X-RAY DIFFRACTION' ? refined -33.7720 38.1030 29.9595 0.9193 ? 0.0148 ? 0.0049 ? 0.7267 ? -0.0076 ? 1.0905 ? 0.1916 ? -0.5559 ? -0.8221 ? 2.1716 ? 1.8360 ? 2.6773 ? 0.4969 ? 0.4834 ? 0.5543 ? -1.2654 ? -0.6378 ? -0.3733 ? -0.3408 ? 0.1070 ? -0.0049 ? 3 'X-RAY DIFFRACTION' ? refined -48.7487 16.0418 32.9149 0.9720 ? -0.0252 ? 0.0829 ? 0.9125 ? -0.0413 ? 0.9192 ? 2.2555 ? 0.6703 ? -0.4898 ? 0.4542 ? -0.5753 ? 0.7801 ? 0.3952 ? 0.5146 ? 0.5213 ? 0.4285 ? 0.0541 ? 0.2585 ? -0.5644 ? -0.7834 ? -0.0003 ? 4 'X-RAY DIFFRACTION' ? refined -43.0169 8.0515 34.5141 1.1690 ? -0.0808 ? 0.1380 ? 0.8953 ? -0.0606 ? 1.0356 ? 1.7218 ? 1.4705 ? -2.6596 ? 0.9042 ? -2.6666 ? 1.3402 ? -0.4861 ? -0.2663 ? -0.8877 ? -0.3479 ? -0.3961 ? -0.9397 ? 0.3077 ? 0.3888 ? 0.0028 ? 5 'X-RAY DIFFRACTION' ? refined -29.1514 40.2264 39.1861 1.0972 ? -0.0151 ? 0.0969 ? 0.8768 ? -0.0239 ? 1.0592 ? 0.9257 ? 1.9014 ? 1.6467 ? 2.9531 ? 2.7741 ? 0.5012 ? -0.5934 ? -0.7027 ? 0.6181 ? 0.0990 ? 1.0902 ? -0.3295 ? -0.1125 ? 0.4739 ? -0.0036 ? 6 'X-RAY DIFFRACTION' ? refined -36.2142 29.0577 41.4804 1.4133 ? -0.3200 ? 0.3710 ? 1.2024 ? -0.1497 ? 0.9187 ? 4.0796 ? 1.0365 ? 3.9154 ? 4.9333 ? 6.2780 ? 8.1611 ? 0.5434 ? -1.3844 ? -1.8747 ? 2.0797 ? 0.5016 ? -1.0742 ? 3.2094 ? -0.6089 ? 1.6136 ? 7 'X-RAY DIFFRACTION' ? refined -53.7426 4.2983 30.5210 1.4043 ? -0.0805 ? 0.0060 ? 1.1943 ? -0.1135 ? 0.8951 ? 2.7493 ? -0.0628 ? -0.4596 ? 0.5817 ? -0.5209 ? 1.4699 ? -0.1103 ? 1.7409 ? 1.2885 ? -0.9773 ? 0.9239 ? 0.6012 ? 0.2025 ? -0.7572 ? 0.0180 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? A 295 ? ? A 330 ? ;chain 'A' and (resid 295 through 330 ) ; 2 'X-RAY DIFFRACTION' 2 ? ? A 331 ? ? A 366 ? ;chain 'A' and (resid 331 through 366 ) ; 3 'X-RAY DIFFRACTION' 3 ? ? B 294 ? ? B 330 ? ;chain 'B' and (resid 294 through 330 ) ; 4 'X-RAY DIFFRACTION' 4 ? ? B 331 ? ? B 367 ? ;chain 'B' and (resid 331 through 367 ) ; 5 'X-RAY DIFFRACTION' 5 ? ? C 0 ? ? C 0 ? ;chain 'C' and (resid 1014 through 1043 ) ; 6 'X-RAY DIFFRACTION' 6 ? ? C 0 ? ? C 0 ? ;chain 'C' and (resid 1044 through 1074 ) ; 7 'X-RAY DIFFRACTION' 7 ? ? C 0 ? ? C 0 ? ;chain 'C' and (resid 1075 through 1093 ) ; # _pdbx_entry_details.entry_id 6SWG _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 274 ? A MET 1 2 1 Y 1 A GLY 275 ? A GLY 2 3 1 Y 1 A SER 276 ? A SER 3 4 1 Y 1 A SER 277 ? A SER 4 5 1 Y 1 A HIS 278 ? A HIS 5 6 1 Y 1 A HIS 279 ? A HIS 6 7 1 Y 1 A HIS 280 ? A HIS 7 8 1 Y 1 A HIS 281 ? A HIS 8 9 1 Y 1 A HIS 282 ? A HIS 9 10 1 Y 1 A HIS 283 ? A HIS 10 11 1 Y 1 A SER 284 ? A SER 11 12 1 Y 1 A GLN 285 ? A GLN 12 13 1 Y 1 A GLU 286 ? A GLU 13 14 1 Y 1 A ASN 287 ? A ASN 14 15 1 Y 1 A LEU 288 ? A LEU 15 16 1 Y 1 A TYR 289 ? A TYR 16 17 1 Y 1 A PHE 290 ? A PHE 17 18 1 Y 1 A GLN 291 ? A GLN 18 19 1 Y 1 A SER 292 ? A SER 19 20 1 Y 1 A GLN 293 ? A GLN 20 21 1 Y 1 A LEU 294 ? A LEU 21 22 1 Y 1 A THR 367 ? A THR 94 23 1 Y 1 B MET 274 ? B MET 1 24 1 Y 1 B GLY 275 ? B GLY 2 25 1 Y 1 B SER 276 ? B SER 3 26 1 Y 1 B SER 277 ? B SER 4 27 1 Y 1 B HIS 278 ? B HIS 5 28 1 Y 1 B HIS 279 ? B HIS 6 29 1 Y 1 B HIS 280 ? B HIS 7 30 1 Y 1 B HIS 281 ? B HIS 8 31 1 Y 1 B HIS 282 ? B HIS 9 32 1 Y 1 B HIS 283 ? B HIS 10 33 1 Y 1 B SER 284 ? B SER 11 34 1 Y 1 B GLN 285 ? B GLN 12 35 1 Y 1 B GLU 286 ? B GLU 13 36 1 Y 1 B ASN 287 ? B ASN 14 37 1 Y 1 B LEU 288 ? B LEU 15 38 1 Y 1 B TYR 289 ? B TYR 16 39 1 Y 1 B PHE 290 ? B PHE 17 40 1 Y 1 B GLN 291 ? B GLN 18 41 1 Y 1 B SER 292 ? B SER 19 42 1 Y 1 B GLN 293 ? B GLN 20 43 1 Y 1 C MET 1013 ? C MET 1 44 1 Y 1 C GLN 1055 ? C GLN 43 45 1 Y 1 C GLU 1056 ? C GLU 44 46 1 Y 1 C LYS 1057 ? C LYS 45 47 1 Y 1 C MET 1058 ? C MET 46 48 1 Y 1 C LYS 1059 ? C LYS 47 49 1 Y 1 C ARG 1060 ? C ARG 48 50 1 Y 1 C LEU 1061 ? C LEU 49 51 1 Y 1 C SER 1062 ? C SER 50 52 1 Y 1 C GLU 1063 ? C GLU 51 53 1 Y 1 C PHE 1064 ? C PHE 52 54 1 Y 1 C ILE 1065 ? C ILE 53 55 1 Y 1 C TYR 1066 ? C TYR 54 56 1 Y 1 C SER 1067 ? C SER 55 57 1 Y 1 C LYS 1068 ? C LYS 56 58 1 Y 1 C THR 1069 ? C THR 57 59 1 Y 1 C SER 1070 ? C SER 58 60 1 Y 1 C LYS 1071 ? C LYS 59 61 1 Y 1 C ALA 1094 ? C ALA 82 62 1 Y 1 C LYS 1095 ? C LYS 83 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 SO4 S S N N 301 SO4 O1 O N N 302 SO4 O2 O N N 303 SO4 O3 O N N 304 SO4 O4 O N N 305 THR N N N N 306 THR CA C N S 307 THR C C N N 308 THR O O N N 309 THR CB C N R 310 THR OG1 O N N 311 THR CG2 C N N 312 THR OXT O N N 313 THR H H N N 314 THR H2 H N N 315 THR HA H N N 316 THR HB H N N 317 THR HG1 H N N 318 THR HG21 H N N 319 THR HG22 H N N 320 THR HG23 H N N 321 THR HXT H N N 322 TYR N N N N 323 TYR CA C N S 324 TYR C C N N 325 TYR O O N N 326 TYR CB C N N 327 TYR CG C Y N 328 TYR CD1 C Y N 329 TYR CD2 C Y N 330 TYR CE1 C Y N 331 TYR CE2 C Y N 332 TYR CZ C Y N 333 TYR OH O N N 334 TYR OXT O N N 335 TYR H H N N 336 TYR H2 H N N 337 TYR HA H N N 338 TYR HB2 H N N 339 TYR HB3 H N N 340 TYR HD1 H N N 341 TYR HD2 H N N 342 TYR HE1 H N N 343 TYR HE2 H N N 344 TYR HH H N N 345 TYR HXT H N N 346 VAL N N N N 347 VAL CA C N S 348 VAL C C N N 349 VAL O O N N 350 VAL CB C N N 351 VAL CG1 C N N 352 VAL CG2 C N N 353 VAL OXT O N N 354 VAL H H N N 355 VAL H2 H N N 356 VAL HA H N N 357 VAL HB H N N 358 VAL HG11 H N N 359 VAL HG12 H N N 360 VAL HG13 H N N 361 VAL HG21 H N N 362 VAL HG22 H N N 363 VAL HG23 H N N 364 VAL HXT H N N 365 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 SO4 S O1 doub N N 288 SO4 S O2 doub N N 289 SO4 S O3 sing N N 290 SO4 S O4 sing N N 291 THR N CA sing N N 292 THR N H sing N N 293 THR N H2 sing N N 294 THR CA C sing N N 295 THR CA CB sing N N 296 THR CA HA sing N N 297 THR C O doub N N 298 THR C OXT sing N N 299 THR CB OG1 sing N N 300 THR CB CG2 sing N N 301 THR CB HB sing N N 302 THR OG1 HG1 sing N N 303 THR CG2 HG21 sing N N 304 THR CG2 HG22 sing N N 305 THR CG2 HG23 sing N N 306 THR OXT HXT sing N N 307 TYR N CA sing N N 308 TYR N H sing N N 309 TYR N H2 sing N N 310 TYR CA C sing N N 311 TYR CA CB sing N N 312 TYR CA HA sing N N 313 TYR C O doub N N 314 TYR C OXT sing N N 315 TYR CB CG sing N N 316 TYR CB HB2 sing N N 317 TYR CB HB3 sing N N 318 TYR CG CD1 doub Y N 319 TYR CG CD2 sing Y N 320 TYR CD1 CE1 sing Y N 321 TYR CD1 HD1 sing N N 322 TYR CD2 CE2 doub Y N 323 TYR CD2 HD2 sing N N 324 TYR CE1 CZ doub Y N 325 TYR CE1 HE1 sing N N 326 TYR CE2 CZ sing Y N 327 TYR CE2 HE2 sing N N 328 TYR CZ OH sing N N 329 TYR OH HH sing N N 330 TYR OXT HXT sing N N 331 VAL N CA sing N N 332 VAL N H sing N N 333 VAL N H2 sing N N 334 VAL CA C sing N N 335 VAL CA CB sing N N 336 VAL CA HA sing N N 337 VAL C O doub N N 338 VAL C OXT sing N N 339 VAL CB CG1 sing N N 340 VAL CB CG2 sing N N 341 VAL CB HB sing N N 342 VAL CG1 HG11 sing N N 343 VAL CG1 HG12 sing N N 344 VAL CG1 HG13 sing N N 345 VAL CG2 HG21 sing N N 346 VAL CG2 HG22 sing N N 347 VAL CG2 HG23 sing N N 348 VAL OXT HXT sing N N 349 # _pdbx_audit_support.funding_organization 'Wellcome Trust' _pdbx_audit_support.country 'United Kingdom' _pdbx_audit_support.grant_number 101908/Z/13/Z _pdbx_audit_support.ordinal 1 # _pdbx_related_exp_data_set.ordinal 1 _pdbx_related_exp_data_set.data_reference 10.15785/SBGRID/714 _pdbx_related_exp_data_set.metadata_reference ? _pdbx_related_exp_data_set.data_set_type 'diffraction image data' _pdbx_related_exp_data_set.details ? # _atom_sites.entry_id 6SWG _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.010687 _atom_sites.fract_transf_matrix[1][2] 0.006170 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.012340 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011769 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_