data_6SXW # _entry.id 6SXW # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6SXW pdb_00006sxw 10.2210/pdb6sxw/pdb WWPDB D_1292104519 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-10-16 2 'Structure model' 1 1 2024-01-24 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6SXW _pdbx_database_status.recvd_initial_deposition_date 2019-09-26 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Newman, J.A.' 1 ? 'Aitkenhead, H.' 2 ? 'Wang, D.' 3 ? 'Burgess-Brown, N.A.' 4 ? 'von Delft, F.' 5 ? 'Arrowsmith, C.H.' 6 ? 'Edwards, A.' 7 ? 'Bountra, C.' 8 ? 'Gileadi, O.' 9 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Crystal structure of the first RRM domain of human Zinc finger protein 638 (ZNF638)' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Newman, J.A.' 1 ? primary 'Aitkenhead, H.' 2 ? primary 'Wang, D.' 3 ? primary 'Burgess-Brown, N.A.' 4 ? primary 'von Delft, F.' 5 ? primary 'Arrowsmith, C.H.' 6 ? primary 'Edwards, A.' 7 ? primary 'Bountra, C.' 8 ? primary 'Gileadi, O.' 9 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Zinc finger protein 638' 8443.946 1 ? ? ? ? 2 non-polymer syn 'SULFATE ION' 96.063 2 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;Cutaneous T-cell lymphoma-associated antigen se33-1,CTCL-associated antigen se33-1,Nuclear protein 220,Zinc finger matrin-like protein ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code SVLLITELPEDGCTEEDVRKLFQPFGKVNDVLIVPYRKEAYLEMEFKEAITAIMKYIETTPLTIKGKSVKICVP _entity_poly.pdbx_seq_one_letter_code_can SVLLITELPEDGCTEEDVRKLFQPFGKVNDVLIVPYRKEAYLEMEFKEAITAIMKYIETTPLTIKGKSVKICVP _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'SULFATE ION' _pdbx_entity_nonpoly.comp_id SO4 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 VAL n 1 3 LEU n 1 4 LEU n 1 5 ILE n 1 6 THR n 1 7 GLU n 1 8 LEU n 1 9 PRO n 1 10 GLU n 1 11 ASP n 1 12 GLY n 1 13 CYS n 1 14 THR n 1 15 GLU n 1 16 GLU n 1 17 ASP n 1 18 VAL n 1 19 ARG n 1 20 LYS n 1 21 LEU n 1 22 PHE n 1 23 GLN n 1 24 PRO n 1 25 PHE n 1 26 GLY n 1 27 LYS n 1 28 VAL n 1 29 ASN n 1 30 ASP n 1 31 VAL n 1 32 LEU n 1 33 ILE n 1 34 VAL n 1 35 PRO n 1 36 TYR n 1 37 ARG n 1 38 LYS n 1 39 GLU n 1 40 ALA n 1 41 TYR n 1 42 LEU n 1 43 GLU n 1 44 MET n 1 45 GLU n 1 46 PHE n 1 47 LYS n 1 48 GLU n 1 49 ALA n 1 50 ILE n 1 51 THR n 1 52 ALA n 1 53 ILE n 1 54 MET n 1 55 LYS n 1 56 TYR n 1 57 ILE n 1 58 GLU n 1 59 THR n 1 60 THR n 1 61 PRO n 1 62 LEU n 1 63 THR n 1 64 ILE n 1 65 LYS n 1 66 GLY n 1 67 LYS n 1 68 SER n 1 69 VAL n 1 70 LYS n 1 71 ILE n 1 72 CYS n 1 73 VAL n 1 74 PRO n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 74 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'ZNF638, NP220, ZFML' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 676 676 SER SER A . n A 1 2 VAL 2 677 677 VAL VAL A . n A 1 3 LEU 3 678 678 LEU LEU A . n A 1 4 LEU 4 679 679 LEU LEU A . n A 1 5 ILE 5 680 680 ILE ILE A . n A 1 6 THR 6 681 681 THR THR A . n A 1 7 GLU 7 682 682 GLU GLU A . n A 1 8 LEU 8 683 683 LEU LEU A . n A 1 9 PRO 9 684 684 PRO PRO A . n A 1 10 GLU 10 685 685 GLU GLU A . n A 1 11 ASP 11 686 686 ASP ASP A . n A 1 12 GLY 12 687 687 GLY GLY A . n A 1 13 CYS 13 688 688 CYS CYS A . n A 1 14 THR 14 689 689 THR THR A . n A 1 15 GLU 15 690 690 GLU GLU A . n A 1 16 GLU 16 691 691 GLU GLU A . n A 1 17 ASP 17 692 692 ASP ASP A . n A 1 18 VAL 18 693 693 VAL VAL A . n A 1 19 ARG 19 694 694 ARG ARG A . n A 1 20 LYS 20 695 695 LYS LYS A . n A 1 21 LEU 21 696 696 LEU LEU A . n A 1 22 PHE 22 697 697 PHE PHE A . n A 1 23 GLN 23 698 698 GLN GLN A . n A 1 24 PRO 24 699 699 PRO PRO A . n A 1 25 PHE 25 700 700 PHE PHE A . n A 1 26 GLY 26 701 701 GLY GLY A . n A 1 27 LYS 27 702 702 LYS LYS A . n A 1 28 VAL 28 703 703 VAL VAL A . n A 1 29 ASN 29 704 704 ASN ASN A . n A 1 30 ASP 30 705 705 ASP ASP A . n A 1 31 VAL 31 706 706 VAL VAL A . n A 1 32 LEU 32 707 707 LEU LEU A . n A 1 33 ILE 33 708 708 ILE ILE A . n A 1 34 VAL 34 709 709 VAL VAL A . n A 1 35 PRO 35 710 710 PRO PRO A . n A 1 36 TYR 36 711 711 TYR TYR A . n A 1 37 ARG 37 712 712 ARG ARG A . n A 1 38 LYS 38 713 713 LYS LYS A . n A 1 39 GLU 39 714 714 GLU GLU A . n A 1 40 ALA 40 715 715 ALA ALA A . n A 1 41 TYR 41 716 716 TYR TYR A . n A 1 42 LEU 42 717 717 LEU LEU A . n A 1 43 GLU 43 718 718 GLU GLU A . n A 1 44 MET 44 719 719 MET MET A . n A 1 45 GLU 45 720 720 GLU GLU A . n A 1 46 PHE 46 721 721 PHE PHE A . n A 1 47 LYS 47 722 722 LYS LYS A . n A 1 48 GLU 48 723 723 GLU GLU A . n A 1 49 ALA 49 724 724 ALA ALA A . n A 1 50 ILE 50 725 725 ILE ILE A . n A 1 51 THR 51 726 726 THR THR A . n A 1 52 ALA 52 727 727 ALA ALA A . n A 1 53 ILE 53 728 728 ILE ILE A . n A 1 54 MET 54 729 729 MET MET A . n A 1 55 LYS 55 730 730 LYS LYS A . n A 1 56 TYR 56 731 731 TYR TYR A . n A 1 57 ILE 57 732 732 ILE ILE A . n A 1 58 GLU 58 733 733 GLU GLU A . n A 1 59 THR 59 734 734 THR THR A . n A 1 60 THR 60 735 735 THR THR A . n A 1 61 PRO 61 736 736 PRO PRO A . n A 1 62 LEU 62 737 737 LEU LEU A . n A 1 63 THR 63 738 738 THR THR A . n A 1 64 ILE 64 739 739 ILE ILE A . n A 1 65 LYS 65 740 740 LYS LYS A . n A 1 66 GLY 66 741 741 GLY GLY A . n A 1 67 LYS 67 742 742 LYS LYS A . n A 1 68 SER 68 743 743 SER SER A . n A 1 69 VAL 69 744 744 VAL VAL A . n A 1 70 LYS 70 745 745 LYS LYS A . n A 1 71 ILE 71 746 746 ILE ILE A . n A 1 72 CYS 72 747 747 CYS CYS A . n A 1 73 VAL 73 748 748 VAL VAL A . n A 1 74 PRO 74 749 749 PRO PRO A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SO4 1 801 1 SO4 SO4 A . C 2 SO4 1 802 2 SO4 SO4 A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 685 ? CG ? A GLU 10 CG 2 1 Y 1 A GLU 685 ? CD ? A GLU 10 CD 3 1 Y 1 A GLU 685 ? OE1 ? A GLU 10 OE1 4 1 Y 1 A GLU 685 ? OE2 ? A GLU 10 OE2 5 1 Y 1 A GLU 691 ? CG ? A GLU 16 CG 6 1 Y 1 A GLU 691 ? CD ? A GLU 16 CD 7 1 Y 1 A GLU 691 ? OE1 ? A GLU 16 OE1 8 1 Y 1 A GLU 691 ? OE2 ? A GLU 16 OE2 9 1 Y 1 A ARG 694 ? CG ? A ARG 19 CG 10 1 Y 1 A ARG 694 ? CD ? A ARG 19 CD 11 1 Y 1 A ARG 694 ? NE ? A ARG 19 NE 12 1 Y 1 A ARG 694 ? CZ ? A ARG 19 CZ 13 1 Y 1 A ARG 694 ? NH1 ? A ARG 19 NH1 14 1 Y 1 A ARG 694 ? NH2 ? A ARG 19 NH2 15 1 Y 1 A LYS 695 ? CG ? A LYS 20 CG 16 1 Y 1 A LYS 695 ? CD ? A LYS 20 CD 17 1 Y 1 A LYS 695 ? CE ? A LYS 20 CE 18 1 Y 1 A LYS 695 ? NZ ? A LYS 20 NZ 19 1 Y 1 A LYS 702 ? CG ? A LYS 27 CG 20 1 Y 1 A LYS 702 ? CD ? A LYS 27 CD 21 1 Y 1 A LYS 702 ? CE ? A LYS 27 CE 22 1 Y 1 A LYS 702 ? NZ ? A LYS 27 NZ 23 1 Y 1 A LYS 713 ? CG ? A LYS 38 CG 24 1 Y 1 A LYS 713 ? CD ? A LYS 38 CD 25 1 Y 1 A LYS 713 ? CE ? A LYS 38 CE 26 1 Y 1 A LYS 713 ? NZ ? A LYS 38 NZ 27 1 Y 1 A LYS 722 ? CG ? A LYS 47 CG 28 1 Y 1 A LYS 722 ? CD ? A LYS 47 CD 29 1 Y 1 A LYS 722 ? CE ? A LYS 47 CE 30 1 Y 1 A LYS 722 ? NZ ? A LYS 47 NZ # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data reduction' ? ? 'Wolfgang Kabsch' Wolfgang.Kabsch@mpimf-heidelberg.mpg.de ? ? ? ? ? http://www.mpimf-heidelberg.mpg.de/~kabsch/xds/ ? XDS ? ? package . 1 ? 'data scaling' ? ? 'Wolfgang Kabsch' ? ? ? ? ? ? http://www.mpimf-heidelberg.mpg.de/~kabsch/xds/html_doc/xscale_program.html ? XSCALE ? ? package . 2 ? phasing ? ? 'Randy J. Read' cimr-phaser@lists.cam.ac.uk 'Thu May 2 19:17:37 2019 (svn 8432) (git 7454, 42cd19d... )' ? ? ? ? http://www-structmed.cimr.cam.ac.uk/phaser/ ? PHASER ? ? program 2.8.3 3 ? refinement ? ? 'Paul D. Adams' PDAdams@lbl.gov ? ? ? ? C++ http://www.phenix-online.org/ ? PHENIX ? ? package 1.16_3549 4 ? 'data extraction' ? ? PDB deposit@deposit.rcsb.org 'Apr. 1, 2019' ? ? ? C++ http://sw-tools.pdb.org/apps/PDB_EXTRACT/ ? PDB_EXTRACT ? ? package 3.25 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 6SXW _cell.details ? _cell.formula_units_Z ? _cell.length_a 57.435 _cell.length_a_esd ? _cell.length_b 57.435 _cell.length_b_esd ? _cell.length_c 46.619 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6SXW _symmetry.cell_setting ? _symmetry.Int_Tables_number 154 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 32 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6SXW _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.63 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 53.21 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1M tris pH 8.5 -- 2.6M ammonium sulfate' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-09-13 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.92 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I04-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.92 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I04-1 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6SXW _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.75 _reflns.d_resolution_low 18.80 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 2464 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.7 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 9.4 _reflns.pdbx_Rmerge_I_obs 0.050 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 20.9 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all 0.018 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 1.000 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.75 _reflns_shell.d_res_low 2.90 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.5 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 343 _reflns_shell.percent_possible_all 100.0 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 1.666 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 9.5 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all 0.569 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.724 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 209.680 _refine.B_iso_mean 108.5176 _refine.B_iso_min 73.230 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6SXW _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.7510 _refine.ls_d_res_low 18.8000 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 2439 _refine.ls_number_reflns_R_free 244 _refine.ls_number_reflns_R_work 2195 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.3100 _refine.ls_percent_reflns_R_free 10.0000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2649 _refine.ls_R_factor_R_free 0.3131 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2595 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.350 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 2CQ1 _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 32.7600 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3500 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.7510 _refine_hist.d_res_low 18.8000 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 570 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 74 _refine_hist.pdbx_B_iso_mean_ligand 139.05 _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 560 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 10 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.7510 3.4620 . . 115 1059 99.0000 . . . 0.3394 0.0000 0.3573 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.4620 18.8000 . . 129 1136 100.0000 . . . 0.3087 0.0000 0.2438 . . . . . . . . . . # _struct.entry_id 6SXW _struct.title 'Crystal structure of the first RRM domain of human Zinc finger protein 638 (ZNF638)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6SXW _struct_keywords.text 'Zinc finger, RNA binding, RRM, TRANSCRIPTION' _struct_keywords.pdbx_keywords TRANSCRIPTION # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ZN638_HUMAN _struct_ref.pdbx_db_accession Q14966 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code SVLLITELPEDGCTEEDVRKLFQPFGKVNDVLIVPYRKEAYLEMEFKEAITAIMKYIETTPLTIKGKSVKICVP _struct_ref.pdbx_align_begin 676 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6SXW _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 74 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q14966 _struct_ref_seq.db_align_beg 676 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 749 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 676 _struct_ref_seq.pdbx_auth_seq_align_end 749 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 320 ? 1 MORE -21 ? 1 'SSA (A^2)' 4680 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 14 ? GLN A 23 ? THR A 689 GLN A 698 1 ? 10 HELX_P HELX_P2 AA2 PRO A 24 ? GLY A 26 ? PRO A 699 GLY A 701 5 ? 3 HELX_P HELX_P3 AA3 PRO A 35 ? ARG A 37 ? PRO A 710 ARG A 712 5 ? 3 HELX_P HELX_P4 AA4 LYS A 47 ? GLU A 58 ? LYS A 722 GLU A 733 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 28 ? VAL A 34 ? VAL A 703 VAL A 709 AA1 2 GLU A 39 ? MET A 44 ? GLU A 714 MET A 719 AA1 3 VAL A 2 ? THR A 6 ? VAL A 677 THR A 681 AA1 4 LYS A 70 ? CYS A 72 ? LYS A 745 CYS A 747 AA2 1 THR A 63 ? ILE A 64 ? THR A 738 ILE A 739 AA2 2 LYS A 67 ? SER A 68 ? LYS A 742 SER A 743 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LEU A 32 ? N LEU A 707 O TYR A 41 ? O TYR A 716 AA1 2 3 O LEU A 42 ? O LEU A 717 N LEU A 3 ? N LEU A 678 AA1 3 4 N LEU A 4 ? N LEU A 679 O CYS A 72 ? O CYS A 747 AA2 1 2 N ILE A 64 ? N ILE A 739 O LYS A 67 ? O LYS A 742 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A SO4 801 ? 2 'binding site for residue SO4 A 801' AC2 Software A SO4 802 ? 3 'binding site for residue SO4 A 802' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 2 PRO A 9 ? PRO A 684 . ? 1_555 ? 2 AC1 2 GLU A 10 ? GLU A 685 . ? 1_555 ? 3 AC2 3 GLY A 26 ? GLY A 701 . ? 1_555 ? 4 AC2 3 LYS A 27 ? LYS A 702 . ? 1_555 ? 5 AC2 3 VAL A 28 ? VAL A 703 . ? 1_555 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 699 ? ? -56.55 -9.42 2 1 ASN A 704 ? ? -97.76 -74.43 # _pdbx_phasing_MR.entry_id 6SXW _pdbx_phasing_MR.method_rotation ? _pdbx_phasing_MR.method_translation ? _pdbx_phasing_MR.model_details 'Phaser MODE: MR_AUTO' _pdbx_phasing_MR.R_factor ? _pdbx_phasing_MR.R_rigid_body ? _pdbx_phasing_MR.correlation_coeff_Fo_to_Fc ? _pdbx_phasing_MR.correlation_coeff_Io_to_Ic ? _pdbx_phasing_MR.d_res_high_rotation 2.750 _pdbx_phasing_MR.d_res_low_rotation 18.800 _pdbx_phasing_MR.d_res_high_translation 2.750 _pdbx_phasing_MR.d_res_low_translation 18.800 _pdbx_phasing_MR.packing ? _pdbx_phasing_MR.reflns_percent_rotation ? _pdbx_phasing_MR.reflns_percent_translation ? _pdbx_phasing_MR.sigma_F_rotation ? _pdbx_phasing_MR.sigma_F_translation ? _pdbx_phasing_MR.sigma_I_rotation ? _pdbx_phasing_MR.sigma_I_translation ? # _phasing.method MR # _pdbx_entry_details.entry_id 6SXW _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 ILE N N N N 137 ILE CA C N S 138 ILE C C N N 139 ILE O O N N 140 ILE CB C N S 141 ILE CG1 C N N 142 ILE CG2 C N N 143 ILE CD1 C N N 144 ILE OXT O N N 145 ILE H H N N 146 ILE H2 H N N 147 ILE HA H N N 148 ILE HB H N N 149 ILE HG12 H N N 150 ILE HG13 H N N 151 ILE HG21 H N N 152 ILE HG22 H N N 153 ILE HG23 H N N 154 ILE HD11 H N N 155 ILE HD12 H N N 156 ILE HD13 H N N 157 ILE HXT H N N 158 LEU N N N N 159 LEU CA C N S 160 LEU C C N N 161 LEU O O N N 162 LEU CB C N N 163 LEU CG C N N 164 LEU CD1 C N N 165 LEU CD2 C N N 166 LEU OXT O N N 167 LEU H H N N 168 LEU H2 H N N 169 LEU HA H N N 170 LEU HB2 H N N 171 LEU HB3 H N N 172 LEU HG H N N 173 LEU HD11 H N N 174 LEU HD12 H N N 175 LEU HD13 H N N 176 LEU HD21 H N N 177 LEU HD22 H N N 178 LEU HD23 H N N 179 LEU HXT H N N 180 LYS N N N N 181 LYS CA C N S 182 LYS C C N N 183 LYS O O N N 184 LYS CB C N N 185 LYS CG C N N 186 LYS CD C N N 187 LYS CE C N N 188 LYS NZ N N N 189 LYS OXT O N N 190 LYS H H N N 191 LYS H2 H N N 192 LYS HA H N N 193 LYS HB2 H N N 194 LYS HB3 H N N 195 LYS HG2 H N N 196 LYS HG3 H N N 197 LYS HD2 H N N 198 LYS HD3 H N N 199 LYS HE2 H N N 200 LYS HE3 H N N 201 LYS HZ1 H N N 202 LYS HZ2 H N N 203 LYS HZ3 H N N 204 LYS HXT H N N 205 MET N N N N 206 MET CA C N S 207 MET C C N N 208 MET O O N N 209 MET CB C N N 210 MET CG C N N 211 MET SD S N N 212 MET CE C N N 213 MET OXT O N N 214 MET H H N N 215 MET H2 H N N 216 MET HA H N N 217 MET HB2 H N N 218 MET HB3 H N N 219 MET HG2 H N N 220 MET HG3 H N N 221 MET HE1 H N N 222 MET HE2 H N N 223 MET HE3 H N N 224 MET HXT H N N 225 PHE N N N N 226 PHE CA C N S 227 PHE C C N N 228 PHE O O N N 229 PHE CB C N N 230 PHE CG C Y N 231 PHE CD1 C Y N 232 PHE CD2 C Y N 233 PHE CE1 C Y N 234 PHE CE2 C Y N 235 PHE CZ C Y N 236 PHE OXT O N N 237 PHE H H N N 238 PHE H2 H N N 239 PHE HA H N N 240 PHE HB2 H N N 241 PHE HB3 H N N 242 PHE HD1 H N N 243 PHE HD2 H N N 244 PHE HE1 H N N 245 PHE HE2 H N N 246 PHE HZ H N N 247 PHE HXT H N N 248 PRO N N N N 249 PRO CA C N S 250 PRO C C N N 251 PRO O O N N 252 PRO CB C N N 253 PRO CG C N N 254 PRO CD C N N 255 PRO OXT O N N 256 PRO H H N N 257 PRO HA H N N 258 PRO HB2 H N N 259 PRO HB3 H N N 260 PRO HG2 H N N 261 PRO HG3 H N N 262 PRO HD2 H N N 263 PRO HD3 H N N 264 PRO HXT H N N 265 SER N N N N 266 SER CA C N S 267 SER C C N N 268 SER O O N N 269 SER CB C N N 270 SER OG O N N 271 SER OXT O N N 272 SER H H N N 273 SER H2 H N N 274 SER HA H N N 275 SER HB2 H N N 276 SER HB3 H N N 277 SER HG H N N 278 SER HXT H N N 279 SO4 S S N N 280 SO4 O1 O N N 281 SO4 O2 O N N 282 SO4 O3 O N N 283 SO4 O4 O N N 284 THR N N N N 285 THR CA C N S 286 THR C C N N 287 THR O O N N 288 THR CB C N R 289 THR OG1 O N N 290 THR CG2 C N N 291 THR OXT O N N 292 THR H H N N 293 THR H2 H N N 294 THR HA H N N 295 THR HB H N N 296 THR HG1 H N N 297 THR HG21 H N N 298 THR HG22 H N N 299 THR HG23 H N N 300 THR HXT H N N 301 TYR N N N N 302 TYR CA C N S 303 TYR C C N N 304 TYR O O N N 305 TYR CB C N N 306 TYR CG C Y N 307 TYR CD1 C Y N 308 TYR CD2 C Y N 309 TYR CE1 C Y N 310 TYR CE2 C Y N 311 TYR CZ C Y N 312 TYR OH O N N 313 TYR OXT O N N 314 TYR H H N N 315 TYR H2 H N N 316 TYR HA H N N 317 TYR HB2 H N N 318 TYR HB3 H N N 319 TYR HD1 H N N 320 TYR HD2 H N N 321 TYR HE1 H N N 322 TYR HE2 H N N 323 TYR HH H N N 324 TYR HXT H N N 325 VAL N N N N 326 VAL CA C N S 327 VAL C C N N 328 VAL O O N N 329 VAL CB C N N 330 VAL CG1 C N N 331 VAL CG2 C N N 332 VAL OXT O N N 333 VAL H H N N 334 VAL H2 H N N 335 VAL HA H N N 336 VAL HB H N N 337 VAL HG11 H N N 338 VAL HG12 H N N 339 VAL HG13 H N N 340 VAL HG21 H N N 341 VAL HG22 H N N 342 VAL HG23 H N N 343 VAL HXT H N N 344 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 ILE N CA sing N N 129 ILE N H sing N N 130 ILE N H2 sing N N 131 ILE CA C sing N N 132 ILE CA CB sing N N 133 ILE CA HA sing N N 134 ILE C O doub N N 135 ILE C OXT sing N N 136 ILE CB CG1 sing N N 137 ILE CB CG2 sing N N 138 ILE CB HB sing N N 139 ILE CG1 CD1 sing N N 140 ILE CG1 HG12 sing N N 141 ILE CG1 HG13 sing N N 142 ILE CG2 HG21 sing N N 143 ILE CG2 HG22 sing N N 144 ILE CG2 HG23 sing N N 145 ILE CD1 HD11 sing N N 146 ILE CD1 HD12 sing N N 147 ILE CD1 HD13 sing N N 148 ILE OXT HXT sing N N 149 LEU N CA sing N N 150 LEU N H sing N N 151 LEU N H2 sing N N 152 LEU CA C sing N N 153 LEU CA CB sing N N 154 LEU CA HA sing N N 155 LEU C O doub N N 156 LEU C OXT sing N N 157 LEU CB CG sing N N 158 LEU CB HB2 sing N N 159 LEU CB HB3 sing N N 160 LEU CG CD1 sing N N 161 LEU CG CD2 sing N N 162 LEU CG HG sing N N 163 LEU CD1 HD11 sing N N 164 LEU CD1 HD12 sing N N 165 LEU CD1 HD13 sing N N 166 LEU CD2 HD21 sing N N 167 LEU CD2 HD22 sing N N 168 LEU CD2 HD23 sing N N 169 LEU OXT HXT sing N N 170 LYS N CA sing N N 171 LYS N H sing N N 172 LYS N H2 sing N N 173 LYS CA C sing N N 174 LYS CA CB sing N N 175 LYS CA HA sing N N 176 LYS C O doub N N 177 LYS C OXT sing N N 178 LYS CB CG sing N N 179 LYS CB HB2 sing N N 180 LYS CB HB3 sing N N 181 LYS CG CD sing N N 182 LYS CG HG2 sing N N 183 LYS CG HG3 sing N N 184 LYS CD CE sing N N 185 LYS CD HD2 sing N N 186 LYS CD HD3 sing N N 187 LYS CE NZ sing N N 188 LYS CE HE2 sing N N 189 LYS CE HE3 sing N N 190 LYS NZ HZ1 sing N N 191 LYS NZ HZ2 sing N N 192 LYS NZ HZ3 sing N N 193 LYS OXT HXT sing N N 194 MET N CA sing N N 195 MET N H sing N N 196 MET N H2 sing N N 197 MET CA C sing N N 198 MET CA CB sing N N 199 MET CA HA sing N N 200 MET C O doub N N 201 MET C OXT sing N N 202 MET CB CG sing N N 203 MET CB HB2 sing N N 204 MET CB HB3 sing N N 205 MET CG SD sing N N 206 MET CG HG2 sing N N 207 MET CG HG3 sing N N 208 MET SD CE sing N N 209 MET CE HE1 sing N N 210 MET CE HE2 sing N N 211 MET CE HE3 sing N N 212 MET OXT HXT sing N N 213 PHE N CA sing N N 214 PHE N H sing N N 215 PHE N H2 sing N N 216 PHE CA C sing N N 217 PHE CA CB sing N N 218 PHE CA HA sing N N 219 PHE C O doub N N 220 PHE C OXT sing N N 221 PHE CB CG sing N N 222 PHE CB HB2 sing N N 223 PHE CB HB3 sing N N 224 PHE CG CD1 doub Y N 225 PHE CG CD2 sing Y N 226 PHE CD1 CE1 sing Y N 227 PHE CD1 HD1 sing N N 228 PHE CD2 CE2 doub Y N 229 PHE CD2 HD2 sing N N 230 PHE CE1 CZ doub Y N 231 PHE CE1 HE1 sing N N 232 PHE CE2 CZ sing Y N 233 PHE CE2 HE2 sing N N 234 PHE CZ HZ sing N N 235 PHE OXT HXT sing N N 236 PRO N CA sing N N 237 PRO N CD sing N N 238 PRO N H sing N N 239 PRO CA C sing N N 240 PRO CA CB sing N N 241 PRO CA HA sing N N 242 PRO C O doub N N 243 PRO C OXT sing N N 244 PRO CB CG sing N N 245 PRO CB HB2 sing N N 246 PRO CB HB3 sing N N 247 PRO CG CD sing N N 248 PRO CG HG2 sing N N 249 PRO CG HG3 sing N N 250 PRO CD HD2 sing N N 251 PRO CD HD3 sing N N 252 PRO OXT HXT sing N N 253 SER N CA sing N N 254 SER N H sing N N 255 SER N H2 sing N N 256 SER CA C sing N N 257 SER CA CB sing N N 258 SER CA HA sing N N 259 SER C O doub N N 260 SER C OXT sing N N 261 SER CB OG sing N N 262 SER CB HB2 sing N N 263 SER CB HB3 sing N N 264 SER OG HG sing N N 265 SER OXT HXT sing N N 266 SO4 S O1 doub N N 267 SO4 S O2 doub N N 268 SO4 S O3 sing N N 269 SO4 S O4 sing N N 270 THR N CA sing N N 271 THR N H sing N N 272 THR N H2 sing N N 273 THR CA C sing N N 274 THR CA CB sing N N 275 THR CA HA sing N N 276 THR C O doub N N 277 THR C OXT sing N N 278 THR CB OG1 sing N N 279 THR CB CG2 sing N N 280 THR CB HB sing N N 281 THR OG1 HG1 sing N N 282 THR CG2 HG21 sing N N 283 THR CG2 HG22 sing N N 284 THR CG2 HG23 sing N N 285 THR OXT HXT sing N N 286 TYR N CA sing N N 287 TYR N H sing N N 288 TYR N H2 sing N N 289 TYR CA C sing N N 290 TYR CA CB sing N N 291 TYR CA HA sing N N 292 TYR C O doub N N 293 TYR C OXT sing N N 294 TYR CB CG sing N N 295 TYR CB HB2 sing N N 296 TYR CB HB3 sing N N 297 TYR CG CD1 doub Y N 298 TYR CG CD2 sing Y N 299 TYR CD1 CE1 sing Y N 300 TYR CD1 HD1 sing N N 301 TYR CD2 CE2 doub Y N 302 TYR CD2 HD2 sing N N 303 TYR CE1 CZ doub Y N 304 TYR CE1 HE1 sing N N 305 TYR CE2 CZ sing Y N 306 TYR CE2 HE2 sing N N 307 TYR CZ OH sing N N 308 TYR OH HH sing N N 309 TYR OXT HXT sing N N 310 VAL N CA sing N N 311 VAL N H sing N N 312 VAL N H2 sing N N 313 VAL CA C sing N N 314 VAL CA CB sing N N 315 VAL CA HA sing N N 316 VAL C O doub N N 317 VAL C OXT sing N N 318 VAL CB CG1 sing N N 319 VAL CB CG2 sing N N 320 VAL CB HB sing N N 321 VAL CG1 HG11 sing N N 322 VAL CG1 HG12 sing N N 323 VAL CG1 HG13 sing N N 324 VAL CG2 HG21 sing N N 325 VAL CG2 HG22 sing N N 326 VAL CG2 HG23 sing N N 327 VAL OXT HXT sing N N 328 # _pdbx_audit_support.funding_organization 'Wellcome Trust' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2CQ1 _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 6SXW _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.017411 _atom_sites.fract_transf_matrix[1][2] 0.010052 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.020104 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.021450 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_ #