data_6SZC # _entry.id 6SZC # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6SZC pdb_00006szc 10.2210/pdb6szc/pdb WWPDB D_1292103448 ? ? BMRB 34439 ? ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'NMR structure of repeat domain 13 of the fibrillar adhesin CshA from Streptococcus gordonii.' _pdbx_database_related.db_id 34439 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 6SZC _pdbx_database_status.recvd_initial_deposition_date 2019-10-02 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Higman, V.A.' 1 0000-0002-3204-2665 'Back, C.' 2 0000-0002-9835-9171 'Crump, M.P.' 3 0000-0002-7868-5818 'Race, P.' 4 0000-0003-0184-5630 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Biol.Chem. _citation.journal_id_ASTM JBCHA3 _citation.journal_id_CSD 0071 _citation.journal_id_ISSN 1083-351X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 295 _citation.language ? _citation.page_first 6689 _citation.page_last 6699 _citation.title 'The streptococcal multidomain fibrillar adhesin CshA has an elongated polymeric architecture.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1074/jbc.RA119.011719 _citation.pdbx_database_id_PubMed 32229583 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Back, C.R.' 1 ? primary 'Higman, V.A.' 2 ? primary 'Le Vay, K.' 3 ? primary 'Patel, V.V.' 4 ? primary 'Parnell, A.E.' 5 ? primary 'Frankel, D.' 6 ? primary 'Jenkinson, H.F.' 7 ? primary 'Burston, S.G.' 8 ? primary 'Crump, M.P.' 9 ? primary 'Nobbs, A.H.' 10 ? primary 'Race, P.R.' 11 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Surface-associated protein CshA' _entity.formula_weight 12480.738 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details 'Sample sequence includes N-terminal His-tag and disordered N-terminal of the polypeptide.' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MAHHHHHHSSGLEVLFQGPTGTGATSTGPQGLPQTGTPTFQGGDPLVPIDETVEPTFEDGSKEKTIPGQGTYTIVPDGTV TFTPDKQFVGKPDPVTVKRVDKNGTPVTATYSPEFTKV ; _entity_poly.pdbx_seq_one_letter_code_can ;MAHHHHHHSSGLEVLFQGPTGTGATSTGPQGLPQTGTPTFQGGDPLVPIDETVEPTFEDGSKEKTIPGQGTYTIVPDGTV TFTPDKQFVGKPDPVTVKRVDKNGTPVTATYSPEFTKV ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 SER n 1 10 SER n 1 11 GLY n 1 12 LEU n 1 13 GLU n 1 14 VAL n 1 15 LEU n 1 16 PHE n 1 17 GLN n 1 18 GLY n 1 19 PRO n 1 20 THR n 1 21 GLY n 1 22 THR n 1 23 GLY n 1 24 ALA n 1 25 THR n 1 26 SER n 1 27 THR n 1 28 GLY n 1 29 PRO n 1 30 GLN n 1 31 GLY n 1 32 LEU n 1 33 PRO n 1 34 GLN n 1 35 THR n 1 36 GLY n 1 37 THR n 1 38 PRO n 1 39 THR n 1 40 PHE n 1 41 GLN n 1 42 GLY n 1 43 GLY n 1 44 ASP n 1 45 PRO n 1 46 LEU n 1 47 VAL n 1 48 PRO n 1 49 ILE n 1 50 ASP n 1 51 GLU n 1 52 THR n 1 53 VAL n 1 54 GLU n 1 55 PRO n 1 56 THR n 1 57 PHE n 1 58 GLU n 1 59 ASP n 1 60 GLY n 1 61 SER n 1 62 LYS n 1 63 GLU n 1 64 LYS n 1 65 THR n 1 66 ILE n 1 67 PRO n 1 68 GLY n 1 69 GLN n 1 70 GLY n 1 71 THR n 1 72 TYR n 1 73 THR n 1 74 ILE n 1 75 VAL n 1 76 PRO n 1 77 ASP n 1 78 GLY n 1 79 THR n 1 80 VAL n 1 81 THR n 1 82 PHE n 1 83 THR n 1 84 PRO n 1 85 ASP n 1 86 LYS n 1 87 GLN n 1 88 PHE n 1 89 VAL n 1 90 GLY n 1 91 LYS n 1 92 PRO n 1 93 ASP n 1 94 PRO n 1 95 VAL n 1 96 THR n 1 97 VAL n 1 98 LYS n 1 99 ARG n 1 100 VAL n 1 101 ASP n 1 102 LYS n 1 103 ASN n 1 104 GLY n 1 105 THR n 1 106 PRO n 1 107 VAL n 1 108 THR n 1 109 ALA n 1 110 THR n 1 111 TYR n 1 112 SER n 1 113 PRO n 1 114 GLU n 1 115 PHE n 1 116 THR n 1 117 LYS n 1 118 VAL n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 118 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'cshA, SGO_0854' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 467705 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pOPINF _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A8AWJ3_STRGC _struct_ref.pdbx_db_accession A8AWJ3 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;PTGTGATSTGPQGLPQTGTPTFQGGDPLVPIDETVEPTFEDGSKEKTIPGQGTYTIVPDGTVTFTPDKQFVGKPDPVTVK RVDKNGTPVTATYSPEFTKV ; _struct_ref.pdbx_align_begin 2031 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6SZC _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 19 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 118 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A8AWJ3 _struct_ref_seq.db_align_beg 2031 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 2130 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2031 _struct_ref_seq.pdbx_auth_seq_align_end 2130 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6SZC MET A 1 ? UNP A8AWJ3 ? ? 'initiating methionine' 2013 1 1 6SZC ALA A 2 ? UNP A8AWJ3 ? ? 'expression tag' 2014 2 1 6SZC HIS A 3 ? UNP A8AWJ3 ? ? 'expression tag' 2015 3 1 6SZC HIS A 4 ? UNP A8AWJ3 ? ? 'expression tag' 2016 4 1 6SZC HIS A 5 ? UNP A8AWJ3 ? ? 'expression tag' 2017 5 1 6SZC HIS A 6 ? UNP A8AWJ3 ? ? 'expression tag' 2018 6 1 6SZC HIS A 7 ? UNP A8AWJ3 ? ? 'expression tag' 2019 7 1 6SZC HIS A 8 ? UNP A8AWJ3 ? ? 'expression tag' 2020 8 1 6SZC SER A 9 ? UNP A8AWJ3 ? ? 'expression tag' 2021 9 1 6SZC SER A 10 ? UNP A8AWJ3 ? ? 'expression tag' 2022 10 1 6SZC GLY A 11 ? UNP A8AWJ3 ? ? 'expression tag' 2023 11 1 6SZC LEU A 12 ? UNP A8AWJ3 ? ? 'expression tag' 2024 12 1 6SZC GLU A 13 ? UNP A8AWJ3 ? ? 'expression tag' 2025 13 1 6SZC VAL A 14 ? UNP A8AWJ3 ? ? 'expression tag' 2026 14 1 6SZC LEU A 15 ? UNP A8AWJ3 ? ? 'expression tag' 2027 15 1 6SZC PHE A 16 ? UNP A8AWJ3 ? ? 'expression tag' 2028 16 1 6SZC GLN A 17 ? UNP A8AWJ3 ? ? 'expression tag' 2029 17 1 6SZC GLY A 18 ? UNP A8AWJ3 ? ? 'expression tag' 2030 18 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 1 isotropic 2 1 2 '3D HNCACB' 1 isotropic 3 1 2 '3D CBCA(CO)NH' 1 isotropic 4 1 2 '3D HNCA' 1 isotropic 5 1 1 '3D HNHA' 1 isotropic 6 1 2 '3D HN(CO)CA' 1 isotropic 7 1 2 '3D HNCO' 1 isotropic 8 1 2 'HN(CA)CO' 1 isotropic 9 1 2 '3D C(CO)NH' 1 isotropic 10 1 2 '3D HCCH-TOCSY' 1 isotropic 11 1 1 '15N TOCSY-HSQC' 1 isotropic 13 1 1 '15N NOESY-HSQC' 1 isotropic 14 1 2 '13C NOESY-HSQC' 1 isotropic 15 1 2 '13C NOESY-HSQC aromatic' 1 isotropic 16 1 2 '15N NOESY-HSQC' 2 isotropic 17 1 2 '13C NOESY-HSQC' 2 isotropic 18 1 3 '2D 1H-15N HSQC' 1 isotropic 19 1 3 '2D 1H-1H TOCSY' 1 isotropic 20 1 3 '2D 1H-1H NOESY' 1 isotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength 70 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label Condition1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 '20 mg/mL [U-15N] CshA_RD13, 50 mM sodium chloride, 20 mM potassium phosphate, 90% H2O/10% D2O' '90% H2O/10% D2O' 15N-CshA_RD13 solution ? 3 '20 mg/mL [U-15N] CshA_RD13, 50 mM sodium chloride, 20 mM potassium phosphate, 100% D2O' '100% D2O' 15N-CshA_RD13-D2O solution ? 2 '20 mg/mL [U-13C; U-15N] CshA_RD13, 50 mM sodium chloride, 20 mM potassium phosphate, 90% H2O/10% D2O' '90% H2O/10% D2O' 15N13C-CshA_RD13 solution ? # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 VNMRS ? Varian 600 'with cryogenic cold probe' 2 INOVA ? Varian 900 'with cryogenic cold probe' # _pdbx_nmr_refine.entry_id 6SZC _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details 'standard ARIA calculation and water refinement protocol' _pdbx_nmr_refine.software_ordinal 2 # _pdbx_nmr_ensemble.entry_id 6SZC _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 15 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 6SZC _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 'chemical shift assignment' 'CcpNmr Analysis' ? CCPN 2 'structure calculation' ARIA ? ;Linge, O'Donoghue and Nilges ; 4 'peak picking' 'CcpNmr Analysis' ? CCPN # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6SZC _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 6SZC _struct.title 'NMR structure of repeat domain 13 of the fibrillar adhesin CshA from Streptococcus gordonii.' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6SZC _struct_keywords.text 'Adhesin, Fibril, Novel, Repeat domain, Streptococcus, cell adhesion' _struct_keywords.pdbx_keywords 'CELL ADHESION' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 3 ? AA2 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PRO A 55 ? PHE A 57 ? PRO A 2067 PHE A 2069 AA1 2 VAL A 95 ? VAL A 100 ? VAL A 2107 VAL A 2112 AA1 3 PRO A 106 ? TYR A 111 ? PRO A 2118 TYR A 2123 AA2 1 GLU A 63 ? ILE A 66 ? GLU A 2075 ILE A 2078 AA2 2 GLY A 70 ? VAL A 75 ? GLY A 2082 VAL A 2087 AA2 3 THR A 79 ? PRO A 84 ? THR A 2091 PRO A 2096 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N THR A 56 ? N THR A 2068 O LYS A 98 ? O LYS A 2110 AA1 2 3 N VAL A 95 ? N VAL A 2107 O TYR A 111 ? O TYR A 2123 AA2 1 2 N ILE A 66 ? N ILE A 2078 O GLY A 70 ? O GLY A 2082 AA2 2 3 N THR A 73 ? N THR A 2085 O THR A 81 ? O THR A 2093 # _atom_sites.entry_id 6SZC _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 2013 ? ? ? A . n A 1 2 ALA 2 2014 ? ? ? A . n A 1 3 HIS 3 2015 ? ? ? A . n A 1 4 HIS 4 2016 ? ? ? A . n A 1 5 HIS 5 2017 ? ? ? A . n A 1 6 HIS 6 2018 ? ? ? A . n A 1 7 HIS 7 2019 ? ? ? A . n A 1 8 HIS 8 2020 ? ? ? A . n A 1 9 SER 9 2021 ? ? ? A . n A 1 10 SER 10 2022 ? ? ? A . n A 1 11 GLY 11 2023 ? ? ? A . n A 1 12 LEU 12 2024 ? ? ? A . n A 1 13 GLU 13 2025 ? ? ? A . n A 1 14 VAL 14 2026 ? ? ? A . n A 1 15 LEU 15 2027 ? ? ? A . n A 1 16 PHE 16 2028 ? ? ? A . n A 1 17 GLN 17 2029 ? ? ? A . n A 1 18 GLY 18 2030 ? ? ? A . n A 1 19 PRO 19 2031 ? ? ? A . n A 1 20 THR 20 2032 ? ? ? A . n A 1 21 GLY 21 2033 ? ? ? A . n A 1 22 THR 22 2034 ? ? ? A . n A 1 23 GLY 23 2035 ? ? ? A . n A 1 24 ALA 24 2036 ? ? ? A . n A 1 25 THR 25 2037 ? ? ? A . n A 1 26 SER 26 2038 ? ? ? A . n A 1 27 THR 27 2039 ? ? ? A . n A 1 28 GLY 28 2040 ? ? ? A . n A 1 29 PRO 29 2041 ? ? ? A . n A 1 30 GLN 30 2042 ? ? ? A . n A 1 31 GLY 31 2043 ? ? ? A . n A 1 32 LEU 32 2044 ? ? ? A . n A 1 33 PRO 33 2045 ? ? ? A . n A 1 34 GLN 34 2046 ? ? ? A . n A 1 35 THR 35 2047 ? ? ? A . n A 1 36 GLY 36 2048 ? ? ? A . n A 1 37 THR 37 2049 ? ? ? A . n A 1 38 PRO 38 2050 ? ? ? A . n A 1 39 THR 39 2051 ? ? ? A . n A 1 40 PHE 40 2052 ? ? ? A . n A 1 41 GLN 41 2053 2053 GLN GLN A . n A 1 42 GLY 42 2054 2054 GLY GLY A . n A 1 43 GLY 43 2055 2055 GLY GLY A . n A 1 44 ASP 44 2056 2056 ASP ASP A . n A 1 45 PRO 45 2057 2057 PRO PRO A . n A 1 46 LEU 46 2058 2058 LEU LEU A . n A 1 47 VAL 47 2059 2059 VAL VAL A . n A 1 48 PRO 48 2060 2060 PRO PRO A . n A 1 49 ILE 49 2061 2061 ILE ILE A . n A 1 50 ASP 50 2062 2062 ASP ASP A . n A 1 51 GLU 51 2063 2063 GLU GLU A . n A 1 52 THR 52 2064 2064 THR THR A . n A 1 53 VAL 53 2065 2065 VAL VAL A . n A 1 54 GLU 54 2066 2066 GLU GLU A . n A 1 55 PRO 55 2067 2067 PRO PRO A . n A 1 56 THR 56 2068 2068 THR THR A . n A 1 57 PHE 57 2069 2069 PHE PHE A . n A 1 58 GLU 58 2070 2070 GLU GLU A . n A 1 59 ASP 59 2071 2071 ASP ASP A . n A 1 60 GLY 60 2072 2072 GLY GLY A . n A 1 61 SER 61 2073 2073 SER SER A . n A 1 62 LYS 62 2074 2074 LYS LYS A . n A 1 63 GLU 63 2075 2075 GLU GLU A . n A 1 64 LYS 64 2076 2076 LYS LYS A . n A 1 65 THR 65 2077 2077 THR THR A . n A 1 66 ILE 66 2078 2078 ILE ILE A . n A 1 67 PRO 67 2079 2079 PRO PRO A . n A 1 68 GLY 68 2080 2080 GLY GLY A . n A 1 69 GLN 69 2081 2081 GLN GLN A . n A 1 70 GLY 70 2082 2082 GLY GLY A . n A 1 71 THR 71 2083 2083 THR THR A . n A 1 72 TYR 72 2084 2084 TYR TYR A . n A 1 73 THR 73 2085 2085 THR THR A . n A 1 74 ILE 74 2086 2086 ILE ILE A . n A 1 75 VAL 75 2087 2087 VAL VAL A . n A 1 76 PRO 76 2088 2088 PRO PRO A . n A 1 77 ASP 77 2089 2089 ASP ASP A . n A 1 78 GLY 78 2090 2090 GLY GLY A . n A 1 79 THR 79 2091 2091 THR THR A . n A 1 80 VAL 80 2092 2092 VAL VAL A . n A 1 81 THR 81 2093 2093 THR THR A . n A 1 82 PHE 82 2094 2094 PHE PHE A . n A 1 83 THR 83 2095 2095 THR THR A . n A 1 84 PRO 84 2096 2096 PRO PRO A . n A 1 85 ASP 85 2097 2097 ASP ASP A . n A 1 86 LYS 86 2098 2098 LYS LYS A . n A 1 87 GLN 87 2099 2099 GLN GLN A . n A 1 88 PHE 88 2100 2100 PHE PHE A . n A 1 89 VAL 89 2101 2101 VAL VAL A . n A 1 90 GLY 90 2102 2102 GLY GLY A . n A 1 91 LYS 91 2103 2103 LYS LYS A . n A 1 92 PRO 92 2104 2104 PRO PRO A . n A 1 93 ASP 93 2105 2105 ASP ASP A . n A 1 94 PRO 94 2106 2106 PRO PRO A . n A 1 95 VAL 95 2107 2107 VAL VAL A . n A 1 96 THR 96 2108 2108 THR THR A . n A 1 97 VAL 97 2109 2109 VAL VAL A . n A 1 98 LYS 98 2110 2110 LYS LYS A . n A 1 99 ARG 99 2111 2111 ARG ARG A . n A 1 100 VAL 100 2112 2112 VAL VAL A . n A 1 101 ASP 101 2113 2113 ASP ASP A . n A 1 102 LYS 102 2114 2114 LYS LYS A . n A 1 103 ASN 103 2115 2115 ASN ASN A . n A 1 104 GLY 104 2116 2116 GLY GLY A . n A 1 105 THR 105 2117 2117 THR THR A . n A 1 106 PRO 106 2118 2118 PRO PRO A . n A 1 107 VAL 107 2119 2119 VAL VAL A . n A 1 108 THR 108 2120 2120 THR THR A . n A 1 109 ALA 109 2121 2121 ALA ALA A . n A 1 110 THR 110 2122 2122 THR THR A . n A 1 111 TYR 111 2123 2123 TYR TYR A . n A 1 112 SER 112 2124 2124 SER SER A . n A 1 113 PRO 113 2125 2125 PRO PRO A . n A 1 114 GLU 114 2126 2126 GLU GLU A . n A 1 115 PHE 115 2127 2127 PHE PHE A . n A 1 116 THR 116 2128 2128 THR THR A . n A 1 117 LYS 117 2129 2129 LYS LYS A . n A 1 118 VAL 118 2130 2130 VAL VAL A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 4830 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-04-08 2 'Structure model' 1 1 2020-05-20 3 'Structure model' 1 2 2022-03-30 4 'Structure model' 1 3 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Author supporting evidence' 3 3 'Structure model' 'Database references' 4 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' database_2 4 3 'Structure model' pdbx_audit_support 5 4 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation_author.identifier_ORCID' 5 2 'Structure model' '_citation_author.name' 6 3 'Structure model' '_database_2.pdbx_DOI' 7 3 'Structure model' '_database_2.pdbx_database_accession' 8 3 'Structure model' '_pdbx_audit_support.funding_organization' 9 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 CshA_RD13 20 ? mg/mL '[U-15N]' 1 'sodium chloride' 50 ? mM 'natural abundance' 1 'potassium phosphate' 20 ? mM 'natural abundance' 3 CshA_RD13 20 ? mg/mL '[U-15N]' 3 'sodium chloride' 50 ? mM 'natural abundance' 3 'potassium phosphate' 20 ? mM 'natural abundance' 2 CshA_RD13 20 ? mg/mL '[U-13C; U-15N]' 2 'sodium chloride' 50 ? mM 'natural abundance' 2 'potassium phosphate' 20 ? mM 'natural abundance' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OD1 A ASP 2062 ? ? HG1 A THR 2064 ? ? 1.60 2 2 HZ1 A LYS 2076 ? ? OD1 A ASP 2105 ? ? 1.60 3 3 OD2 A ASP 2062 ? ? HG1 A THR 2064 ? ? 1.58 4 5 OD1 A ASP 2062 ? ? HG1 A THR 2064 ? ? 1.56 5 6 OD2 A ASP 2062 ? ? HG1 A THR 2064 ? ? 1.58 6 8 OD1 A ASP 2097 ? ? HH A TYR 2123 ? ? 1.60 7 9 OD2 A ASP 2062 ? ? HG1 A THR 2064 ? ? 1.57 8 11 OD2 A ASP 2062 ? ? HG1 A THR 2064 ? ? 1.57 9 12 OD1 A ASP 2062 ? ? HG1 A THR 2064 ? ? 1.56 10 13 OD2 A ASP 2062 ? ? HG1 A THR 2064 ? ? 1.60 11 15 OD1 A ASP 2062 ? ? HG1 A THR 2064 ? ? 1.56 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 2079 ? ? -47.27 108.69 2 1 PRO A 2088 ? ? -56.99 -4.08 3 1 PRO A 2106 ? ? -56.34 102.68 4 1 PRO A 2125 ? ? -58.50 -6.09 5 1 THR A 2128 ? ? -117.82 -81.11 6 2 LYS A 2129 ? ? -178.24 40.49 7 3 PRO A 2079 ? ? -51.73 107.86 8 3 ASP A 2113 ? ? -110.01 -169.13 9 3 LYS A 2129 ? ? -126.64 -165.27 10 4 PRO A 2079 ? ? -47.14 109.67 11 4 PRO A 2088 ? ? -62.18 0.01 12 4 VAL A 2107 ? ? -160.66 119.87 13 4 PRO A 2125 ? ? -69.17 52.11 14 4 THR A 2128 ? ? -75.57 -168.57 15 5 PRO A 2079 ? ? -51.36 109.99 16 5 PRO A 2088 ? ? -61.99 0.52 17 5 LYS A 2103 ? ? 60.45 83.49 18 5 PRO A 2106 ? ? -64.10 95.85 19 5 THR A 2128 ? ? 50.29 -149.82 20 5 LYS A 2129 ? ? 74.13 -172.94 21 6 PRO A 2079 ? ? -52.29 109.48 22 6 PRO A 2088 ? ? -55.76 -6.27 23 6 PHE A 2127 ? ? 63.51 -94.62 24 7 PRO A 2079 ? ? -41.91 108.66 25 7 PRO A 2088 ? ? -59.04 -6.42 26 7 GLN A 2099 ? ? -120.64 -52.55 27 7 PRO A 2125 ? ? -75.13 21.13 28 7 THR A 2128 ? ? -103.59 -81.08 29 7 LYS A 2129 ? ? 178.16 -176.40 30 8 PRO A 2088 ? ? -60.00 -1.28 31 8 ASP A 2097 ? ? -72.46 48.31 32 8 THR A 2128 ? ? -135.22 -73.71 33 9 PRO A 2079 ? ? -53.76 108.90 34 9 PRO A 2088 ? ? -58.94 -3.90 35 9 PHE A 2100 ? ? 65.10 72.20 36 9 LYS A 2103 ? ? 55.87 72.56 37 9 GLU A 2126 ? ? 58.70 87.53 38 9 LYS A 2129 ? ? -84.67 47.55 39 10 PRO A 2060 ? ? -38.66 119.71 40 10 PRO A 2079 ? ? -47.84 109.52 41 10 THR A 2128 ? ? 70.55 144.46 42 11 PRO A 2088 ? ? -62.38 0.69 43 11 LYS A 2103 ? ? 68.69 159.33 44 11 PRO A 2125 ? ? -55.86 97.93 45 11 GLU A 2126 ? ? -161.59 -56.03 46 11 THR A 2128 ? ? 74.53 -56.74 47 12 PRO A 2088 ? ? -61.67 0.17 48 12 GLU A 2126 ? ? -124.63 -145.92 49 12 PHE A 2127 ? ? 59.52 83.36 50 13 PRO A 2079 ? ? -51.04 108.97 51 13 PRO A 2088 ? ? -61.18 0.24 52 14 PRO A 2079 ? ? -47.41 109.40 53 14 PRO A 2088 ? ? -59.76 -5.33 54 14 LYS A 2103 ? ? 59.27 73.76 55 14 ARG A 2111 ? ? -175.38 142.76 56 14 THR A 2128 ? ? 55.53 105.24 57 15 PRO A 2079 ? ? -47.11 109.87 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 2013 ? A MET 1 2 1 Y 1 A ALA 2014 ? A ALA 2 3 1 Y 1 A HIS 2015 ? A HIS 3 4 1 Y 1 A HIS 2016 ? A HIS 4 5 1 Y 1 A HIS 2017 ? A HIS 5 6 1 Y 1 A HIS 2018 ? A HIS 6 7 1 Y 1 A HIS 2019 ? A HIS 7 8 1 Y 1 A HIS 2020 ? A HIS 8 9 1 Y 1 A SER 2021 ? A SER 9 10 1 Y 1 A SER 2022 ? A SER 10 11 1 Y 1 A GLY 2023 ? A GLY 11 12 1 Y 1 A LEU 2024 ? A LEU 12 13 1 Y 1 A GLU 2025 ? A GLU 13 14 1 Y 1 A VAL 2026 ? A VAL 14 15 1 Y 1 A LEU 2027 ? A LEU 15 16 1 Y 1 A PHE 2028 ? A PHE 16 17 1 Y 1 A GLN 2029 ? A GLN 17 18 1 Y 1 A GLY 2030 ? A GLY 18 19 1 Y 1 A PRO 2031 ? A PRO 19 20 1 Y 1 A THR 2032 ? A THR 20 21 1 Y 1 A GLY 2033 ? A GLY 21 22 1 Y 1 A THR 2034 ? A THR 22 23 1 Y 1 A GLY 2035 ? A GLY 23 24 1 Y 1 A ALA 2036 ? A ALA 24 25 1 Y 1 A THR 2037 ? A THR 25 26 1 Y 1 A SER 2038 ? A SER 26 27 1 Y 1 A THR 2039 ? A THR 27 28 1 Y 1 A GLY 2040 ? A GLY 28 29 1 Y 1 A PRO 2041 ? A PRO 29 30 1 Y 1 A GLN 2042 ? A GLN 30 31 1 Y 1 A GLY 2043 ? A GLY 31 32 1 Y 1 A LEU 2044 ? A LEU 32 33 1 Y 1 A PRO 2045 ? A PRO 33 34 1 Y 1 A GLN 2046 ? A GLN 34 35 1 Y 1 A THR 2047 ? A THR 35 36 1 Y 1 A GLY 2048 ? A GLY 36 37 1 Y 1 A THR 2049 ? A THR 37 38 1 Y 1 A PRO 2050 ? A PRO 38 39 1 Y 1 A THR 2051 ? A THR 39 40 1 Y 1 A PHE 2052 ? A PHE 40 41 2 Y 1 A MET 2013 ? A MET 1 42 2 Y 1 A ALA 2014 ? A ALA 2 43 2 Y 1 A HIS 2015 ? A HIS 3 44 2 Y 1 A HIS 2016 ? A HIS 4 45 2 Y 1 A HIS 2017 ? A HIS 5 46 2 Y 1 A HIS 2018 ? A HIS 6 47 2 Y 1 A HIS 2019 ? A HIS 7 48 2 Y 1 A HIS 2020 ? A HIS 8 49 2 Y 1 A SER 2021 ? A SER 9 50 2 Y 1 A SER 2022 ? A SER 10 51 2 Y 1 A GLY 2023 ? A GLY 11 52 2 Y 1 A LEU 2024 ? A LEU 12 53 2 Y 1 A GLU 2025 ? A GLU 13 54 2 Y 1 A VAL 2026 ? A VAL 14 55 2 Y 1 A LEU 2027 ? A LEU 15 56 2 Y 1 A PHE 2028 ? A PHE 16 57 2 Y 1 A GLN 2029 ? A GLN 17 58 2 Y 1 A GLY 2030 ? A GLY 18 59 2 Y 1 A PRO 2031 ? A PRO 19 60 2 Y 1 A THR 2032 ? A THR 20 61 2 Y 1 A GLY 2033 ? A GLY 21 62 2 Y 1 A THR 2034 ? A THR 22 63 2 Y 1 A GLY 2035 ? A GLY 23 64 2 Y 1 A ALA 2036 ? A ALA 24 65 2 Y 1 A THR 2037 ? A THR 25 66 2 Y 1 A SER 2038 ? A SER 26 67 2 Y 1 A THR 2039 ? A THR 27 68 2 Y 1 A GLY 2040 ? A GLY 28 69 2 Y 1 A PRO 2041 ? A PRO 29 70 2 Y 1 A GLN 2042 ? A GLN 30 71 2 Y 1 A GLY 2043 ? A GLY 31 72 2 Y 1 A LEU 2044 ? A LEU 32 73 2 Y 1 A PRO 2045 ? A PRO 33 74 2 Y 1 A GLN 2046 ? A GLN 34 75 2 Y 1 A THR 2047 ? A THR 35 76 2 Y 1 A GLY 2048 ? A GLY 36 77 2 Y 1 A THR 2049 ? A THR 37 78 2 Y 1 A PRO 2050 ? A PRO 38 79 2 Y 1 A THR 2051 ? A THR 39 80 2 Y 1 A PHE 2052 ? A PHE 40 81 3 Y 1 A MET 2013 ? A MET 1 82 3 Y 1 A ALA 2014 ? A ALA 2 83 3 Y 1 A HIS 2015 ? A HIS 3 84 3 Y 1 A HIS 2016 ? A HIS 4 85 3 Y 1 A HIS 2017 ? A HIS 5 86 3 Y 1 A HIS 2018 ? A HIS 6 87 3 Y 1 A HIS 2019 ? A HIS 7 88 3 Y 1 A HIS 2020 ? A HIS 8 89 3 Y 1 A SER 2021 ? A SER 9 90 3 Y 1 A SER 2022 ? A SER 10 91 3 Y 1 A GLY 2023 ? A GLY 11 92 3 Y 1 A LEU 2024 ? A LEU 12 93 3 Y 1 A GLU 2025 ? A GLU 13 94 3 Y 1 A VAL 2026 ? A VAL 14 95 3 Y 1 A LEU 2027 ? A LEU 15 96 3 Y 1 A PHE 2028 ? A PHE 16 97 3 Y 1 A GLN 2029 ? A GLN 17 98 3 Y 1 A GLY 2030 ? A GLY 18 99 3 Y 1 A PRO 2031 ? A PRO 19 100 3 Y 1 A THR 2032 ? A THR 20 101 3 Y 1 A GLY 2033 ? A GLY 21 102 3 Y 1 A THR 2034 ? A THR 22 103 3 Y 1 A GLY 2035 ? A GLY 23 104 3 Y 1 A ALA 2036 ? A ALA 24 105 3 Y 1 A THR 2037 ? A THR 25 106 3 Y 1 A SER 2038 ? A SER 26 107 3 Y 1 A THR 2039 ? A THR 27 108 3 Y 1 A GLY 2040 ? A GLY 28 109 3 Y 1 A PRO 2041 ? A PRO 29 110 3 Y 1 A GLN 2042 ? A GLN 30 111 3 Y 1 A GLY 2043 ? A GLY 31 112 3 Y 1 A LEU 2044 ? A LEU 32 113 3 Y 1 A PRO 2045 ? A PRO 33 114 3 Y 1 A GLN 2046 ? A GLN 34 115 3 Y 1 A THR 2047 ? A THR 35 116 3 Y 1 A GLY 2048 ? A GLY 36 117 3 Y 1 A THR 2049 ? A THR 37 118 3 Y 1 A PRO 2050 ? A PRO 38 119 3 Y 1 A THR 2051 ? A THR 39 120 3 Y 1 A PHE 2052 ? A PHE 40 121 4 Y 1 A MET 2013 ? A MET 1 122 4 Y 1 A ALA 2014 ? A ALA 2 123 4 Y 1 A HIS 2015 ? A HIS 3 124 4 Y 1 A HIS 2016 ? A HIS 4 125 4 Y 1 A HIS 2017 ? A HIS 5 126 4 Y 1 A HIS 2018 ? A HIS 6 127 4 Y 1 A HIS 2019 ? A HIS 7 128 4 Y 1 A HIS 2020 ? A HIS 8 129 4 Y 1 A SER 2021 ? A SER 9 130 4 Y 1 A SER 2022 ? A SER 10 131 4 Y 1 A GLY 2023 ? A GLY 11 132 4 Y 1 A LEU 2024 ? A LEU 12 133 4 Y 1 A GLU 2025 ? A GLU 13 134 4 Y 1 A VAL 2026 ? A VAL 14 135 4 Y 1 A LEU 2027 ? A LEU 15 136 4 Y 1 A PHE 2028 ? A PHE 16 137 4 Y 1 A GLN 2029 ? A GLN 17 138 4 Y 1 A GLY 2030 ? A GLY 18 139 4 Y 1 A PRO 2031 ? A PRO 19 140 4 Y 1 A THR 2032 ? A THR 20 141 4 Y 1 A GLY 2033 ? A GLY 21 142 4 Y 1 A THR 2034 ? A THR 22 143 4 Y 1 A GLY 2035 ? A GLY 23 144 4 Y 1 A ALA 2036 ? A ALA 24 145 4 Y 1 A THR 2037 ? A THR 25 146 4 Y 1 A SER 2038 ? A SER 26 147 4 Y 1 A THR 2039 ? A THR 27 148 4 Y 1 A GLY 2040 ? A GLY 28 149 4 Y 1 A PRO 2041 ? A PRO 29 150 4 Y 1 A GLN 2042 ? A GLN 30 151 4 Y 1 A GLY 2043 ? A GLY 31 152 4 Y 1 A LEU 2044 ? A LEU 32 153 4 Y 1 A PRO 2045 ? A PRO 33 154 4 Y 1 A GLN 2046 ? A GLN 34 155 4 Y 1 A THR 2047 ? A THR 35 156 4 Y 1 A GLY 2048 ? A GLY 36 157 4 Y 1 A THR 2049 ? A THR 37 158 4 Y 1 A PRO 2050 ? A PRO 38 159 4 Y 1 A THR 2051 ? A THR 39 160 4 Y 1 A PHE 2052 ? A PHE 40 161 5 Y 1 A MET 2013 ? A MET 1 162 5 Y 1 A ALA 2014 ? A ALA 2 163 5 Y 1 A HIS 2015 ? A HIS 3 164 5 Y 1 A HIS 2016 ? A HIS 4 165 5 Y 1 A HIS 2017 ? A HIS 5 166 5 Y 1 A HIS 2018 ? A HIS 6 167 5 Y 1 A HIS 2019 ? A HIS 7 168 5 Y 1 A HIS 2020 ? A HIS 8 169 5 Y 1 A SER 2021 ? A SER 9 170 5 Y 1 A SER 2022 ? A SER 10 171 5 Y 1 A GLY 2023 ? A GLY 11 172 5 Y 1 A LEU 2024 ? A LEU 12 173 5 Y 1 A GLU 2025 ? A GLU 13 174 5 Y 1 A VAL 2026 ? A VAL 14 175 5 Y 1 A LEU 2027 ? A LEU 15 176 5 Y 1 A PHE 2028 ? A PHE 16 177 5 Y 1 A GLN 2029 ? A GLN 17 178 5 Y 1 A GLY 2030 ? A GLY 18 179 5 Y 1 A PRO 2031 ? A PRO 19 180 5 Y 1 A THR 2032 ? A THR 20 181 5 Y 1 A GLY 2033 ? A GLY 21 182 5 Y 1 A THR 2034 ? A THR 22 183 5 Y 1 A GLY 2035 ? A GLY 23 184 5 Y 1 A ALA 2036 ? A ALA 24 185 5 Y 1 A THR 2037 ? A THR 25 186 5 Y 1 A SER 2038 ? A SER 26 187 5 Y 1 A THR 2039 ? A THR 27 188 5 Y 1 A GLY 2040 ? A GLY 28 189 5 Y 1 A PRO 2041 ? A PRO 29 190 5 Y 1 A GLN 2042 ? A GLN 30 191 5 Y 1 A GLY 2043 ? A GLY 31 192 5 Y 1 A LEU 2044 ? A LEU 32 193 5 Y 1 A PRO 2045 ? A PRO 33 194 5 Y 1 A GLN 2046 ? A GLN 34 195 5 Y 1 A THR 2047 ? A THR 35 196 5 Y 1 A GLY 2048 ? A GLY 36 197 5 Y 1 A THR 2049 ? A THR 37 198 5 Y 1 A PRO 2050 ? A PRO 38 199 5 Y 1 A THR 2051 ? A THR 39 200 5 Y 1 A PHE 2052 ? A PHE 40 201 6 Y 1 A MET 2013 ? A MET 1 202 6 Y 1 A ALA 2014 ? A ALA 2 203 6 Y 1 A HIS 2015 ? A HIS 3 204 6 Y 1 A HIS 2016 ? A HIS 4 205 6 Y 1 A HIS 2017 ? A HIS 5 206 6 Y 1 A HIS 2018 ? A HIS 6 207 6 Y 1 A HIS 2019 ? A HIS 7 208 6 Y 1 A HIS 2020 ? A HIS 8 209 6 Y 1 A SER 2021 ? A SER 9 210 6 Y 1 A SER 2022 ? A SER 10 211 6 Y 1 A GLY 2023 ? A GLY 11 212 6 Y 1 A LEU 2024 ? A LEU 12 213 6 Y 1 A GLU 2025 ? A GLU 13 214 6 Y 1 A VAL 2026 ? A VAL 14 215 6 Y 1 A LEU 2027 ? A LEU 15 216 6 Y 1 A PHE 2028 ? A PHE 16 217 6 Y 1 A GLN 2029 ? A GLN 17 218 6 Y 1 A GLY 2030 ? A GLY 18 219 6 Y 1 A PRO 2031 ? A PRO 19 220 6 Y 1 A THR 2032 ? A THR 20 221 6 Y 1 A GLY 2033 ? A GLY 21 222 6 Y 1 A THR 2034 ? A THR 22 223 6 Y 1 A GLY 2035 ? A GLY 23 224 6 Y 1 A ALA 2036 ? A ALA 24 225 6 Y 1 A THR 2037 ? A THR 25 226 6 Y 1 A SER 2038 ? A SER 26 227 6 Y 1 A THR 2039 ? A THR 27 228 6 Y 1 A GLY 2040 ? A GLY 28 229 6 Y 1 A PRO 2041 ? A PRO 29 230 6 Y 1 A GLN 2042 ? A GLN 30 231 6 Y 1 A GLY 2043 ? A GLY 31 232 6 Y 1 A LEU 2044 ? A LEU 32 233 6 Y 1 A PRO 2045 ? A PRO 33 234 6 Y 1 A GLN 2046 ? A GLN 34 235 6 Y 1 A THR 2047 ? A THR 35 236 6 Y 1 A GLY 2048 ? A GLY 36 237 6 Y 1 A THR 2049 ? A THR 37 238 6 Y 1 A PRO 2050 ? A PRO 38 239 6 Y 1 A THR 2051 ? A THR 39 240 6 Y 1 A PHE 2052 ? A PHE 40 241 7 Y 1 A MET 2013 ? A MET 1 242 7 Y 1 A ALA 2014 ? A ALA 2 243 7 Y 1 A HIS 2015 ? A HIS 3 244 7 Y 1 A HIS 2016 ? A HIS 4 245 7 Y 1 A HIS 2017 ? A HIS 5 246 7 Y 1 A HIS 2018 ? A HIS 6 247 7 Y 1 A HIS 2019 ? A HIS 7 248 7 Y 1 A HIS 2020 ? A HIS 8 249 7 Y 1 A SER 2021 ? A SER 9 250 7 Y 1 A SER 2022 ? A SER 10 251 7 Y 1 A GLY 2023 ? A GLY 11 252 7 Y 1 A LEU 2024 ? A LEU 12 253 7 Y 1 A GLU 2025 ? A GLU 13 254 7 Y 1 A VAL 2026 ? A VAL 14 255 7 Y 1 A LEU 2027 ? A LEU 15 256 7 Y 1 A PHE 2028 ? A PHE 16 257 7 Y 1 A GLN 2029 ? A GLN 17 258 7 Y 1 A GLY 2030 ? A GLY 18 259 7 Y 1 A PRO 2031 ? A PRO 19 260 7 Y 1 A THR 2032 ? A THR 20 261 7 Y 1 A GLY 2033 ? A GLY 21 262 7 Y 1 A THR 2034 ? A THR 22 263 7 Y 1 A GLY 2035 ? A GLY 23 264 7 Y 1 A ALA 2036 ? A ALA 24 265 7 Y 1 A THR 2037 ? A THR 25 266 7 Y 1 A SER 2038 ? A SER 26 267 7 Y 1 A THR 2039 ? A THR 27 268 7 Y 1 A GLY 2040 ? A GLY 28 269 7 Y 1 A PRO 2041 ? A PRO 29 270 7 Y 1 A GLN 2042 ? A GLN 30 271 7 Y 1 A GLY 2043 ? A GLY 31 272 7 Y 1 A LEU 2044 ? A LEU 32 273 7 Y 1 A PRO 2045 ? A PRO 33 274 7 Y 1 A GLN 2046 ? A GLN 34 275 7 Y 1 A THR 2047 ? A THR 35 276 7 Y 1 A GLY 2048 ? A GLY 36 277 7 Y 1 A THR 2049 ? A THR 37 278 7 Y 1 A PRO 2050 ? A PRO 38 279 7 Y 1 A THR 2051 ? A THR 39 280 7 Y 1 A PHE 2052 ? A PHE 40 281 8 Y 1 A MET 2013 ? A MET 1 282 8 Y 1 A ALA 2014 ? A ALA 2 283 8 Y 1 A HIS 2015 ? A HIS 3 284 8 Y 1 A HIS 2016 ? A HIS 4 285 8 Y 1 A HIS 2017 ? A HIS 5 286 8 Y 1 A HIS 2018 ? A HIS 6 287 8 Y 1 A HIS 2019 ? A HIS 7 288 8 Y 1 A HIS 2020 ? A HIS 8 289 8 Y 1 A SER 2021 ? A SER 9 290 8 Y 1 A SER 2022 ? A SER 10 291 8 Y 1 A GLY 2023 ? A GLY 11 292 8 Y 1 A LEU 2024 ? A LEU 12 293 8 Y 1 A GLU 2025 ? A GLU 13 294 8 Y 1 A VAL 2026 ? A VAL 14 295 8 Y 1 A LEU 2027 ? A LEU 15 296 8 Y 1 A PHE 2028 ? A PHE 16 297 8 Y 1 A GLN 2029 ? A GLN 17 298 8 Y 1 A GLY 2030 ? A GLY 18 299 8 Y 1 A PRO 2031 ? A PRO 19 300 8 Y 1 A THR 2032 ? A THR 20 301 8 Y 1 A GLY 2033 ? A GLY 21 302 8 Y 1 A THR 2034 ? A THR 22 303 8 Y 1 A GLY 2035 ? A GLY 23 304 8 Y 1 A ALA 2036 ? A ALA 24 305 8 Y 1 A THR 2037 ? A THR 25 306 8 Y 1 A SER 2038 ? A SER 26 307 8 Y 1 A THR 2039 ? A THR 27 308 8 Y 1 A GLY 2040 ? A GLY 28 309 8 Y 1 A PRO 2041 ? A PRO 29 310 8 Y 1 A GLN 2042 ? A GLN 30 311 8 Y 1 A GLY 2043 ? A GLY 31 312 8 Y 1 A LEU 2044 ? A LEU 32 313 8 Y 1 A PRO 2045 ? A PRO 33 314 8 Y 1 A GLN 2046 ? A GLN 34 315 8 Y 1 A THR 2047 ? A THR 35 316 8 Y 1 A GLY 2048 ? A GLY 36 317 8 Y 1 A THR 2049 ? A THR 37 318 8 Y 1 A PRO 2050 ? A PRO 38 319 8 Y 1 A THR 2051 ? A THR 39 320 8 Y 1 A PHE 2052 ? A PHE 40 321 9 Y 1 A MET 2013 ? A MET 1 322 9 Y 1 A ALA 2014 ? A ALA 2 323 9 Y 1 A HIS 2015 ? A HIS 3 324 9 Y 1 A HIS 2016 ? A HIS 4 325 9 Y 1 A HIS 2017 ? A HIS 5 326 9 Y 1 A HIS 2018 ? A HIS 6 327 9 Y 1 A HIS 2019 ? A HIS 7 328 9 Y 1 A HIS 2020 ? A HIS 8 329 9 Y 1 A SER 2021 ? A SER 9 330 9 Y 1 A SER 2022 ? A SER 10 331 9 Y 1 A GLY 2023 ? A GLY 11 332 9 Y 1 A LEU 2024 ? A LEU 12 333 9 Y 1 A GLU 2025 ? A GLU 13 334 9 Y 1 A VAL 2026 ? A VAL 14 335 9 Y 1 A LEU 2027 ? A LEU 15 336 9 Y 1 A PHE 2028 ? A PHE 16 337 9 Y 1 A GLN 2029 ? A GLN 17 338 9 Y 1 A GLY 2030 ? A GLY 18 339 9 Y 1 A PRO 2031 ? A PRO 19 340 9 Y 1 A THR 2032 ? A THR 20 341 9 Y 1 A GLY 2033 ? A GLY 21 342 9 Y 1 A THR 2034 ? A THR 22 343 9 Y 1 A GLY 2035 ? A GLY 23 344 9 Y 1 A ALA 2036 ? A ALA 24 345 9 Y 1 A THR 2037 ? A THR 25 346 9 Y 1 A SER 2038 ? A SER 26 347 9 Y 1 A THR 2039 ? A THR 27 348 9 Y 1 A GLY 2040 ? A GLY 28 349 9 Y 1 A PRO 2041 ? A PRO 29 350 9 Y 1 A GLN 2042 ? A GLN 30 351 9 Y 1 A GLY 2043 ? A GLY 31 352 9 Y 1 A LEU 2044 ? A LEU 32 353 9 Y 1 A PRO 2045 ? A PRO 33 354 9 Y 1 A GLN 2046 ? A GLN 34 355 9 Y 1 A THR 2047 ? A THR 35 356 9 Y 1 A GLY 2048 ? A GLY 36 357 9 Y 1 A THR 2049 ? A THR 37 358 9 Y 1 A PRO 2050 ? A PRO 38 359 9 Y 1 A THR 2051 ? A THR 39 360 9 Y 1 A PHE 2052 ? A PHE 40 361 10 Y 1 A MET 2013 ? A MET 1 362 10 Y 1 A ALA 2014 ? A ALA 2 363 10 Y 1 A HIS 2015 ? A HIS 3 364 10 Y 1 A HIS 2016 ? A HIS 4 365 10 Y 1 A HIS 2017 ? A HIS 5 366 10 Y 1 A HIS 2018 ? A HIS 6 367 10 Y 1 A HIS 2019 ? A HIS 7 368 10 Y 1 A HIS 2020 ? A HIS 8 369 10 Y 1 A SER 2021 ? A SER 9 370 10 Y 1 A SER 2022 ? A SER 10 371 10 Y 1 A GLY 2023 ? A GLY 11 372 10 Y 1 A LEU 2024 ? A LEU 12 373 10 Y 1 A GLU 2025 ? A GLU 13 374 10 Y 1 A VAL 2026 ? A VAL 14 375 10 Y 1 A LEU 2027 ? A LEU 15 376 10 Y 1 A PHE 2028 ? A PHE 16 377 10 Y 1 A GLN 2029 ? A GLN 17 378 10 Y 1 A GLY 2030 ? A GLY 18 379 10 Y 1 A PRO 2031 ? A PRO 19 380 10 Y 1 A THR 2032 ? A THR 20 381 10 Y 1 A GLY 2033 ? A GLY 21 382 10 Y 1 A THR 2034 ? A THR 22 383 10 Y 1 A GLY 2035 ? A GLY 23 384 10 Y 1 A ALA 2036 ? A ALA 24 385 10 Y 1 A THR 2037 ? A THR 25 386 10 Y 1 A SER 2038 ? A SER 26 387 10 Y 1 A THR 2039 ? A THR 27 388 10 Y 1 A GLY 2040 ? A GLY 28 389 10 Y 1 A PRO 2041 ? A PRO 29 390 10 Y 1 A GLN 2042 ? A GLN 30 391 10 Y 1 A GLY 2043 ? A GLY 31 392 10 Y 1 A LEU 2044 ? A LEU 32 393 10 Y 1 A PRO 2045 ? A PRO 33 394 10 Y 1 A GLN 2046 ? A GLN 34 395 10 Y 1 A THR 2047 ? A THR 35 396 10 Y 1 A GLY 2048 ? A GLY 36 397 10 Y 1 A THR 2049 ? A THR 37 398 10 Y 1 A PRO 2050 ? A PRO 38 399 10 Y 1 A THR 2051 ? A THR 39 400 10 Y 1 A PHE 2052 ? A PHE 40 401 11 Y 1 A MET 2013 ? A MET 1 402 11 Y 1 A ALA 2014 ? A ALA 2 403 11 Y 1 A HIS 2015 ? A HIS 3 404 11 Y 1 A HIS 2016 ? A HIS 4 405 11 Y 1 A HIS 2017 ? A HIS 5 406 11 Y 1 A HIS 2018 ? A HIS 6 407 11 Y 1 A HIS 2019 ? A HIS 7 408 11 Y 1 A HIS 2020 ? A HIS 8 409 11 Y 1 A SER 2021 ? A SER 9 410 11 Y 1 A SER 2022 ? A SER 10 411 11 Y 1 A GLY 2023 ? A GLY 11 412 11 Y 1 A LEU 2024 ? A LEU 12 413 11 Y 1 A GLU 2025 ? A GLU 13 414 11 Y 1 A VAL 2026 ? A VAL 14 415 11 Y 1 A LEU 2027 ? A LEU 15 416 11 Y 1 A PHE 2028 ? A PHE 16 417 11 Y 1 A GLN 2029 ? A GLN 17 418 11 Y 1 A GLY 2030 ? A GLY 18 419 11 Y 1 A PRO 2031 ? A PRO 19 420 11 Y 1 A THR 2032 ? A THR 20 421 11 Y 1 A GLY 2033 ? A GLY 21 422 11 Y 1 A THR 2034 ? A THR 22 423 11 Y 1 A GLY 2035 ? A GLY 23 424 11 Y 1 A ALA 2036 ? A ALA 24 425 11 Y 1 A THR 2037 ? A THR 25 426 11 Y 1 A SER 2038 ? A SER 26 427 11 Y 1 A THR 2039 ? A THR 27 428 11 Y 1 A GLY 2040 ? A GLY 28 429 11 Y 1 A PRO 2041 ? A PRO 29 430 11 Y 1 A GLN 2042 ? A GLN 30 431 11 Y 1 A GLY 2043 ? A GLY 31 432 11 Y 1 A LEU 2044 ? A LEU 32 433 11 Y 1 A PRO 2045 ? A PRO 33 434 11 Y 1 A GLN 2046 ? A GLN 34 435 11 Y 1 A THR 2047 ? A THR 35 436 11 Y 1 A GLY 2048 ? A GLY 36 437 11 Y 1 A THR 2049 ? A THR 37 438 11 Y 1 A PRO 2050 ? A PRO 38 439 11 Y 1 A THR 2051 ? A THR 39 440 11 Y 1 A PHE 2052 ? A PHE 40 441 12 Y 1 A MET 2013 ? A MET 1 442 12 Y 1 A ALA 2014 ? A ALA 2 443 12 Y 1 A HIS 2015 ? A HIS 3 444 12 Y 1 A HIS 2016 ? A HIS 4 445 12 Y 1 A HIS 2017 ? A HIS 5 446 12 Y 1 A HIS 2018 ? A HIS 6 447 12 Y 1 A HIS 2019 ? A HIS 7 448 12 Y 1 A HIS 2020 ? A HIS 8 449 12 Y 1 A SER 2021 ? A SER 9 450 12 Y 1 A SER 2022 ? A SER 10 451 12 Y 1 A GLY 2023 ? A GLY 11 452 12 Y 1 A LEU 2024 ? A LEU 12 453 12 Y 1 A GLU 2025 ? A GLU 13 454 12 Y 1 A VAL 2026 ? A VAL 14 455 12 Y 1 A LEU 2027 ? A LEU 15 456 12 Y 1 A PHE 2028 ? A PHE 16 457 12 Y 1 A GLN 2029 ? A GLN 17 458 12 Y 1 A GLY 2030 ? A GLY 18 459 12 Y 1 A PRO 2031 ? A PRO 19 460 12 Y 1 A THR 2032 ? A THR 20 461 12 Y 1 A GLY 2033 ? A GLY 21 462 12 Y 1 A THR 2034 ? A THR 22 463 12 Y 1 A GLY 2035 ? A GLY 23 464 12 Y 1 A ALA 2036 ? A ALA 24 465 12 Y 1 A THR 2037 ? A THR 25 466 12 Y 1 A SER 2038 ? A SER 26 467 12 Y 1 A THR 2039 ? A THR 27 468 12 Y 1 A GLY 2040 ? A GLY 28 469 12 Y 1 A PRO 2041 ? A PRO 29 470 12 Y 1 A GLN 2042 ? A GLN 30 471 12 Y 1 A GLY 2043 ? A GLY 31 472 12 Y 1 A LEU 2044 ? A LEU 32 473 12 Y 1 A PRO 2045 ? A PRO 33 474 12 Y 1 A GLN 2046 ? A GLN 34 475 12 Y 1 A THR 2047 ? A THR 35 476 12 Y 1 A GLY 2048 ? A GLY 36 477 12 Y 1 A THR 2049 ? A THR 37 478 12 Y 1 A PRO 2050 ? A PRO 38 479 12 Y 1 A THR 2051 ? A THR 39 480 12 Y 1 A PHE 2052 ? A PHE 40 481 13 Y 1 A MET 2013 ? A MET 1 482 13 Y 1 A ALA 2014 ? A ALA 2 483 13 Y 1 A HIS 2015 ? A HIS 3 484 13 Y 1 A HIS 2016 ? A HIS 4 485 13 Y 1 A HIS 2017 ? A HIS 5 486 13 Y 1 A HIS 2018 ? A HIS 6 487 13 Y 1 A HIS 2019 ? A HIS 7 488 13 Y 1 A HIS 2020 ? A HIS 8 489 13 Y 1 A SER 2021 ? A SER 9 490 13 Y 1 A SER 2022 ? A SER 10 491 13 Y 1 A GLY 2023 ? A GLY 11 492 13 Y 1 A LEU 2024 ? A LEU 12 493 13 Y 1 A GLU 2025 ? A GLU 13 494 13 Y 1 A VAL 2026 ? A VAL 14 495 13 Y 1 A LEU 2027 ? A LEU 15 496 13 Y 1 A PHE 2028 ? A PHE 16 497 13 Y 1 A GLN 2029 ? A GLN 17 498 13 Y 1 A GLY 2030 ? A GLY 18 499 13 Y 1 A PRO 2031 ? A PRO 19 500 13 Y 1 A THR 2032 ? A THR 20 501 13 Y 1 A GLY 2033 ? A GLY 21 502 13 Y 1 A THR 2034 ? A THR 22 503 13 Y 1 A GLY 2035 ? A GLY 23 504 13 Y 1 A ALA 2036 ? A ALA 24 505 13 Y 1 A THR 2037 ? A THR 25 506 13 Y 1 A SER 2038 ? A SER 26 507 13 Y 1 A THR 2039 ? A THR 27 508 13 Y 1 A GLY 2040 ? A GLY 28 509 13 Y 1 A PRO 2041 ? A PRO 29 510 13 Y 1 A GLN 2042 ? A GLN 30 511 13 Y 1 A GLY 2043 ? A GLY 31 512 13 Y 1 A LEU 2044 ? A LEU 32 513 13 Y 1 A PRO 2045 ? A PRO 33 514 13 Y 1 A GLN 2046 ? A GLN 34 515 13 Y 1 A THR 2047 ? A THR 35 516 13 Y 1 A GLY 2048 ? A GLY 36 517 13 Y 1 A THR 2049 ? A THR 37 518 13 Y 1 A PRO 2050 ? A PRO 38 519 13 Y 1 A THR 2051 ? A THR 39 520 13 Y 1 A PHE 2052 ? A PHE 40 521 14 Y 1 A MET 2013 ? A MET 1 522 14 Y 1 A ALA 2014 ? A ALA 2 523 14 Y 1 A HIS 2015 ? A HIS 3 524 14 Y 1 A HIS 2016 ? A HIS 4 525 14 Y 1 A HIS 2017 ? A HIS 5 526 14 Y 1 A HIS 2018 ? A HIS 6 527 14 Y 1 A HIS 2019 ? A HIS 7 528 14 Y 1 A HIS 2020 ? A HIS 8 529 14 Y 1 A SER 2021 ? A SER 9 530 14 Y 1 A SER 2022 ? A SER 10 531 14 Y 1 A GLY 2023 ? A GLY 11 532 14 Y 1 A LEU 2024 ? A LEU 12 533 14 Y 1 A GLU 2025 ? A GLU 13 534 14 Y 1 A VAL 2026 ? A VAL 14 535 14 Y 1 A LEU 2027 ? A LEU 15 536 14 Y 1 A PHE 2028 ? A PHE 16 537 14 Y 1 A GLN 2029 ? A GLN 17 538 14 Y 1 A GLY 2030 ? A GLY 18 539 14 Y 1 A PRO 2031 ? A PRO 19 540 14 Y 1 A THR 2032 ? A THR 20 541 14 Y 1 A GLY 2033 ? A GLY 21 542 14 Y 1 A THR 2034 ? A THR 22 543 14 Y 1 A GLY 2035 ? A GLY 23 544 14 Y 1 A ALA 2036 ? A ALA 24 545 14 Y 1 A THR 2037 ? A THR 25 546 14 Y 1 A SER 2038 ? A SER 26 547 14 Y 1 A THR 2039 ? A THR 27 548 14 Y 1 A GLY 2040 ? A GLY 28 549 14 Y 1 A PRO 2041 ? A PRO 29 550 14 Y 1 A GLN 2042 ? A GLN 30 551 14 Y 1 A GLY 2043 ? A GLY 31 552 14 Y 1 A LEU 2044 ? A LEU 32 553 14 Y 1 A PRO 2045 ? A PRO 33 554 14 Y 1 A GLN 2046 ? A GLN 34 555 14 Y 1 A THR 2047 ? A THR 35 556 14 Y 1 A GLY 2048 ? A GLY 36 557 14 Y 1 A THR 2049 ? A THR 37 558 14 Y 1 A PRO 2050 ? A PRO 38 559 14 Y 1 A THR 2051 ? A THR 39 560 14 Y 1 A PHE 2052 ? A PHE 40 561 15 Y 1 A MET 2013 ? A MET 1 562 15 Y 1 A ALA 2014 ? A ALA 2 563 15 Y 1 A HIS 2015 ? A HIS 3 564 15 Y 1 A HIS 2016 ? A HIS 4 565 15 Y 1 A HIS 2017 ? A HIS 5 566 15 Y 1 A HIS 2018 ? A HIS 6 567 15 Y 1 A HIS 2019 ? A HIS 7 568 15 Y 1 A HIS 2020 ? A HIS 8 569 15 Y 1 A SER 2021 ? A SER 9 570 15 Y 1 A SER 2022 ? A SER 10 571 15 Y 1 A GLY 2023 ? A GLY 11 572 15 Y 1 A LEU 2024 ? A LEU 12 573 15 Y 1 A GLU 2025 ? A GLU 13 574 15 Y 1 A VAL 2026 ? A VAL 14 575 15 Y 1 A LEU 2027 ? A LEU 15 576 15 Y 1 A PHE 2028 ? A PHE 16 577 15 Y 1 A GLN 2029 ? A GLN 17 578 15 Y 1 A GLY 2030 ? A GLY 18 579 15 Y 1 A PRO 2031 ? A PRO 19 580 15 Y 1 A THR 2032 ? A THR 20 581 15 Y 1 A GLY 2033 ? A GLY 21 582 15 Y 1 A THR 2034 ? A THR 22 583 15 Y 1 A GLY 2035 ? A GLY 23 584 15 Y 1 A ALA 2036 ? A ALA 24 585 15 Y 1 A THR 2037 ? A THR 25 586 15 Y 1 A SER 2038 ? A SER 26 587 15 Y 1 A THR 2039 ? A THR 27 588 15 Y 1 A GLY 2040 ? A GLY 28 589 15 Y 1 A PRO 2041 ? A PRO 29 590 15 Y 1 A GLN 2042 ? A GLN 30 591 15 Y 1 A GLY 2043 ? A GLY 31 592 15 Y 1 A LEU 2044 ? A LEU 32 593 15 Y 1 A PRO 2045 ? A PRO 33 594 15 Y 1 A GLN 2046 ? A GLN 34 595 15 Y 1 A THR 2047 ? A THR 35 596 15 Y 1 A GLY 2048 ? A GLY 36 597 15 Y 1 A THR 2049 ? A THR 37 598 15 Y 1 A PRO 2050 ? A PRO 38 599 15 Y 1 A THR 2051 ? A THR 39 600 15 Y 1 A PHE 2052 ? A PHE 40 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Institutes of Health/National Institute of Dental and Craniofacial Research (NIH/NIDCR)' 'United Kingdom' DE016690 1 'Biotechnology and Biological Sciences Research Council' 'United Kingdom' BB/L01386X/1 2 'Biotechnology and Biological Sciences Research Council' 'United Kingdom' BB/M025624/1 3 'Royal Society' 'United Kingdom' UF080534 4 # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #