data_6T1J # _entry.id 6T1J # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6T1J pdb_00006t1j 10.2210/pdb6t1j/pdb WWPDB D_1292104689 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-11-06 2 'Structure model' 1 1 2020-01-29 3 'Structure model' 1 2 2024-01-24 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' database_2 6 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.pdbx_database_id_PubMed' 10 2 'Structure model' '_citation.title' 11 2 'Structure model' '_citation.year' 12 3 'Structure model' '_database_2.pdbx_DOI' 13 3 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6T1J _pdbx_database_status.recvd_initial_deposition_date 2019-10-04 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Chaikuad, A.' 1 ? 'Heidenreich, D.' 2 ? 'Arrowsmith, C.H.' 3 ? 'Edwards, A.M.' 4 ? 'Bountra, C.' 5 ? 'Fedorov, O.' 6 ? 'Knapp, S.' 7 ? 'Structural Genomics Consortium (SGC)' 8 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Acs Med.Chem.Lett.' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1948-5875 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 10 _citation.language ? _citation.page_first 1661 _citation.page_last 1666 _citation.title 'Structural Insights into Interaction Mechanisms of Alternative Piperazine-urea YEATS Domain Binders in MLLT1.' _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acsmedchemlett.9b00460 _citation.pdbx_database_id_PubMed 31857843 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ni, X.' 1 ? primary 'Heidenreich, D.' 2 ? primary 'Christott, T.' 3 ? primary 'Bennett, J.' 4 ? primary 'Moustakim, M.' 5 ? primary 'Brennan, P.E.' 6 ? primary 'Fedorov, O.' 7 ? primary 'Knapp, S.' 8 ? primary 'Chaikuad, A.' 9 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Protein ENL' 18225.002 1 ? ? ? ? 2 non-polymer syn 1,2-ETHANEDIOL 62.068 7 ? ? ? ? 3 non-polymer syn '~{N}-[[4-(pyrrolidin-1-ylmethyl)phenyl]methyl]-4-thiophen-2-ylcarbonyl-piperazine-1-carboxamide' 412.548 1 ? ? ? ? 4 water nat water 18.015 46 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'YEATS domain-containing protein 1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MDNQCTVQVRLELGHRAQLRKKPTTEGFTHDWMVFVRGPEQCDIQHFVEKVVFWLHDSFPKPRRVCKEPPYKVEESGYAG FIMPIEVHFKNKEEPRKVCFTYDLFLNLEGNPPVNHLRCEKLTFNNPTTEFRYKLLRAGGVMVMPEGAHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MDNQCTVQVRLELGHRAQLRKKPTTEGFTHDWMVFVRGPEQCDIQHFVEKVVFWLHDSFPKPRRVCKEPPYKVEESGYAG FIMPIEVHFKNKEEPRKVCFTYDLFLNLEGNPPVNHLRCEKLTFNNPTTEFRYKLLRAGGVMVMPEGAHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 1,2-ETHANEDIOL EDO 3 '~{N}-[[4-(pyrrolidin-1-ylmethyl)phenyl]methyl]-4-thiophen-2-ylcarbonyl-piperazine-1-carboxamide' M7T 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASP n 1 3 ASN n 1 4 GLN n 1 5 CYS n 1 6 THR n 1 7 VAL n 1 8 GLN n 1 9 VAL n 1 10 ARG n 1 11 LEU n 1 12 GLU n 1 13 LEU n 1 14 GLY n 1 15 HIS n 1 16 ARG n 1 17 ALA n 1 18 GLN n 1 19 LEU n 1 20 ARG n 1 21 LYS n 1 22 LYS n 1 23 PRO n 1 24 THR n 1 25 THR n 1 26 GLU n 1 27 GLY n 1 28 PHE n 1 29 THR n 1 30 HIS n 1 31 ASP n 1 32 TRP n 1 33 MET n 1 34 VAL n 1 35 PHE n 1 36 VAL n 1 37 ARG n 1 38 GLY n 1 39 PRO n 1 40 GLU n 1 41 GLN n 1 42 CYS n 1 43 ASP n 1 44 ILE n 1 45 GLN n 1 46 HIS n 1 47 PHE n 1 48 VAL n 1 49 GLU n 1 50 LYS n 1 51 VAL n 1 52 VAL n 1 53 PHE n 1 54 TRP n 1 55 LEU n 1 56 HIS n 1 57 ASP n 1 58 SER n 1 59 PHE n 1 60 PRO n 1 61 LYS n 1 62 PRO n 1 63 ARG n 1 64 ARG n 1 65 VAL n 1 66 CYS n 1 67 LYS n 1 68 GLU n 1 69 PRO n 1 70 PRO n 1 71 TYR n 1 72 LYS n 1 73 VAL n 1 74 GLU n 1 75 GLU n 1 76 SER n 1 77 GLY n 1 78 TYR n 1 79 ALA n 1 80 GLY n 1 81 PHE n 1 82 ILE n 1 83 MET n 1 84 PRO n 1 85 ILE n 1 86 GLU n 1 87 VAL n 1 88 HIS n 1 89 PHE n 1 90 LYS n 1 91 ASN n 1 92 LYS n 1 93 GLU n 1 94 GLU n 1 95 PRO n 1 96 ARG n 1 97 LYS n 1 98 VAL n 1 99 CYS n 1 100 PHE n 1 101 THR n 1 102 TYR n 1 103 ASP n 1 104 LEU n 1 105 PHE n 1 106 LEU n 1 107 ASN n 1 108 LEU n 1 109 GLU n 1 110 GLY n 1 111 ASN n 1 112 PRO n 1 113 PRO n 1 114 VAL n 1 115 ASN n 1 116 HIS n 1 117 LEU n 1 118 ARG n 1 119 CYS n 1 120 GLU n 1 121 LYS n 1 122 LEU n 1 123 THR n 1 124 PHE n 1 125 ASN n 1 126 ASN n 1 127 PRO n 1 128 THR n 1 129 THR n 1 130 GLU n 1 131 PHE n 1 132 ARG n 1 133 TYR n 1 134 LYS n 1 135 LEU n 1 136 LEU n 1 137 ARG n 1 138 ALA n 1 139 GLY n 1 140 GLY n 1 141 VAL n 1 142 MET n 1 143 VAL n 1 144 MET n 1 145 PRO n 1 146 GLU n 1 147 GLY n 1 148 ALA n 1 149 HIS n 1 150 HIS n 1 151 HIS n 1 152 HIS n 1 153 HIS n 1 154 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 154 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'MLLT1, ENL, LTG19, YEATS1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant -R3-pRARE2 _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pNIC-CH _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 EDO non-polymer . 1,2-ETHANEDIOL 'ETHYLENE GLYCOL' 'C2 H6 O2' 62.068 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 M7T non-polymer . '~{N}-[[4-(pyrrolidin-1-ylmethyl)phenyl]methyl]-4-thiophen-2-ylcarbonyl-piperazine-1-carboxamide' ? 'C22 H28 N4 O2 S' 412.548 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 ASN 3 3 3 ASN ASN A . n A 1 4 GLN 4 4 4 GLN GLN A . n A 1 5 CYS 5 5 5 CYS CYS A . n A 1 6 THR 6 6 6 THR THR A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 GLN 8 8 8 GLN GLN A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 ARG 10 10 10 ARG ARG A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 HIS 15 15 15 HIS HIS A . n A 1 16 ARG 16 16 16 ARG ARG A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 GLN 18 18 18 GLN GLN A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 ARG 20 20 20 ARG ARG A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 PRO 23 23 23 PRO PRO A . n A 1 24 THR 24 24 24 THR THR A . n A 1 25 THR 25 25 25 THR THR A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 PHE 28 28 28 PHE PHE A . n A 1 29 THR 29 29 29 THR THR A . n A 1 30 HIS 30 30 30 HIS HIS A . n A 1 31 ASP 31 31 31 ASP ASP A . n A 1 32 TRP 32 32 32 TRP TRP A . n A 1 33 MET 33 33 33 MET MET A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 PHE 35 35 35 PHE PHE A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 ARG 37 37 37 ARG ARG A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 PRO 39 39 39 PRO PRO A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 GLN 41 41 41 GLN GLN A . n A 1 42 CYS 42 42 42 CYS CYS A . n A 1 43 ASP 43 43 43 ASP ASP A . n A 1 44 ILE 44 44 44 ILE ILE A . n A 1 45 GLN 45 45 45 GLN GLN A . n A 1 46 HIS 46 46 46 HIS HIS A . n A 1 47 PHE 47 47 47 PHE PHE A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 GLU 49 49 49 GLU GLU A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 PHE 53 53 53 PHE PHE A . n A 1 54 TRP 54 54 54 TRP TRP A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 HIS 56 56 56 HIS HIS A . n A 1 57 ASP 57 57 57 ASP ASP A . n A 1 58 SER 58 58 58 SER SER A . n A 1 59 PHE 59 59 59 PHE PHE A . n A 1 60 PRO 60 60 60 PRO PRO A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 PRO 62 62 62 PRO PRO A . n A 1 63 ARG 63 63 63 ARG ARG A . n A 1 64 ARG 64 64 64 ARG ARG A . n A 1 65 VAL 65 65 65 VAL VAL A . n A 1 66 CYS 66 66 66 CYS CYS A . n A 1 67 LYS 67 67 67 LYS LYS A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 PRO 69 69 69 PRO PRO A . n A 1 70 PRO 70 70 70 PRO PRO A . n A 1 71 TYR 71 71 71 TYR TYR A . n A 1 72 LYS 72 72 72 LYS LYS A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 GLU 74 74 74 GLU GLU A . n A 1 75 GLU 75 75 75 GLU GLU A . n A 1 76 SER 76 76 76 SER SER A . n A 1 77 GLY 77 77 77 GLY GLY A . n A 1 78 TYR 78 78 78 TYR TYR A . n A 1 79 ALA 79 79 79 ALA ALA A . n A 1 80 GLY 80 80 80 GLY GLY A . n A 1 81 PHE 81 81 81 PHE PHE A . n A 1 82 ILE 82 82 82 ILE ILE A . n A 1 83 MET 83 83 83 MET MET A . n A 1 84 PRO 84 84 84 PRO PRO A . n A 1 85 ILE 85 85 85 ILE ILE A . n A 1 86 GLU 86 86 86 GLU GLU A . n A 1 87 VAL 87 87 87 VAL VAL A . n A 1 88 HIS 88 88 88 HIS HIS A . n A 1 89 PHE 89 89 89 PHE PHE A . n A 1 90 LYS 90 90 90 LYS LYS A . n A 1 91 ASN 91 91 91 ASN ASN A . n A 1 92 LYS 92 92 92 LYS LYS A . n A 1 93 GLU 93 93 93 GLU GLU A . n A 1 94 GLU 94 94 94 GLU GLU A . n A 1 95 PRO 95 95 95 PRO PRO A . n A 1 96 ARG 96 96 96 ARG ARG A . n A 1 97 LYS 97 97 97 LYS LYS A . n A 1 98 VAL 98 98 98 VAL VAL A . n A 1 99 CYS 99 99 99 CYS CYS A . n A 1 100 PHE 100 100 100 PHE PHE A . n A 1 101 THR 101 101 101 THR THR A . n A 1 102 TYR 102 102 102 TYR TYR A . n A 1 103 ASP 103 103 103 ASP ASP A . n A 1 104 LEU 104 104 104 LEU LEU A . n A 1 105 PHE 105 105 105 PHE PHE A . n A 1 106 LEU 106 106 106 LEU LEU A . n A 1 107 ASN 107 107 107 ASN ASN A . n A 1 108 LEU 108 108 108 LEU LEU A . n A 1 109 GLU 109 109 109 GLU GLU A . n A 1 110 GLY 110 110 110 GLY GLY A . n A 1 111 ASN 111 111 111 ASN ASN A . n A 1 112 PRO 112 112 112 PRO PRO A . n A 1 113 PRO 113 113 113 PRO PRO A . n A 1 114 VAL 114 114 114 VAL VAL A . n A 1 115 ASN 115 115 115 ASN ASN A . n A 1 116 HIS 116 116 116 HIS HIS A . n A 1 117 LEU 117 117 117 LEU LEU A . n A 1 118 ARG 118 118 118 ARG ARG A . n A 1 119 CYS 119 119 119 CYS CYS A . n A 1 120 GLU 120 120 120 GLU GLU A . n A 1 121 LYS 121 121 121 LYS LYS A . n A 1 122 LEU 122 122 122 LEU LEU A . n A 1 123 THR 123 123 123 THR THR A . n A 1 124 PHE 124 124 124 PHE PHE A . n A 1 125 ASN 125 125 125 ASN ASN A . n A 1 126 ASN 126 126 126 ASN ASN A . n A 1 127 PRO 127 127 127 PRO PRO A . n A 1 128 THR 128 128 128 THR THR A . n A 1 129 THR 129 129 129 THR THR A . n A 1 130 GLU 130 130 130 GLU GLU A . n A 1 131 PHE 131 131 131 PHE PHE A . n A 1 132 ARG 132 132 132 ARG ARG A . n A 1 133 TYR 133 133 133 TYR TYR A . n A 1 134 LYS 134 134 134 LYS LYS A . n A 1 135 LEU 135 135 135 LEU LEU A . n A 1 136 LEU 136 136 136 LEU LEU A . n A 1 137 ARG 137 137 137 ARG ARG A . n A 1 138 ALA 138 138 138 ALA ALA A . n A 1 139 GLY 139 139 139 GLY GLY A . n A 1 140 GLY 140 140 140 GLY GLY A . n A 1 141 VAL 141 141 141 VAL VAL A . n A 1 142 MET 142 142 142 MET MET A . n A 1 143 VAL 143 143 143 VAL VAL A . n A 1 144 MET 144 144 144 MET MET A . n A 1 145 PRO 145 145 ? ? ? A . n A 1 146 GLU 146 146 ? ? ? A . n A 1 147 GLY 147 147 ? ? ? A . n A 1 148 ALA 148 148 ? ? ? A . n A 1 149 HIS 149 149 ? ? ? A . n A 1 150 HIS 150 150 ? ? ? A . n A 1 151 HIS 151 151 ? ? ? A . n A 1 152 HIS 152 152 ? ? ? A . n A 1 153 HIS 153 153 ? ? ? A . n A 1 154 HIS 154 154 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 EDO 1 201 1 EDO EDO A . C 2 EDO 1 202 2 EDO EDO A . D 2 EDO 1 203 3 EDO EDO A . E 2 EDO 1 204 4 EDO EDO A . F 2 EDO 1 205 5 EDO EDO A . G 2 EDO 1 206 6 EDO EDO A . H 2 EDO 1 207 7 EDO EDO A . I 3 M7T 1 208 1 M7T ULB A . J 4 HOH 1 301 40 HOH HOH A . J 4 HOH 2 302 50 HOH HOH A . J 4 HOH 3 303 41 HOH HOH A . J 4 HOH 4 304 5 HOH HOH A . J 4 HOH 5 305 18 HOH HOH A . J 4 HOH 6 306 2 HOH HOH A . J 4 HOH 7 307 25 HOH HOH A . J 4 HOH 8 308 24 HOH HOH A . J 4 HOH 9 309 20 HOH HOH A . J 4 HOH 10 310 44 HOH HOH A . J 4 HOH 11 311 38 HOH HOH A . J 4 HOH 12 312 21 HOH HOH A . J 4 HOH 13 313 11 HOH HOH A . J 4 HOH 14 314 22 HOH HOH A . J 4 HOH 15 315 51 HOH HOH A . J 4 HOH 16 316 19 HOH HOH A . J 4 HOH 17 317 13 HOH HOH A . J 4 HOH 18 318 3 HOH HOH A . J 4 HOH 19 319 12 HOH HOH A . J 4 HOH 20 320 36 HOH HOH A . J 4 HOH 21 321 33 HOH HOH A . J 4 HOH 22 322 28 HOH HOH A . J 4 HOH 23 323 48 HOH HOH A . J 4 HOH 24 324 17 HOH HOH A . J 4 HOH 25 325 27 HOH HOH A . J 4 HOH 26 326 1 HOH HOH A . J 4 HOH 27 327 6 HOH HOH A . J 4 HOH 28 328 15 HOH HOH A . J 4 HOH 29 329 31 HOH HOH A . J 4 HOH 30 330 9 HOH HOH A . J 4 HOH 31 331 29 HOH HOH A . J 4 HOH 32 332 8 HOH HOH A . J 4 HOH 33 333 23 HOH HOH A . J 4 HOH 34 334 14 HOH HOH A . J 4 HOH 35 335 35 HOH HOH A . J 4 HOH 36 336 46 HOH HOH A . J 4 HOH 37 337 34 HOH HOH A . J 4 HOH 38 338 43 HOH HOH A . J 4 HOH 39 339 7 HOH HOH A . J 4 HOH 40 340 39 HOH HOH A . J 4 HOH 41 341 49 HOH HOH A . J 4 HOH 42 342 47 HOH HOH A . J 4 HOH 43 343 45 HOH HOH A . J 4 HOH 44 344 10 HOH HOH A . J 4 HOH 45 345 30 HOH HOH A . J 4 HOH 46 346 16 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ASP 2 ? CG ? A ASP 2 CG 2 1 Y 1 A ASP 2 ? OD1 ? A ASP 2 OD1 3 1 Y 1 A ASP 2 ? OD2 ? A ASP 2 OD2 4 1 Y 1 A MET 144 ? CG ? A MET 144 CG 5 1 Y 1 A MET 144 ? SD ? A MET 144 SD 6 1 Y 1 A MET 144 ? CE ? A MET 144 CE # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.7.4 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0253 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6T1J _cell.details ? _cell.formula_units_Z ? _cell.length_a 49.152 _cell.length_a_esd ? _cell.length_b 49.152 _cell.length_b_esd ? _cell.length_c 131.009 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6T1J _symmetry.cell_setting ? _symmetry.Int_Tables_number 96 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 43 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6T1J _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.17 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 43.34 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '25% PEG 3350, 0.2M sodium chloride, 0.1M bis-tris pH 6.5' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100.0 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-09-20 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0000 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SLS BEAMLINE X06SA' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0000 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline X06SA _diffrn_source.pdbx_synchrotron_site SLS # _reflns.B_iso_Wilson_estimate 37.8 _reflns.entry_id 6T1J _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.970 _reflns.d_resolution_low 49.150 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 12088 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100.000 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 9.500 _reflns.pdbx_Rmerge_I_obs 0.104 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 9.000 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.111 _reflns.pdbx_Rpim_I_all 0.034 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.997 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split 1.970 2.040 ? 2.1 ? ? ? ? 1139 100.000 ? ? ? ? 0.768 ? ? ? ? ? ? ? ? 8.800 ? ? ? ? 0.852 0.282 ? 1 1 0.917 ? ? 7.630 49.150 ? ? ? ? ? ? 278 99.900 ? ? ? ? 0.069 ? ? ? ? ? ? ? ? 8.100 ? ? ? ? 0.074 0.025 ? 2 1 0.995 ? ? # _refine.aniso_B[1][1] -2.9100 _refine.aniso_B[1][2] -0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][2] -2.9100 _refine.aniso_B[2][3] 0.0000 _refine.aniso_B[3][3] 5.8100 _refine.B_iso_max 119.270 _refine.B_iso_mean 54.0460 _refine.B_iso_min 32.130 _refine.correlation_coeff_Fo_to_Fc 0.9570 _refine.correlation_coeff_Fo_to_Fc_free 0.9310 _refine.details 'U VALUES : WITH TLS ADDED HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6T1J _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.9700 _refine.ls_d_res_low 46.0200 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 11454 _refine.ls_number_reflns_R_free 577 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.9800 _refine.ls_percent_reflns_R_free 4.8000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2260 _refine.ls_R_factor_R_free 0.2747 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2236 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 6HQ0 _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.2020 _refine.pdbx_overall_ESU_R_Free 0.1840 _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 15.5830 _refine.overall_SU_ML 0.1970 _refine.overall_SU_R_Cruickshank_DPI 0.2020 _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 1.9700 _refine_hist.d_res_low 46.0200 _refine_hist.number_atoms_solvent 46 _refine_hist.number_atoms_total 1285 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 143 _refine_hist.pdbx_B_iso_mean_ligand 73.12 _refine_hist.pdbx_B_iso_mean_solvent 54.01 _refine_hist.pdbx_number_atoms_protein 1182 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 57 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.011 0.013 1270 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.017 1182 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.194 1.677 1703 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.096 1.610 2742 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 8.288 5.000 142 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 23.174 21.250 72 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 14.733 15.000 210 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 18.944 15.000 10 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.057 0.200 147 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.010 0.020 1442 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.002 0.020 284 ? r_gen_planes_other ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.9700 _refine_ls_shell.d_res_low 2.0210 _refine_ls_shell.number_reflns_all 842 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 34 _refine_ls_shell.number_reflns_R_work 808 _refine_ls_shell.percent_reflns_obs 100.0000 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.4150 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.3530 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 6T1J _struct.title 'Crystal structure of MLLT1 (ENL) YEATS domain in complexed with piperazine-urea derivative 2' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6T1J _struct_keywords.text 'TRANSCRIPTION, YEATS domain, ENL, MLLT1, chemical probe, inhibitor, Structural Genomics, Structural Genomics Consortium, SGC' _struct_keywords.pdbx_keywords TRANSCRIPTION # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 2 ? F N N 2 ? G N N 2 ? H N N 2 ? I N N 3 ? J N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ENL_HUMAN _struct_ref.pdbx_db_accession Q03111 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MDNQCTVQVRLELGHRAQLRKKPTTEGFTHDWMVFVRGPEQCDIQHFVEKVVFWLHDSFPKPRRVCKEPPYKVEESGYAG FIMPIEVHFKNKEEPRKVCFTYDLFLNLEGNPPVNHLRCEKLTFNNPTTEFRYKLLRAGGVMVMPEGA ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6T1J _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 148 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q03111 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 148 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 148 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6T1J HIS A 149 ? UNP Q03111 ? ? 'expression tag' 149 1 1 6T1J HIS A 150 ? UNP Q03111 ? ? 'expression tag' 150 2 1 6T1J HIS A 151 ? UNP Q03111 ? ? 'expression tag' 151 3 1 6T1J HIS A 152 ? UNP Q03111 ? ? 'expression tag' 152 4 1 6T1J HIS A 153 ? UNP Q03111 ? ? 'expression tag' 153 5 1 6T1J HIS A 154 ? UNP Q03111 ? ? 'expression tag' 154 6 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1120 ? 1 MORE 16 ? 1 'SSA (A^2)' 8930 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H,I,J # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 43 ? HIS A 46 ? ASP A 43 HIS A 46 5 ? 4 HELX_P HELX_P2 AA2 THR A 128 ? ALA A 138 ? THR A 128 ALA A 138 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 PRO 69 A . ? PRO 69 A PRO 70 A ? PRO 70 A 1 -7.30 2 GLU 94 A . ? GLU 94 A PRO 95 A ? PRO 95 A 1 -12.59 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 4 ? AA3 ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 TYR A 71 ? GLY A 77 ? TYR A 71 GLY A 77 AA1 2 HIS A 30 ? ARG A 37 ? HIS A 30 ARG A 37 AA1 3 THR A 6 ? LEU A 19 ? THR A 6 LEU A 19 AA1 4 VAL A 114 ? ASN A 125 ? VAL A 114 ASN A 125 AA2 1 TYR A 71 ? GLY A 77 ? TYR A 71 GLY A 77 AA2 2 HIS A 30 ? ARG A 37 ? HIS A 30 ARG A 37 AA2 3 THR A 6 ? LEU A 19 ? THR A 6 LEU A 19 AA2 4 VAL A 141 ? MET A 142 ? VAL A 141 MET A 142 AA3 1 ARG A 63 ? CYS A 66 ? ARG A 63 CYS A 66 AA3 2 VAL A 48 ? TRP A 54 ? VAL A 48 TRP A 54 AA3 3 PHE A 81 ? PHE A 89 ? PHE A 81 PHE A 89 AA3 4 LYS A 97 ? LEU A 104 ? LYS A 97 LEU A 104 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O GLU A 75 ? O GLU A 75 N TRP A 32 ? N TRP A 32 AA1 2 3 O ARG A 37 ? O ARG A 37 N GLU A 12 ? N GLU A 12 AA1 3 4 N LEU A 13 ? N LEU A 13 O ARG A 118 ? O ARG A 118 AA2 1 2 O GLU A 75 ? O GLU A 75 N TRP A 32 ? N TRP A 32 AA2 2 3 O ARG A 37 ? O ARG A 37 N GLU A 12 ? N GLU A 12 AA2 3 4 N GLN A 8 ? N GLN A 8 O VAL A 141 ? O VAL A 141 AA3 1 2 O ARG A 64 ? O ARG A 64 N PHE A 53 ? N PHE A 53 AA3 2 3 N VAL A 52 ? N VAL A 52 O GLU A 86 ? O GLU A 86 AA3 3 4 N MET A 83 ? N MET A 83 O TYR A 102 ? O TYR A 102 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A EDO 201 ? 4 'binding site for residue EDO A 201' AC2 Software A EDO 202 ? 3 'binding site for residue EDO A 202' AC3 Software A EDO 203 ? 7 'binding site for residue EDO A 203' AC4 Software A EDO 204 ? 4 'binding site for residue EDO A 204' AC5 Software A EDO 205 ? 2 'binding site for residue EDO A 205' AC6 Software A EDO 206 ? 2 'binding site for residue EDO A 206' AC7 Software A EDO 207 ? 1 'binding site for residue EDO A 207' AC8 Software A M7T 208 ? 15 'binding site for residue M7T A 208' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 PHE A 100 ? PHE A 100 . ? 1_555 ? 2 AC1 4 THR A 101 ? THR A 101 . ? 1_555 ? 3 AC1 4 ASN A 111 ? ASN A 111 . ? 7_555 ? 4 AC1 4 ARG A 118 ? ARG A 118 . ? 1_555 ? 5 AC2 3 PHE A 35 ? PHE A 35 . ? 6_545 ? 6 AC2 3 GLU A 93 ? GLU A 93 . ? 1_555 ? 7 AC2 3 GLU A 94 ? GLU A 94 . ? 1_555 ? 8 AC3 7 VAL A 9 ? VAL A 9 . ? 1_555 ? 9 AC3 7 ARG A 10 ? ARG A 10 . ? 1_555 ? 10 AC3 7 CYS A 42 ? CYS A 42 . ? 1_555 ? 11 AC3 7 ILE A 44 ? ILE A 44 . ? 1_555 ? 12 AC3 7 PHE A 47 ? PHE A 47 . ? 1_555 ? 13 AC3 7 ALA A 138 ? ALA A 138 . ? 1_555 ? 14 AC3 7 GLY A 139 ? GLY A 139 . ? 1_555 ? 15 AC4 4 GLU A 94 ? GLU A 94 . ? 6_445 ? 16 AC4 4 PRO A 95 ? PRO A 95 . ? 6_445 ? 17 AC4 4 ARG A 96 ? ARG A 96 . ? 6_445 ? 18 AC4 4 LYS A 97 ? LYS A 97 . ? 6_445 ? 19 AC5 2 LEU A 122 ? LEU A 122 . ? 1_555 ? 20 AC5 2 THR A 123 ? THR A 123 . ? 1_555 ? 21 AC6 2 LYS A 50 ? LYS A 50 . ? 1_555 ? 22 AC6 2 ARG A 63 ? ARG A 63 . ? 1_555 ? 23 AC7 1 ASP A 103 ? ASP A 103 . ? 1_555 ? 24 AC8 15 GLN A 4 ? GLN A 4 . ? 1_565 ? 25 AC8 15 PHE A 28 ? PHE A 28 . ? 1_555 ? 26 AC8 15 HIS A 56 ? HIS A 56 . ? 1_555 ? 27 AC8 15 SER A 58 ? SER A 58 . ? 1_555 ? 28 AC8 15 PHE A 59 ? PHE A 59 . ? 1_555 ? 29 AC8 15 PRO A 60 ? PRO A 60 . ? 1_555 ? 30 AC8 15 SER A 76 ? SER A 76 . ? 1_555 ? 31 AC8 15 GLY A 77 ? GLY A 77 . ? 1_555 ? 32 AC8 15 TYR A 78 ? TYR A 78 . ? 1_555 ? 33 AC8 15 ALA A 79 ? ALA A 79 . ? 1_555 ? 34 AC8 15 GLY A 80 ? GLY A 80 . ? 1_555 ? 35 AC8 15 TYR A 133 ? TYR A 133 . ? 1_565 ? 36 AC8 15 MET A 142 ? MET A 142 . ? 1_565 ? 37 AC8 15 MET A 144 ? MET A 144 . ? 1_565 ? 38 AC8 15 HOH J . ? HOH A 329 . ? 1_555 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 25 ? ? -28.44 -52.91 2 1 LYS A 61 ? ? 25.71 73.37 3 1 GLU A 109 ? ? 39.97 -119.56 4 1 THR A 128 ? ? -49.55 161.38 # _pdbx_refine_tls.id 1 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x -1.1850 _pdbx_refine_tls.origin_y -4.3338 _pdbx_refine_tls.origin_z 12.7086 _pdbx_refine_tls.T[1][1] 0.0429 _pdbx_refine_tls.T[1][1]_esd ? _pdbx_refine_tls.T[1][2] -0.0423 _pdbx_refine_tls.T[1][2]_esd ? _pdbx_refine_tls.T[1][3] -0.0033 _pdbx_refine_tls.T[1][3]_esd ? _pdbx_refine_tls.T[2][2] 0.0461 _pdbx_refine_tls.T[2][2]_esd ? _pdbx_refine_tls.T[2][3] 0.0021 _pdbx_refine_tls.T[2][3]_esd ? _pdbx_refine_tls.T[3][3] 0.1519 _pdbx_refine_tls.T[3][3]_esd ? _pdbx_refine_tls.L[1][1] 2.6953 _pdbx_refine_tls.L[1][1]_esd ? _pdbx_refine_tls.L[1][2] -0.9678 _pdbx_refine_tls.L[1][2]_esd ? _pdbx_refine_tls.L[1][3] 0.1770 _pdbx_refine_tls.L[1][3]_esd ? _pdbx_refine_tls.L[2][2] 2.7296 _pdbx_refine_tls.L[2][2]_esd ? _pdbx_refine_tls.L[2][3] -0.7197 _pdbx_refine_tls.L[2][3]_esd ? _pdbx_refine_tls.L[3][3] 0.4319 _pdbx_refine_tls.L[3][3]_esd ? _pdbx_refine_tls.S[1][1] 0.1719 _pdbx_refine_tls.S[1][1]_esd ? _pdbx_refine_tls.S[1][2] -0.1524 _pdbx_refine_tls.S[1][2]_esd ? _pdbx_refine_tls.S[1][3] -0.2081 _pdbx_refine_tls.S[1][3]_esd ? _pdbx_refine_tls.S[2][1] -0.0415 _pdbx_refine_tls.S[2][1]_esd ? _pdbx_refine_tls.S[2][2] -0.0609 _pdbx_refine_tls.S[2][2]_esd ? _pdbx_refine_tls.S[2][3] 0.2372 _pdbx_refine_tls.S[2][3]_esd ? _pdbx_refine_tls.S[3][1] -0.0802 _pdbx_refine_tls.S[3][1]_esd ? _pdbx_refine_tls.S[3][2] 0.1058 _pdbx_refine_tls.S[3][2]_esd ? _pdbx_refine_tls.S[3][3] -0.1110 _pdbx_refine_tls.S[3][3]_esd ? # _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id 2 _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id A _pdbx_refine_tls_group.end_auth_seq_id 144 _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details ? # _pdbx_entry_details.entry_id 6T1J _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A PRO 145 ? A PRO 145 3 1 Y 1 A GLU 146 ? A GLU 146 4 1 Y 1 A GLY 147 ? A GLY 147 5 1 Y 1 A ALA 148 ? A ALA 148 6 1 Y 1 A HIS 149 ? A HIS 149 7 1 Y 1 A HIS 150 ? A HIS 150 8 1 Y 1 A HIS 151 ? A HIS 151 9 1 Y 1 A HIS 152 ? A HIS 152 10 1 Y 1 A HIS 153 ? A HIS 153 11 1 Y 1 A HIS 154 ? A HIS 154 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 EDO C1 C N N 88 EDO O1 O N N 89 EDO C2 C N N 90 EDO O2 O N N 91 EDO H11 H N N 92 EDO H12 H N N 93 EDO HO1 H N N 94 EDO H21 H N N 95 EDO H22 H N N 96 EDO HO2 H N N 97 GLN N N N N 98 GLN CA C N S 99 GLN C C N N 100 GLN O O N N 101 GLN CB C N N 102 GLN CG C N N 103 GLN CD C N N 104 GLN OE1 O N N 105 GLN NE2 N N N 106 GLN OXT O N N 107 GLN H H N N 108 GLN H2 H N N 109 GLN HA H N N 110 GLN HB2 H N N 111 GLN HB3 H N N 112 GLN HG2 H N N 113 GLN HG3 H N N 114 GLN HE21 H N N 115 GLN HE22 H N N 116 GLN HXT H N N 117 GLU N N N N 118 GLU CA C N S 119 GLU C C N N 120 GLU O O N N 121 GLU CB C N N 122 GLU CG C N N 123 GLU CD C N N 124 GLU OE1 O N N 125 GLU OE2 O N N 126 GLU OXT O N N 127 GLU H H N N 128 GLU H2 H N N 129 GLU HA H N N 130 GLU HB2 H N N 131 GLU HB3 H N N 132 GLU HG2 H N N 133 GLU HG3 H N N 134 GLU HE2 H N N 135 GLU HXT H N N 136 GLY N N N N 137 GLY CA C N N 138 GLY C C N N 139 GLY O O N N 140 GLY OXT O N N 141 GLY H H N N 142 GLY H2 H N N 143 GLY HA2 H N N 144 GLY HA3 H N N 145 GLY HXT H N N 146 HIS N N N N 147 HIS CA C N S 148 HIS C C N N 149 HIS O O N N 150 HIS CB C N N 151 HIS CG C Y N 152 HIS ND1 N Y N 153 HIS CD2 C Y N 154 HIS CE1 C Y N 155 HIS NE2 N Y N 156 HIS OXT O N N 157 HIS H H N N 158 HIS H2 H N N 159 HIS HA H N N 160 HIS HB2 H N N 161 HIS HB3 H N N 162 HIS HD1 H N N 163 HIS HD2 H N N 164 HIS HE1 H N N 165 HIS HE2 H N N 166 HIS HXT H N N 167 HOH O O N N 168 HOH H1 H N N 169 HOH H2 H N N 170 ILE N N N N 171 ILE CA C N S 172 ILE C C N N 173 ILE O O N N 174 ILE CB C N S 175 ILE CG1 C N N 176 ILE CG2 C N N 177 ILE CD1 C N N 178 ILE OXT O N N 179 ILE H H N N 180 ILE H2 H N N 181 ILE HA H N N 182 ILE HB H N N 183 ILE HG12 H N N 184 ILE HG13 H N N 185 ILE HG21 H N N 186 ILE HG22 H N N 187 ILE HG23 H N N 188 ILE HD11 H N N 189 ILE HD12 H N N 190 ILE HD13 H N N 191 ILE HXT H N N 192 LEU N N N N 193 LEU CA C N S 194 LEU C C N N 195 LEU O O N N 196 LEU CB C N N 197 LEU CG C N N 198 LEU CD1 C N N 199 LEU CD2 C N N 200 LEU OXT O N N 201 LEU H H N N 202 LEU H2 H N N 203 LEU HA H N N 204 LEU HB2 H N N 205 LEU HB3 H N N 206 LEU HG H N N 207 LEU HD11 H N N 208 LEU HD12 H N N 209 LEU HD13 H N N 210 LEU HD21 H N N 211 LEU HD22 H N N 212 LEU HD23 H N N 213 LEU HXT H N N 214 LYS N N N N 215 LYS CA C N S 216 LYS C C N N 217 LYS O O N N 218 LYS CB C N N 219 LYS CG C N N 220 LYS CD C N N 221 LYS CE C N N 222 LYS NZ N N N 223 LYS OXT O N N 224 LYS H H N N 225 LYS H2 H N N 226 LYS HA H N N 227 LYS HB2 H N N 228 LYS HB3 H N N 229 LYS HG2 H N N 230 LYS HG3 H N N 231 LYS HD2 H N N 232 LYS HD3 H N N 233 LYS HE2 H N N 234 LYS HE3 H N N 235 LYS HZ1 H N N 236 LYS HZ2 H N N 237 LYS HZ3 H N N 238 LYS HXT H N N 239 M7T O1 O N N 240 M7T C15 C N N 241 M7T C16 C Y N 242 M7T S S Y N 243 M7T C19 C Y N 244 M7T C18 C Y N 245 M7T C17 C Y N 246 M7T N3 N N N 247 M7T C14 C N N 248 M7T C13 C N N 249 M7T C21 C N N 250 M7T C20 C N N 251 M7T N2 N N N 252 M7T C C N N 253 M7T O O N N 254 M7T N N N N 255 M7T C1 C N N 256 M7T C2 C Y N 257 M7T C12 C Y N 258 M7T C11 C Y N 259 M7T C5 C Y N 260 M7T C4 C Y N 261 M7T C3 C Y N 262 M7T C6 C N N 263 M7T N1 N N N 264 M7T C10 C N N 265 M7T C9 C N N 266 M7T C8 C N N 267 M7T C7 C N N 268 M7T H1 H N N 269 M7T H2 H N N 270 M7T H3 H N N 271 M7T H4 H N N 272 M7T H5 H N N 273 M7T H6 H N N 274 M7T H7 H N N 275 M7T H8 H N N 276 M7T H9 H N N 277 M7T H10 H N N 278 M7T H11 H N N 279 M7T H12 H N N 280 M7T H13 H N N 281 M7T H14 H N N 282 M7T H15 H N N 283 M7T H16 H N N 284 M7T H17 H N N 285 M7T H18 H N N 286 M7T H19 H N N 287 M7T H20 H N N 288 M7T H22 H N N 289 M7T H23 H N N 290 M7T H24 H N N 291 M7T H25 H N N 292 M7T H26 H N N 293 M7T H27 H N N 294 M7T H28 H N N 295 M7T H29 H N N 296 MET N N N N 297 MET CA C N S 298 MET C C N N 299 MET O O N N 300 MET CB C N N 301 MET CG C N N 302 MET SD S N N 303 MET CE C N N 304 MET OXT O N N 305 MET H H N N 306 MET H2 H N N 307 MET HA H N N 308 MET HB2 H N N 309 MET HB3 H N N 310 MET HG2 H N N 311 MET HG3 H N N 312 MET HE1 H N N 313 MET HE2 H N N 314 MET HE3 H N N 315 MET HXT H N N 316 PHE N N N N 317 PHE CA C N S 318 PHE C C N N 319 PHE O O N N 320 PHE CB C N N 321 PHE CG C Y N 322 PHE CD1 C Y N 323 PHE CD2 C Y N 324 PHE CE1 C Y N 325 PHE CE2 C Y N 326 PHE CZ C Y N 327 PHE OXT O N N 328 PHE H H N N 329 PHE H2 H N N 330 PHE HA H N N 331 PHE HB2 H N N 332 PHE HB3 H N N 333 PHE HD1 H N N 334 PHE HD2 H N N 335 PHE HE1 H N N 336 PHE HE2 H N N 337 PHE HZ H N N 338 PHE HXT H N N 339 PRO N N N N 340 PRO CA C N S 341 PRO C C N N 342 PRO O O N N 343 PRO CB C N N 344 PRO CG C N N 345 PRO CD C N N 346 PRO OXT O N N 347 PRO H H N N 348 PRO HA H N N 349 PRO HB2 H N N 350 PRO HB3 H N N 351 PRO HG2 H N N 352 PRO HG3 H N N 353 PRO HD2 H N N 354 PRO HD3 H N N 355 PRO HXT H N N 356 SER N N N N 357 SER CA C N S 358 SER C C N N 359 SER O O N N 360 SER CB C N N 361 SER OG O N N 362 SER OXT O N N 363 SER H H N N 364 SER H2 H N N 365 SER HA H N N 366 SER HB2 H N N 367 SER HB3 H N N 368 SER HG H N N 369 SER HXT H N N 370 THR N N N N 371 THR CA C N S 372 THR C C N N 373 THR O O N N 374 THR CB C N R 375 THR OG1 O N N 376 THR CG2 C N N 377 THR OXT O N N 378 THR H H N N 379 THR H2 H N N 380 THR HA H N N 381 THR HB H N N 382 THR HG1 H N N 383 THR HG21 H N N 384 THR HG22 H N N 385 THR HG23 H N N 386 THR HXT H N N 387 TRP N N N N 388 TRP CA C N S 389 TRP C C N N 390 TRP O O N N 391 TRP CB C N N 392 TRP CG C Y N 393 TRP CD1 C Y N 394 TRP CD2 C Y N 395 TRP NE1 N Y N 396 TRP CE2 C Y N 397 TRP CE3 C Y N 398 TRP CZ2 C Y N 399 TRP CZ3 C Y N 400 TRP CH2 C Y N 401 TRP OXT O N N 402 TRP H H N N 403 TRP H2 H N N 404 TRP HA H N N 405 TRP HB2 H N N 406 TRP HB3 H N N 407 TRP HD1 H N N 408 TRP HE1 H N N 409 TRP HE3 H N N 410 TRP HZ2 H N N 411 TRP HZ3 H N N 412 TRP HH2 H N N 413 TRP HXT H N N 414 TYR N N N N 415 TYR CA C N S 416 TYR C C N N 417 TYR O O N N 418 TYR CB C N N 419 TYR CG C Y N 420 TYR CD1 C Y N 421 TYR CD2 C Y N 422 TYR CE1 C Y N 423 TYR CE2 C Y N 424 TYR CZ C Y N 425 TYR OH O N N 426 TYR OXT O N N 427 TYR H H N N 428 TYR H2 H N N 429 TYR HA H N N 430 TYR HB2 H N N 431 TYR HB3 H N N 432 TYR HD1 H N N 433 TYR HD2 H N N 434 TYR HE1 H N N 435 TYR HE2 H N N 436 TYR HH H N N 437 TYR HXT H N N 438 VAL N N N N 439 VAL CA C N S 440 VAL C C N N 441 VAL O O N N 442 VAL CB C N N 443 VAL CG1 C N N 444 VAL CG2 C N N 445 VAL OXT O N N 446 VAL H H N N 447 VAL H2 H N N 448 VAL HA H N N 449 VAL HB H N N 450 VAL HG11 H N N 451 VAL HG12 H N N 452 VAL HG13 H N N 453 VAL HG21 H N N 454 VAL HG22 H N N 455 VAL HG23 H N N 456 VAL HXT H N N 457 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 EDO C1 O1 sing N N 83 EDO C1 C2 sing N N 84 EDO C1 H11 sing N N 85 EDO C1 H12 sing N N 86 EDO O1 HO1 sing N N 87 EDO C2 O2 sing N N 88 EDO C2 H21 sing N N 89 EDO C2 H22 sing N N 90 EDO O2 HO2 sing N N 91 GLN N CA sing N N 92 GLN N H sing N N 93 GLN N H2 sing N N 94 GLN CA C sing N N 95 GLN CA CB sing N N 96 GLN CA HA sing N N 97 GLN C O doub N N 98 GLN C OXT sing N N 99 GLN CB CG sing N N 100 GLN CB HB2 sing N N 101 GLN CB HB3 sing N N 102 GLN CG CD sing N N 103 GLN CG HG2 sing N N 104 GLN CG HG3 sing N N 105 GLN CD OE1 doub N N 106 GLN CD NE2 sing N N 107 GLN NE2 HE21 sing N N 108 GLN NE2 HE22 sing N N 109 GLN OXT HXT sing N N 110 GLU N CA sing N N 111 GLU N H sing N N 112 GLU N H2 sing N N 113 GLU CA C sing N N 114 GLU CA CB sing N N 115 GLU CA HA sing N N 116 GLU C O doub N N 117 GLU C OXT sing N N 118 GLU CB CG sing N N 119 GLU CB HB2 sing N N 120 GLU CB HB3 sing N N 121 GLU CG CD sing N N 122 GLU CG HG2 sing N N 123 GLU CG HG3 sing N N 124 GLU CD OE1 doub N N 125 GLU CD OE2 sing N N 126 GLU OE2 HE2 sing N N 127 GLU OXT HXT sing N N 128 GLY N CA sing N N 129 GLY N H sing N N 130 GLY N H2 sing N N 131 GLY CA C sing N N 132 GLY CA HA2 sing N N 133 GLY CA HA3 sing N N 134 GLY C O doub N N 135 GLY C OXT sing N N 136 GLY OXT HXT sing N N 137 HIS N CA sing N N 138 HIS N H sing N N 139 HIS N H2 sing N N 140 HIS CA C sing N N 141 HIS CA CB sing N N 142 HIS CA HA sing N N 143 HIS C O doub N N 144 HIS C OXT sing N N 145 HIS CB CG sing N N 146 HIS CB HB2 sing N N 147 HIS CB HB3 sing N N 148 HIS CG ND1 sing Y N 149 HIS CG CD2 doub Y N 150 HIS ND1 CE1 doub Y N 151 HIS ND1 HD1 sing N N 152 HIS CD2 NE2 sing Y N 153 HIS CD2 HD2 sing N N 154 HIS CE1 NE2 sing Y N 155 HIS CE1 HE1 sing N N 156 HIS NE2 HE2 sing N N 157 HIS OXT HXT sing N N 158 HOH O H1 sing N N 159 HOH O H2 sing N N 160 ILE N CA sing N N 161 ILE N H sing N N 162 ILE N H2 sing N N 163 ILE CA C sing N N 164 ILE CA CB sing N N 165 ILE CA HA sing N N 166 ILE C O doub N N 167 ILE C OXT sing N N 168 ILE CB CG1 sing N N 169 ILE CB CG2 sing N N 170 ILE CB HB sing N N 171 ILE CG1 CD1 sing N N 172 ILE CG1 HG12 sing N N 173 ILE CG1 HG13 sing N N 174 ILE CG2 HG21 sing N N 175 ILE CG2 HG22 sing N N 176 ILE CG2 HG23 sing N N 177 ILE CD1 HD11 sing N N 178 ILE CD1 HD12 sing N N 179 ILE CD1 HD13 sing N N 180 ILE OXT HXT sing N N 181 LEU N CA sing N N 182 LEU N H sing N N 183 LEU N H2 sing N N 184 LEU CA C sing N N 185 LEU CA CB sing N N 186 LEU CA HA sing N N 187 LEU C O doub N N 188 LEU C OXT sing N N 189 LEU CB CG sing N N 190 LEU CB HB2 sing N N 191 LEU CB HB3 sing N N 192 LEU CG CD1 sing N N 193 LEU CG CD2 sing N N 194 LEU CG HG sing N N 195 LEU CD1 HD11 sing N N 196 LEU CD1 HD12 sing N N 197 LEU CD1 HD13 sing N N 198 LEU CD2 HD21 sing N N 199 LEU CD2 HD22 sing N N 200 LEU CD2 HD23 sing N N 201 LEU OXT HXT sing N N 202 LYS N CA sing N N 203 LYS N H sing N N 204 LYS N H2 sing N N 205 LYS CA C sing N N 206 LYS CA CB sing N N 207 LYS CA HA sing N N 208 LYS C O doub N N 209 LYS C OXT sing N N 210 LYS CB CG sing N N 211 LYS CB HB2 sing N N 212 LYS CB HB3 sing N N 213 LYS CG CD sing N N 214 LYS CG HG2 sing N N 215 LYS CG HG3 sing N N 216 LYS CD CE sing N N 217 LYS CD HD2 sing N N 218 LYS CD HD3 sing N N 219 LYS CE NZ sing N N 220 LYS CE HE2 sing N N 221 LYS CE HE3 sing N N 222 LYS NZ HZ1 sing N N 223 LYS NZ HZ2 sing N N 224 LYS NZ HZ3 sing N N 225 LYS OXT HXT sing N N 226 M7T C8 C9 sing N N 227 M7T C8 C7 sing N N 228 M7T C9 C10 sing N N 229 M7T C7 N1 sing N N 230 M7T C10 N1 sing N N 231 M7T N1 C6 sing N N 232 M7T C6 C5 sing N N 233 M7T C11 C5 doub Y N 234 M7T C11 C12 sing Y N 235 M7T C5 C4 sing Y N 236 M7T C12 C2 doub Y N 237 M7T C4 C3 doub Y N 238 M7T C2 C1 sing N N 239 M7T C2 C3 sing Y N 240 M7T C1 N sing N N 241 M7T O C doub N N 242 M7T N C sing N N 243 M7T C N2 sing N N 244 M7T N2 C13 sing N N 245 M7T N2 C20 sing N N 246 M7T C13 C14 sing N N 247 M7T C20 C21 sing N N 248 M7T C14 N3 sing N N 249 M7T C21 N3 sing N N 250 M7T N3 C15 sing N N 251 M7T C15 C16 sing N N 252 M7T C15 O1 doub N N 253 M7T C17 C16 doub Y N 254 M7T C17 C18 sing Y N 255 M7T C16 S sing Y N 256 M7T C18 C19 doub Y N 257 M7T C19 S sing Y N 258 M7T C19 H1 sing N N 259 M7T C18 H2 sing N N 260 M7T C17 H3 sing N N 261 M7T C14 H4 sing N N 262 M7T C14 H5 sing N N 263 M7T C13 H6 sing N N 264 M7T C13 H7 sing N N 265 M7T C21 H8 sing N N 266 M7T C21 H9 sing N N 267 M7T C20 H10 sing N N 268 M7T C20 H11 sing N N 269 M7T N H12 sing N N 270 M7T C1 H13 sing N N 271 M7T C1 H14 sing N N 272 M7T C12 H15 sing N N 273 M7T C11 H16 sing N N 274 M7T C4 H17 sing N N 275 M7T C3 H18 sing N N 276 M7T C6 H19 sing N N 277 M7T C6 H20 sing N N 278 M7T C10 H22 sing N N 279 M7T C10 H23 sing N N 280 M7T C9 H24 sing N N 281 M7T C9 H25 sing N N 282 M7T C8 H26 sing N N 283 M7T C8 H27 sing N N 284 M7T C7 H28 sing N N 285 M7T C7 H29 sing N N 286 MET N CA sing N N 287 MET N H sing N N 288 MET N H2 sing N N 289 MET CA C sing N N 290 MET CA CB sing N N 291 MET CA HA sing N N 292 MET C O doub N N 293 MET C OXT sing N N 294 MET CB CG sing N N 295 MET CB HB2 sing N N 296 MET CB HB3 sing N N 297 MET CG SD sing N N 298 MET CG HG2 sing N N 299 MET CG HG3 sing N N 300 MET SD CE sing N N 301 MET CE HE1 sing N N 302 MET CE HE2 sing N N 303 MET CE HE3 sing N N 304 MET OXT HXT sing N N 305 PHE N CA sing N N 306 PHE N H sing N N 307 PHE N H2 sing N N 308 PHE CA C sing N N 309 PHE CA CB sing N N 310 PHE CA HA sing N N 311 PHE C O doub N N 312 PHE C OXT sing N N 313 PHE CB CG sing N N 314 PHE CB HB2 sing N N 315 PHE CB HB3 sing N N 316 PHE CG CD1 doub Y N 317 PHE CG CD2 sing Y N 318 PHE CD1 CE1 sing Y N 319 PHE CD1 HD1 sing N N 320 PHE CD2 CE2 doub Y N 321 PHE CD2 HD2 sing N N 322 PHE CE1 CZ doub Y N 323 PHE CE1 HE1 sing N N 324 PHE CE2 CZ sing Y N 325 PHE CE2 HE2 sing N N 326 PHE CZ HZ sing N N 327 PHE OXT HXT sing N N 328 PRO N CA sing N N 329 PRO N CD sing N N 330 PRO N H sing N N 331 PRO CA C sing N N 332 PRO CA CB sing N N 333 PRO CA HA sing N N 334 PRO C O doub N N 335 PRO C OXT sing N N 336 PRO CB CG sing N N 337 PRO CB HB2 sing N N 338 PRO CB HB3 sing N N 339 PRO CG CD sing N N 340 PRO CG HG2 sing N N 341 PRO CG HG3 sing N N 342 PRO CD HD2 sing N N 343 PRO CD HD3 sing N N 344 PRO OXT HXT sing N N 345 SER N CA sing N N 346 SER N H sing N N 347 SER N H2 sing N N 348 SER CA C sing N N 349 SER CA CB sing N N 350 SER CA HA sing N N 351 SER C O doub N N 352 SER C OXT sing N N 353 SER CB OG sing N N 354 SER CB HB2 sing N N 355 SER CB HB3 sing N N 356 SER OG HG sing N N 357 SER OXT HXT sing N N 358 THR N CA sing N N 359 THR N H sing N N 360 THR N H2 sing N N 361 THR CA C sing N N 362 THR CA CB sing N N 363 THR CA HA sing N N 364 THR C O doub N N 365 THR C OXT sing N N 366 THR CB OG1 sing N N 367 THR CB CG2 sing N N 368 THR CB HB sing N N 369 THR OG1 HG1 sing N N 370 THR CG2 HG21 sing N N 371 THR CG2 HG22 sing N N 372 THR CG2 HG23 sing N N 373 THR OXT HXT sing N N 374 TRP N CA sing N N 375 TRP N H sing N N 376 TRP N H2 sing N N 377 TRP CA C sing N N 378 TRP CA CB sing N N 379 TRP CA HA sing N N 380 TRP C O doub N N 381 TRP C OXT sing N N 382 TRP CB CG sing N N 383 TRP CB HB2 sing N N 384 TRP CB HB3 sing N N 385 TRP CG CD1 doub Y N 386 TRP CG CD2 sing Y N 387 TRP CD1 NE1 sing Y N 388 TRP CD1 HD1 sing N N 389 TRP CD2 CE2 doub Y N 390 TRP CD2 CE3 sing Y N 391 TRP NE1 CE2 sing Y N 392 TRP NE1 HE1 sing N N 393 TRP CE2 CZ2 sing Y N 394 TRP CE3 CZ3 doub Y N 395 TRP CE3 HE3 sing N N 396 TRP CZ2 CH2 doub Y N 397 TRP CZ2 HZ2 sing N N 398 TRP CZ3 CH2 sing Y N 399 TRP CZ3 HZ3 sing N N 400 TRP CH2 HH2 sing N N 401 TRP OXT HXT sing N N 402 TYR N CA sing N N 403 TYR N H sing N N 404 TYR N H2 sing N N 405 TYR CA C sing N N 406 TYR CA CB sing N N 407 TYR CA HA sing N N 408 TYR C O doub N N 409 TYR C OXT sing N N 410 TYR CB CG sing N N 411 TYR CB HB2 sing N N 412 TYR CB HB3 sing N N 413 TYR CG CD1 doub Y N 414 TYR CG CD2 sing Y N 415 TYR CD1 CE1 sing Y N 416 TYR CD1 HD1 sing N N 417 TYR CD2 CE2 doub Y N 418 TYR CD2 HD2 sing N N 419 TYR CE1 CZ doub Y N 420 TYR CE1 HE1 sing N N 421 TYR CE2 CZ sing Y N 422 TYR CE2 HE2 sing N N 423 TYR CZ OH sing N N 424 TYR OH HH sing N N 425 TYR OXT HXT sing N N 426 VAL N CA sing N N 427 VAL N H sing N N 428 VAL N H2 sing N N 429 VAL CA C sing N N 430 VAL CA CB sing N N 431 VAL CA HA sing N N 432 VAL C O doub N N 433 VAL C OXT sing N N 434 VAL CB CG1 sing N N 435 VAL CB CG2 sing N N 436 VAL CB HB sing N N 437 VAL CG1 HG11 sing N N 438 VAL CG1 HG12 sing N N 439 VAL CG1 HG13 sing N N 440 VAL CG2 HG21 sing N N 441 VAL CG2 HG22 sing N N 442 VAL CG2 HG23 sing N N 443 VAL OXT HXT sing N N 444 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id M7T _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id M7T _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 6HQ0 _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 6T1J _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.020345 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.020345 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007633 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_