data_6T9Q # _entry.id 6T9Q # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.336 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 6T9Q WWPDB D_1292105110 # _pdbx_database_related.content_type unspecified _pdbx_database_related.db_id 6TAZ _pdbx_database_related.db_name PDB _pdbx_database_related.details . # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6T9Q _pdbx_database_status.recvd_initial_deposition_date 2019-10-28 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Pellegrini, L.' 1 0000-0002-9300-497X 'Holzer, S.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Embo J.' _citation.journal_id_ASTM EMJODG _citation.journal_id_CSD 0897 _citation.journal_id_ISSN 1460-2075 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 39 _citation.language ? _citation.page_first e104185 _citation.page_last e104185 _citation.title 'Timeless couples G-quadruplex detection with processing by DDX11 helicase during DNA replication.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.15252/embj.2019104185 _citation.pdbx_database_id_PubMed 32705708 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Lerner, L.K.' 1 ? primary 'Holzer, S.' 2 ? primary 'Kilkenny, M.L.' 3 ? primary 'Svikovic, S.' 4 ? primary 'Murat, P.' 5 ? primary 'Schiavone, D.' 6 ? primary 'Eldridge, C.B.' 7 ? primary 'Bittleston, A.' 8 ? primary 'Maman, J.D.' 9 ? primary 'Branzei, D.' 10 0000-0002-0544-4888 primary 'Stott, K.' 11 ? primary 'Pellegrini, L.' 12 0000-0002-9300-497X primary 'Sale, J.E.' 13 0000-0002-5031-3780 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 6T9Q _cell.details ? _cell.formula_units_Z ? _cell.length_a 55.407 _cell.length_a_esd ? _cell.length_b 55.407 _cell.length_b_esd ? _cell.length_c 41.659 _cell.length_c_esd ? _cell.volume 110756.378 _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6T9Q _symmetry.cell_setting ? _symmetry.Int_Tables_number 170 _symmetry.space_group_name_Hall 'P 65' _symmetry.space_group_name_H-M 'P 65' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Protein timeless homolog' 7876.086 1 ? ? ? 'The DP dipeptide at the start of the sequence is part of the leftover of the expression tag after protease cleavage' 2 water nat water 18.015 132 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name hTIM # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code DPGTHIVLWTGDQELELQRLFEEFRDSDDVLGHIMKNITAKRSRARIVDKLLALGLVAERRELYKKR _entity_poly.pdbx_seq_one_letter_code_can DPGTHIVLWTGDQELELQRLFEEFRDSDDVLGHIMKNITAKRSRARIVDKLLALGLVAERRELYKKR _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ASP n 1 2 PRO n 1 3 GLY n 1 4 THR n 1 5 HIS n 1 6 ILE n 1 7 VAL n 1 8 LEU n 1 9 TRP n 1 10 THR n 1 11 GLY n 1 12 ASP n 1 13 GLN n 1 14 GLU n 1 15 LEU n 1 16 GLU n 1 17 LEU n 1 18 GLN n 1 19 ARG n 1 20 LEU n 1 21 PHE n 1 22 GLU n 1 23 GLU n 1 24 PHE n 1 25 ARG n 1 26 ASP n 1 27 SER n 1 28 ASP n 1 29 ASP n 1 30 VAL n 1 31 LEU n 1 32 GLY n 1 33 HIS n 1 34 ILE n 1 35 MET n 1 36 LYS n 1 37 ASN n 1 38 ILE n 1 39 THR n 1 40 ALA n 1 41 LYS n 1 42 ARG n 1 43 SER n 1 44 ARG n 1 45 ALA n 1 46 ARG n 1 47 ILE n 1 48 VAL n 1 49 ASP n 1 50 LYS n 1 51 LEU n 1 52 LEU n 1 53 ALA n 1 54 LEU n 1 55 GLY n 1 56 LEU n 1 57 VAL n 1 58 ALA n 1 59 GLU n 1 60 ARG n 1 61 ARG n 1 62 GLU n 1 63 LEU n 1 64 TYR n 1 65 LYS n 1 66 LYS n 1 67 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 67 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'TIMELESS, TIM, TIM1, TIMELESS1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TIM_HUMAN _struct_ref.pdbx_db_accession Q9UNS1 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code GTHIVLWTGDQELELQRLFEEFRDSDDVLGHIMKNITAKRSRARIVDKLLALGLVAERRELYKKR _struct_ref.pdbx_align_begin 883 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6T9Q _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 67 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9UNS1 _struct_ref_seq.db_align_beg 883 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 947 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 883 _struct_ref_seq.pdbx_auth_seq_align_end 947 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6T9Q ASP A 1 ? UNP Q9UNS1 ? ? 'expression tag' 881 1 1 6T9Q PRO A 2 ? UNP Q9UNS1 ? ? 'expression tag' 882 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6T9Q _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.34 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 47.52 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 292 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;200mM Sodium formate 18% PEG3350 ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-08-10 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9686 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I24' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9686 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I24 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate 11.30 _reflns.entry_id 6T9Q _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.15 _reflns.d_resolution_low 31.46 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 25072 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 96.33 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 4.2 _reflns.pdbx_Rmerge_I_obs 0.1377 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 6.82 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.1543 _reflns.pdbx_Rpim_I_all 0.06851 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.975 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.15 _reflns_shell.d_res_low 1.191 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.36 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1920 _reflns_shell.percent_possible_all 74.84 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.4873 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 1.6 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 0.6505 _reflns_shell.pdbx_Rpim_I_all 0.4274 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.464 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 17.72 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6T9Q _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.15 _refine.ls_d_res_low 31.46 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 24985 _refine.ls_number_reflns_R_free 1267 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 96.33 _refine.ls_percent_reflns_R_free 5.07 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1294 _refine.ls_R_factor_R_free 0.1547 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1280 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.36 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 16.4928 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.1255 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.15 _refine_hist.d_res_low 31.46 _refine_hist.number_atoms_solvent 132 _refine_hist.number_atoms_total 648 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 516 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0078 ? 534 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.9639 ? 715 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0675 ? 80 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0072 ? 91 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 11.7066 ? 211 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.15 1.20 . . 110 2051 75.82 . . . 0.3519 . 0.2640 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.20 1.25 . . 128 2539 93.28 . . . 0.2139 . 0.1823 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.25 1.32 . . 132 2708 98.61 . . . 0.1779 . 0.1347 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.32 1.40 . . 138 2710 99.82 . . . 0.1531 . 0.1188 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.40 1.51 . . 132 2755 99.93 . . . 0.1633 . 0.1112 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.51 1.66 . . 156 2719 99.93 . . . 0.1380 . 0.0995 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.66 1.90 . . 154 2726 99.83 . . . 0.1551 . 0.1076 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.90 2.39 . . 156 2734 99.93 . . . 0.1255 . 0.1151 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.39 31.46 . . 161 2776 99.66 . . . 0.1540 . 0.1379 . . . . . . . . . . . # _struct.entry_id 6T9Q _struct.title 'Crystal structure of the second, C-terminal repeat of the DNA-binding domain of human TImeless' _struct.pdbx_descriptor 'Protein timeless homolog' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6T9Q _struct_keywords.text 'DNA-binding, 3-helix bundle, tandem repeat, REPLICATION' _struct_keywords.pdbx_keywords REPLICATION # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 10 ? ARG A 25 ? THR A 890 ARG A 905 1 ? 16 HELX_P HELX_P2 AA2 ASP A 29 ? ASN A 37 ? ASP A 909 ASN A 917 1 ? 9 HELX_P HELX_P3 AA3 SER A 43 ? LEU A 54 ? SER A 923 LEU A 934 1 ? 12 HELX_P HELX_P4 AA4 GLU A 59 ? TYR A 64 ? GLU A 939 TYR A 944 5 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 6T9Q _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.018048 _atom_sites.fract_transf_matrix[1][2] 0.010420 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.020840 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.024004 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? H ? ? 0.51345 0.48472 ? ? 24.73122 6.32584 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ASP 1 881 ? ? ? A . n A 1 2 PRO 2 882 ? ? ? A . n A 1 3 GLY 3 883 ? ? ? A . n A 1 4 THR 4 884 ? ? ? A . n A 1 5 HIS 5 885 885 HIS HIS A . n A 1 6 ILE 6 886 886 ILE ILE A . n A 1 7 VAL 7 887 887 VAL VAL A . n A 1 8 LEU 8 888 888 LEU LEU A . n A 1 9 TRP 9 889 889 TRP TRP A . n A 1 10 THR 10 890 890 THR THR A . n A 1 11 GLY 11 891 891 GLY GLY A . n A 1 12 ASP 12 892 892 ASP ASP A . n A 1 13 GLN 13 893 893 GLN GLN A . n A 1 14 GLU 14 894 894 GLU GLU A . n A 1 15 LEU 15 895 895 LEU LEU A . n A 1 16 GLU 16 896 896 GLU GLU A . n A 1 17 LEU 17 897 897 LEU LEU A . n A 1 18 GLN 18 898 898 GLN GLN A . n A 1 19 ARG 19 899 899 ARG ARG A . n A 1 20 LEU 20 900 900 LEU LEU A . n A 1 21 PHE 21 901 901 PHE PHE A . n A 1 22 GLU 22 902 902 GLU GLU A . n A 1 23 GLU 23 903 903 GLU GLU A . n A 1 24 PHE 24 904 904 PHE PHE A . n A 1 25 ARG 25 905 905 ARG ARG A . n A 1 26 ASP 26 906 906 ASP ASP A . n A 1 27 SER 27 907 907 SER SER A . n A 1 28 ASP 28 908 908 ASP ASP A . n A 1 29 ASP 29 909 909 ASP ASP A . n A 1 30 VAL 30 910 910 VAL VAL A . n A 1 31 LEU 31 911 911 LEU LEU A . n A 1 32 GLY 32 912 912 GLY GLY A . n A 1 33 HIS 33 913 913 HIS HIS A . n A 1 34 ILE 34 914 914 ILE ILE A . n A 1 35 MET 35 915 915 MET MET A . n A 1 36 LYS 36 916 916 LYS LYS A . n A 1 37 ASN 37 917 917 ASN ASN A . n A 1 38 ILE 38 918 918 ILE ILE A . n A 1 39 THR 39 919 919 THR THR A . n A 1 40 ALA 40 920 920 ALA ALA A . n A 1 41 LYS 41 921 921 LYS LYS A . n A 1 42 ARG 42 922 922 ARG ARG A . n A 1 43 SER 43 923 923 SER SER A . n A 1 44 ARG 44 924 924 ARG ARG A . n A 1 45 ALA 45 925 925 ALA ALA A . n A 1 46 ARG 46 926 926 ARG ARG A . n A 1 47 ILE 47 927 927 ILE ILE A . n A 1 48 VAL 48 928 928 VAL VAL A . n A 1 49 ASP 49 929 929 ASP ASP A . n A 1 50 LYS 50 930 930 LYS LYS A . n A 1 51 LEU 51 931 931 LEU LEU A . n A 1 52 LEU 52 932 932 LEU LEU A . n A 1 53 ALA 53 933 933 ALA ALA A . n A 1 54 LEU 54 934 934 LEU LEU A . n A 1 55 GLY 55 935 935 GLY GLY A . n A 1 56 LEU 56 936 936 LEU LEU A . n A 1 57 VAL 57 937 937 VAL VAL A . n A 1 58 ALA 58 938 938 ALA ALA A . n A 1 59 GLU 59 939 939 GLU GLU A . n A 1 60 ARG 60 940 940 ARG ARG A . n A 1 61 ARG 61 941 941 ARG ARG A . n A 1 62 GLU 62 942 942 GLU GLU A . n A 1 63 LEU 63 943 943 LEU LEU A . n A 1 64 TYR 64 944 944 TYR TYR A . n A 1 65 LYS 65 945 945 LYS LYS A . n A 1 66 LYS 66 946 946 LYS LYS A . n A 1 67 ARG 67 947 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 1001 124 HOH HOH A . B 2 HOH 2 1002 125 HOH HOH A . B 2 HOH 3 1003 36 HOH HOH A . B 2 HOH 4 1004 85 HOH HOH A . B 2 HOH 5 1005 99 HOH HOH A . B 2 HOH 6 1006 88 HOH HOH A . B 2 HOH 7 1007 37 HOH HOH A . B 2 HOH 8 1008 22 HOH HOH A . B 2 HOH 9 1009 95 HOH HOH A . B 2 HOH 10 1010 30 HOH HOH A . B 2 HOH 11 1011 119 HOH HOH A . B 2 HOH 12 1012 50 HOH HOH A . B 2 HOH 13 1013 51 HOH HOH A . B 2 HOH 14 1014 70 HOH HOH A . B 2 HOH 15 1015 25 HOH HOH A . B 2 HOH 16 1016 44 HOH HOH A . B 2 HOH 17 1017 80 HOH HOH A . B 2 HOH 18 1018 23 HOH HOH A . B 2 HOH 19 1019 67 HOH HOH A . B 2 HOH 20 1020 73 HOH HOH A . B 2 HOH 21 1021 29 HOH HOH A . B 2 HOH 22 1022 104 HOH HOH A . B 2 HOH 23 1023 18 HOH HOH A . B 2 HOH 24 1024 12 HOH HOH A . B 2 HOH 25 1025 75 HOH HOH A . B 2 HOH 26 1026 24 HOH HOH A . B 2 HOH 27 1027 31 HOH HOH A . B 2 HOH 28 1028 3 HOH HOH A . B 2 HOH 29 1029 33 HOH HOH A . B 2 HOH 30 1030 4 HOH HOH A . B 2 HOH 31 1031 42 HOH HOH A . B 2 HOH 32 1032 121 HOH HOH A . B 2 HOH 33 1033 66 HOH HOH A . B 2 HOH 34 1034 17 HOH HOH A . B 2 HOH 35 1035 59 HOH HOH A . B 2 HOH 36 1036 126 HOH HOH A . B 2 HOH 37 1037 45 HOH HOH A . B 2 HOH 38 1038 13 HOH HOH A . B 2 HOH 39 1039 47 HOH HOH A . B 2 HOH 40 1040 57 HOH HOH A . B 2 HOH 41 1041 39 HOH HOH A . B 2 HOH 42 1042 16 HOH HOH A . B 2 HOH 43 1043 40 HOH HOH A . B 2 HOH 44 1044 61 HOH HOH A . B 2 HOH 45 1045 38 HOH HOH A . B 2 HOH 46 1046 72 HOH HOH A . B 2 HOH 47 1047 55 HOH HOH A . B 2 HOH 48 1048 56 HOH HOH A . B 2 HOH 49 1049 2 HOH HOH A . B 2 HOH 50 1050 65 HOH HOH A . B 2 HOH 51 1051 53 HOH HOH A . B 2 HOH 52 1052 62 HOH HOH A . B 2 HOH 53 1053 9 HOH HOH A . B 2 HOH 54 1054 117 HOH HOH A . B 2 HOH 55 1055 113 HOH HOH A . B 2 HOH 56 1056 1 HOH HOH A . B 2 HOH 57 1057 106 HOH HOH A . B 2 HOH 58 1058 49 HOH HOH A . B 2 HOH 59 1059 76 HOH HOH A . B 2 HOH 60 1060 21 HOH HOH A . B 2 HOH 61 1061 127 HOH HOH A . B 2 HOH 62 1062 107 HOH HOH A . B 2 HOH 63 1063 101 HOH HOH A . B 2 HOH 64 1064 14 HOH HOH A . B 2 HOH 65 1065 89 HOH HOH A . B 2 HOH 66 1066 64 HOH HOH A . B 2 HOH 67 1067 84 HOH HOH A . B 2 HOH 68 1068 15 HOH HOH A . B 2 HOH 69 1069 28 HOH HOH A . B 2 HOH 70 1070 19 HOH HOH A . B 2 HOH 71 1071 6 HOH HOH A . B 2 HOH 72 1072 41 HOH HOH A . B 2 HOH 73 1073 87 HOH HOH A . B 2 HOH 74 1074 48 HOH HOH A . B 2 HOH 75 1075 27 HOH HOH A . B 2 HOH 76 1076 10 HOH HOH A . B 2 HOH 77 1077 97 HOH HOH A . B 2 HOH 78 1078 114 HOH HOH A . B 2 HOH 79 1079 34 HOH HOH A . B 2 HOH 80 1080 100 HOH HOH A . B 2 HOH 81 1081 58 HOH HOH A . B 2 HOH 82 1082 120 HOH HOH A . B 2 HOH 83 1083 94 HOH HOH A . B 2 HOH 84 1084 115 HOH HOH A . B 2 HOH 85 1085 90 HOH HOH A . B 2 HOH 86 1086 123 HOH HOH A . B 2 HOH 87 1087 111 HOH HOH A . B 2 HOH 88 1088 43 HOH HOH A . B 2 HOH 89 1089 86 HOH HOH A . B 2 HOH 90 1090 46 HOH HOH A . B 2 HOH 91 1091 79 HOH HOH A . B 2 HOH 92 1092 109 HOH HOH A . B 2 HOH 93 1093 110 HOH HOH A . B 2 HOH 94 1094 5 HOH HOH A . B 2 HOH 95 1095 7 HOH HOH A . B 2 HOH 96 1096 71 HOH HOH A . B 2 HOH 97 1097 131 HOH HOH A . B 2 HOH 98 1098 128 HOH HOH A . B 2 HOH 99 1099 122 HOH HOH A . B 2 HOH 100 1100 20 HOH HOH A . B 2 HOH 101 1101 69 HOH HOH A . B 2 HOH 102 1102 102 HOH HOH A . B 2 HOH 103 1103 60 HOH HOH A . B 2 HOH 104 1104 74 HOH HOH A . B 2 HOH 105 1105 11 HOH HOH A . B 2 HOH 106 1106 105 HOH HOH A . B 2 HOH 107 1107 82 HOH HOH A . B 2 HOH 108 1108 54 HOH HOH A . B 2 HOH 109 1109 116 HOH HOH A . B 2 HOH 110 1110 63 HOH HOH A . B 2 HOH 111 1111 68 HOH HOH A . B 2 HOH 112 1112 8 HOH HOH A . B 2 HOH 113 1113 118 HOH HOH A . B 2 HOH 114 1114 93 HOH HOH A . B 2 HOH 115 1115 35 HOH HOH A . B 2 HOH 116 1116 98 HOH HOH A . B 2 HOH 117 1117 91 HOH HOH A . B 2 HOH 118 1118 92 HOH HOH A . B 2 HOH 119 1119 83 HOH HOH A . B 2 HOH 120 1120 96 HOH HOH A . B 2 HOH 121 1121 32 HOH HOH A . B 2 HOH 122 1122 52 HOH HOH A . B 2 HOH 123 1123 77 HOH HOH A . B 2 HOH 124 1124 81 HOH HOH A . B 2 HOH 125 1125 26 HOH HOH A . B 2 HOH 126 1126 112 HOH HOH A . B 2 HOH 127 1127 78 HOH HOH A . B 2 HOH 128 1128 103 HOH HOH A . B 2 HOH 129 1129 129 HOH HOH A . B 2 HOH 130 1130 108 HOH HOH A . B 2 HOH 131 1131 130 HOH HOH A . B 2 HOH 132 1132 132 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 4610 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-07-01 2 'Structure model' 1 1 2020-08-12 3 'Structure model' 1 2 2020-12-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.pdbx_database_id_PubMed' 10 2 'Structure model' '_citation.title' 11 2 'Structure model' '_citation.year' 12 3 'Structure model' '_citation.journal_volume' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 2 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.16-3549 3 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HH21 A ARG 899 ? A O A HOH 1001 ? ? 1.43 2 1 O A HOH 1058 ? ? O A HOH 1096 ? ? 2.09 3 1 NH2 A ARG 899 ? A O A HOH 1001 ? ? 2.13 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 O A HOH 1083 ? ? 1_555 O A HOH 1101 ? ? 4_665 1.92 2 1 O A HOH 1099 ? ? 1_555 O A HOH 1126 ? ? 5_565 1.97 3 1 O A HOH 1002 ? ? 1_555 O A HOH 1093 ? ? 2_664 1.97 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id ASP _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 909 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -150.06 _pdbx_validate_torsion.psi 63.76 # loop_ _pdbx_distant_solvent_atoms.id _pdbx_distant_solvent_atoms.PDB_model_num _pdbx_distant_solvent_atoms.auth_atom_id _pdbx_distant_solvent_atoms.label_alt_id _pdbx_distant_solvent_atoms.auth_asym_id _pdbx_distant_solvent_atoms.auth_comp_id _pdbx_distant_solvent_atoms.auth_seq_id _pdbx_distant_solvent_atoms.PDB_ins_code _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance _pdbx_distant_solvent_atoms.neighbor_ligand_distance 1 1 O ? A HOH 1131 ? 7.03 . 2 1 O ? A HOH 1132 ? 7.39 . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ASP 881 ? A ASP 1 2 1 Y 1 A PRO 882 ? A PRO 2 3 1 Y 1 A GLY 883 ? A GLY 3 4 1 Y 1 A THR 884 ? A THR 4 5 1 Y 1 A ARG 947 ? A ARG 67 # _pdbx_audit_support.funding_organization 'Wellcome Trust' _pdbx_audit_support.country 'United Kingdom' _pdbx_audit_support.grant_number 104641/Z/14/Z _pdbx_audit_support.ordinal 1 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _space_group.name_H-M_alt 'P 65' _space_group.name_Hall 'P 65' _space_group.IT_number 170 _space_group.crystal_system hexagonal _space_group.id 1 # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x-y,x,z+5/6 3 y,-x+y,z+1/6 4 -y,x-y,z+2/3 5 -x+y,-x,z+1/3 6 -x,-y,z+1/2 #