data_6THE # _entry.id 6THE # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6THE pdb_00006the 10.2210/pdb6the/pdb WWPDB D_1292105421 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-04-22 2 'Structure model' 1 1 2021-01-13 3 'Structure model' 1 2 2024-01-24 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 2 'Structure model' 'Derived calculations' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 2 'Structure model' pdbx_struct_conn_angle 4 2 'Structure model' struct_conn 5 3 'Structure model' chem_comp_atom 6 3 'Structure model' chem_comp_bond 7 3 'Structure model' database_2 8 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation.year' 5 2 'Structure model' '_citation_author.identifier_ORCID' 6 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 7 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 8 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 9 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 10 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 11 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 12 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_symmetry' 13 2 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_comp_id' 14 2 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_seq_id' 15 2 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 16 2 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_atom_id' 17 2 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_comp_id' 18 2 'Structure model' '_pdbx_struct_conn_angle.ptnr2_symmetry' 19 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 20 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 21 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 22 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 23 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 24 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 25 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_symmetry' 26 2 'Structure model' '_pdbx_struct_conn_angle.value' 27 2 'Structure model' '_struct_conn.pdbx_dist_value' 28 2 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 29 2 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 30 2 'Structure model' '_struct_conn.ptnr1_label_asym_id' 31 2 'Structure model' '_struct_conn.ptnr1_label_atom_id' 32 2 'Structure model' '_struct_conn.ptnr1_label_comp_id' 33 2 'Structure model' '_struct_conn.ptnr1_label_seq_id' 34 2 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 35 2 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 36 2 'Structure model' '_struct_conn.ptnr2_label_asym_id' 37 2 'Structure model' '_struct_conn.ptnr2_label_atom_id' 38 2 'Structure model' '_struct_conn.ptnr2_label_comp_id' 39 2 'Structure model' '_struct_conn.ptnr2_symmetry' 40 3 'Structure model' '_database_2.pdbx_DOI' 41 3 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6THE _pdbx_database_status.recvd_initial_deposition_date 2019-11-20 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Sasaki, D.' 1 0000-0002-2224-1900 'Watanabe, T.F.' 2 ? 'Eady, R.R.' 3 ? 'Garratt, R.C.' 4 ? 'Antonyuk, S.V.' 5 0000-0002-2779-9946 'Hasnain, S.S.' 6 0000-0002-2854-4718 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Febs J.' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1742-464X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 288 _citation.language ? _citation.page_first 262 _citation.page_last 280 _citation.title ;Reverse protein engineering of a novel 4-domain copper nitrite reductase reveals functional regulation by protein-protein interaction. ; _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1111/febs.15324 _citation.pdbx_database_id_PubMed 32255260 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Sasaki, D.' 1 ? primary 'Watanabe, T.F.' 2 ? primary 'Eady, R.R.' 3 ? primary 'Garratt, R.C.' 4 ? primary 'Antonyuk, S.V.' 5 ? primary 'Hasnain, S.S.' 6 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Copper-containing nitrite reductase' 34202.824 1 1.7.2.1 ? ? ;Synthetic variant of four-domain Cu-containing nitrite reductase from Bradyrhizobium sp. ORS 375 where both cytochrome and cupredoxin domains are truncated. ; 2 non-polymer syn 'COPPER (II) ION' 63.546 2 ? ? ? ? 3 non-polymer syn 'YTTERBIUM (III) ION' 173.040 3 ? ? ? ? 4 non-polymer syn 'ERBIUM (III) ION' 167.259 4 ? ? ? ? 5 non-polymer syn 'TERBIUM(III) ION' 158.925 1 ? ? ? ? 6 non-polymer syn 'YTTRIUM (III) ION' 88.906 2 ? ? ? ? 7 non-polymer syn 'CHLORIDE ION' 35.453 1 ? ? ? ? 8 non-polymer syn pentane-1,5-diol 104.148 7 ? ? ? ? 9 water nat water 18.015 55 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MPQTVVEADISREPDDVPPPIGKRAPQTVRVDLLSVELEGRLAEGTTFGYWTFNGKVPGPLLRVRVGDTVEIHLKNAADS AMIHSVDFHAAIAPGGGAAALQVEPGGEKAITWKALVPGLFVYHCATPMVAEHIANGMYGMILVEPEGGLPPVDHEFYVM QGEIYSDIPYGQHGSAEFSVEKLLAERPEYFVFNGSVGALSKLHPLKAKVGDTVRIFFGVGGPNHASSFHVIGEIFDKVD LFGGLTTPPLAGIQTVTVPPGGAAIAEFKVEVPGTYTLVDHALARAERGLLGILHVQGPENPDIYNGVALPGAGHENLYF Q ; _entity_poly.pdbx_seq_one_letter_code_can ;MPQTVVEADISREPDDVPPPIGKRAPQTVRVDLLSVELEGRLAEGTTFGYWTFNGKVPGPLLRVRVGDTVEIHLKNAADS AMIHSVDFHAAIAPGGGAAALQVEPGGEKAITWKALVPGLFVYHCATPMVAEHIANGMYGMILVEPEGGLPPVDHEFYVM QGEIYSDIPYGQHGSAEFSVEKLLAERPEYFVFNGSVGALSKLHPLKAKVGDTVRIFFGVGGPNHASSFHVIGEIFDKVD LFGGLTTPPLAGIQTVTVPPGGAAIAEFKVEVPGTYTLVDHALARAERGLLGILHVQGPENPDIYNGVALPGAGHENLYF Q ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'COPPER (II) ION' CU 3 'YTTERBIUM (III) ION' YB 4 'ERBIUM (III) ION' ER3 5 'TERBIUM(III) ION' TB 6 'YTTRIUM (III) ION' YT3 7 'CHLORIDE ION' CL 8 pentane-1,5-diol 9JE 9 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 PRO n 1 3 GLN n 1 4 THR n 1 5 VAL n 1 6 VAL n 1 7 GLU n 1 8 ALA n 1 9 ASP n 1 10 ILE n 1 11 SER n 1 12 ARG n 1 13 GLU n 1 14 PRO n 1 15 ASP n 1 16 ASP n 1 17 VAL n 1 18 PRO n 1 19 PRO n 1 20 PRO n 1 21 ILE n 1 22 GLY n 1 23 LYS n 1 24 ARG n 1 25 ALA n 1 26 PRO n 1 27 GLN n 1 28 THR n 1 29 VAL n 1 30 ARG n 1 31 VAL n 1 32 ASP n 1 33 LEU n 1 34 LEU n 1 35 SER n 1 36 VAL n 1 37 GLU n 1 38 LEU n 1 39 GLU n 1 40 GLY n 1 41 ARG n 1 42 LEU n 1 43 ALA n 1 44 GLU n 1 45 GLY n 1 46 THR n 1 47 THR n 1 48 PHE n 1 49 GLY n 1 50 TYR n 1 51 TRP n 1 52 THR n 1 53 PHE n 1 54 ASN n 1 55 GLY n 1 56 LYS n 1 57 VAL n 1 58 PRO n 1 59 GLY n 1 60 PRO n 1 61 LEU n 1 62 LEU n 1 63 ARG n 1 64 VAL n 1 65 ARG n 1 66 VAL n 1 67 GLY n 1 68 ASP n 1 69 THR n 1 70 VAL n 1 71 GLU n 1 72 ILE n 1 73 HIS n 1 74 LEU n 1 75 LYS n 1 76 ASN n 1 77 ALA n 1 78 ALA n 1 79 ASP n 1 80 SER n 1 81 ALA n 1 82 MET n 1 83 ILE n 1 84 HIS n 1 85 SER n 1 86 VAL n 1 87 ASP n 1 88 PHE n 1 89 HIS n 1 90 ALA n 1 91 ALA n 1 92 ILE n 1 93 ALA n 1 94 PRO n 1 95 GLY n 1 96 GLY n 1 97 GLY n 1 98 ALA n 1 99 ALA n 1 100 ALA n 1 101 LEU n 1 102 GLN n 1 103 VAL n 1 104 GLU n 1 105 PRO n 1 106 GLY n 1 107 GLY n 1 108 GLU n 1 109 LYS n 1 110 ALA n 1 111 ILE n 1 112 THR n 1 113 TRP n 1 114 LYS n 1 115 ALA n 1 116 LEU n 1 117 VAL n 1 118 PRO n 1 119 GLY n 1 120 LEU n 1 121 PHE n 1 122 VAL n 1 123 TYR n 1 124 HIS n 1 125 CYS n 1 126 ALA n 1 127 THR n 1 128 PRO n 1 129 MET n 1 130 VAL n 1 131 ALA n 1 132 GLU n 1 133 HIS n 1 134 ILE n 1 135 ALA n 1 136 ASN n 1 137 GLY n 1 138 MET n 1 139 TYR n 1 140 GLY n 1 141 MET n 1 142 ILE n 1 143 LEU n 1 144 VAL n 1 145 GLU n 1 146 PRO n 1 147 GLU n 1 148 GLY n 1 149 GLY n 1 150 LEU n 1 151 PRO n 1 152 PRO n 1 153 VAL n 1 154 ASP n 1 155 HIS n 1 156 GLU n 1 157 PHE n 1 158 TYR n 1 159 VAL n 1 160 MET n 1 161 GLN n 1 162 GLY n 1 163 GLU n 1 164 ILE n 1 165 TYR n 1 166 SER n 1 167 ASP n 1 168 ILE n 1 169 PRO n 1 170 TYR n 1 171 GLY n 1 172 GLN n 1 173 HIS n 1 174 GLY n 1 175 SER n 1 176 ALA n 1 177 GLU n 1 178 PHE n 1 179 SER n 1 180 VAL n 1 181 GLU n 1 182 LYS n 1 183 LEU n 1 184 LEU n 1 185 ALA n 1 186 GLU n 1 187 ARG n 1 188 PRO n 1 189 GLU n 1 190 TYR n 1 191 PHE n 1 192 VAL n 1 193 PHE n 1 194 ASN n 1 195 GLY n 1 196 SER n 1 197 VAL n 1 198 GLY n 1 199 ALA n 1 200 LEU n 1 201 SER n 1 202 LYS n 1 203 LEU n 1 204 HIS n 1 205 PRO n 1 206 LEU n 1 207 LYS n 1 208 ALA n 1 209 LYS n 1 210 VAL n 1 211 GLY n 1 212 ASP n 1 213 THR n 1 214 VAL n 1 215 ARG n 1 216 ILE n 1 217 PHE n 1 218 PHE n 1 219 GLY n 1 220 VAL n 1 221 GLY n 1 222 GLY n 1 223 PRO n 1 224 ASN n 1 225 HIS n 1 226 ALA n 1 227 SER n 1 228 SER n 1 229 PHE n 1 230 HIS n 1 231 VAL n 1 232 ILE n 1 233 GLY n 1 234 GLU n 1 235 ILE n 1 236 PHE n 1 237 ASP n 1 238 LYS n 1 239 VAL n 1 240 ASP n 1 241 LEU n 1 242 PHE n 1 243 GLY n 1 244 GLY n 1 245 LEU n 1 246 THR n 1 247 THR n 1 248 PRO n 1 249 PRO n 1 250 LEU n 1 251 ALA n 1 252 GLY n 1 253 ILE n 1 254 GLN n 1 255 THR n 1 256 VAL n 1 257 THR n 1 258 VAL n 1 259 PRO n 1 260 PRO n 1 261 GLY n 1 262 GLY n 1 263 ALA n 1 264 ALA n 1 265 ILE n 1 266 ALA n 1 267 GLU n 1 268 PHE n 1 269 LYS n 1 270 VAL n 1 271 GLU n 1 272 VAL n 1 273 PRO n 1 274 GLY n 1 275 THR n 1 276 TYR n 1 277 THR n 1 278 LEU n 1 279 VAL n 1 280 ASP n 1 281 HIS n 1 282 ALA n 1 283 LEU n 1 284 ALA n 1 285 ARG n 1 286 ALA n 1 287 GLU n 1 288 ARG n 1 289 GLY n 1 290 LEU n 1 291 LEU n 1 292 GLY n 1 293 ILE n 1 294 LEU n 1 295 HIS n 1 296 VAL n 1 297 GLN n 1 298 GLY n 1 299 PRO n 1 300 GLU n 1 301 ASN n 1 302 PRO n 1 303 ASP n 1 304 ILE n 1 305 TYR n 1 306 ASN n 1 307 GLY n 1 308 VAL n 1 309 ALA n 1 310 LEU n 1 311 PRO n 1 312 GLY n 1 313 ALA n 1 314 GLY n 1 315 HIS n 1 316 GLU n 1 317 ASN n 1 318 LEU n 1 319 TYR n 1 320 PHE n 1 321 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 321 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene BRAO375_2740002 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bradyrhizobium sp. ORS 375' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 566679 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'pET-26b(+)' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 9JE non-polymer . pentane-1,5-diol ? 'C5 H12 O2' 104.148 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CU non-polymer . 'COPPER (II) ION' ? 'Cu 2' 63.546 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 ER3 non-polymer . 'ERBIUM (III) ION' ? 'Er 3' 167.259 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TB non-polymer . 'TERBIUM(III) ION' ? 'Tb 3' 158.925 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 YB non-polymer . 'YTTERBIUM (III) ION' ? 'Yb 3' 173.040 YT3 non-polymer . 'YTTRIUM (III) ION' ? 'Y 3' 88.906 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 PRO 2 2 ? ? ? A . n A 1 3 GLN 3 3 ? ? ? A . n A 1 4 THR 4 4 ? ? ? A . n A 1 5 VAL 5 5 ? ? ? A . n A 1 6 VAL 6 6 ? ? ? A . n A 1 7 GLU 7 7 ? ? ? A . n A 1 8 ALA 8 8 8 ALA ALA A . n A 1 9 ASP 9 9 9 ASP ASP A . n A 1 10 ILE 10 10 10 ILE ILE A . n A 1 11 SER 11 11 11 SER SER A . n A 1 12 ARG 12 12 12 ARG ARG A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 PRO 14 14 14 PRO PRO A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 ASP 16 16 16 ASP ASP A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 PRO 18 18 18 PRO PRO A . n A 1 19 PRO 19 19 19 PRO PRO A . n A 1 20 PRO 20 20 20 PRO PRO A . n A 1 21 ILE 21 21 21 ILE ILE A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 ARG 24 24 24 ARG ARG A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 PRO 26 26 26 PRO PRO A . n A 1 27 GLN 27 27 27 GLN GLN A . n A 1 28 THR 28 28 28 THR THR A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 ARG 30 30 30 ARG ARG A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 ASP 32 32 32 ASP ASP A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 GLU 39 39 39 GLU GLU A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 ARG 41 41 41 ARG ARG A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 THR 46 46 46 THR THR A . n A 1 47 THR 47 47 47 THR THR A . n A 1 48 PHE 48 48 48 PHE PHE A . n A 1 49 GLY 49 49 49 GLY GLY A . n A 1 50 TYR 50 50 50 TYR TYR A . n A 1 51 TRP 51 51 51 TRP TRP A . n A 1 52 THR 52 52 52 THR THR A . n A 1 53 PHE 53 53 53 PHE PHE A . n A 1 54 ASN 54 54 54 ASN ASN A . n A 1 55 GLY 55 55 55 GLY GLY A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 PRO 58 58 58 PRO PRO A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 PRO 60 60 60 PRO PRO A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 ARG 63 63 63 ARG ARG A . n A 1 64 VAL 64 64 64 VAL VAL A . n A 1 65 ARG 65 65 65 ARG ARG A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 ASP 68 68 68 ASP ASP A . n A 1 69 THR 69 69 69 THR THR A . n A 1 70 VAL 70 70 70 VAL VAL A . n A 1 71 GLU 71 71 71 GLU GLU A . n A 1 72 ILE 72 72 72 ILE ILE A . n A 1 73 HIS 73 73 73 HIS HIS A . n A 1 74 LEU 74 74 74 LEU LEU A . n A 1 75 LYS 75 75 75 LYS LYS A . n A 1 76 ASN 76 76 76 ASN ASN A . n A 1 77 ALA 77 77 77 ALA ALA A . n A 1 78 ALA 78 78 78 ALA ALA A . n A 1 79 ASP 79 79 79 ASP ASP A . n A 1 80 SER 80 80 80 SER SER A . n A 1 81 ALA 81 81 81 ALA ALA A . n A 1 82 MET 82 82 82 MET MET A . n A 1 83 ILE 83 83 83 ILE ILE A . n A 1 84 HIS 84 84 84 HIS HIS A . n A 1 85 SER 85 85 85 SER SER A . n A 1 86 VAL 86 86 86 VAL VAL A . n A 1 87 ASP 87 87 87 ASP ASP A . n A 1 88 PHE 88 88 88 PHE PHE A . n A 1 89 HIS 89 89 89 HIS HIS A . n A 1 90 ALA 90 90 90 ALA ALA A . n A 1 91 ALA 91 91 91 ALA ALA A . n A 1 92 ILE 92 92 92 ILE ILE A . n A 1 93 ALA 93 93 93 ALA ALA A . n A 1 94 PRO 94 94 94 PRO PRO A . n A 1 95 GLY 95 95 95 GLY GLY A . n A 1 96 GLY 96 96 96 GLY GLY A . n A 1 97 GLY 97 97 97 GLY GLY A . n A 1 98 ALA 98 98 98 ALA ALA A . n A 1 99 ALA 99 99 99 ALA ALA A . n A 1 100 ALA 100 100 100 ALA ALA A . n A 1 101 LEU 101 101 101 LEU LEU A . n A 1 102 GLN 102 102 102 GLN GLN A . n A 1 103 VAL 103 103 103 VAL VAL A . n A 1 104 GLU 104 104 104 GLU GLU A . n A 1 105 PRO 105 105 105 PRO PRO A . n A 1 106 GLY 106 106 106 GLY GLY A . n A 1 107 GLY 107 107 107 GLY GLY A . n A 1 108 GLU 108 108 108 GLU GLU A . n A 1 109 LYS 109 109 109 LYS LYS A . n A 1 110 ALA 110 110 110 ALA ALA A . n A 1 111 ILE 111 111 111 ILE ILE A . n A 1 112 THR 112 112 112 THR THR A . n A 1 113 TRP 113 113 113 TRP TRP A . n A 1 114 LYS 114 114 114 LYS LYS A . n A 1 115 ALA 115 115 115 ALA ALA A . n A 1 116 LEU 116 116 116 LEU LEU A . n A 1 117 VAL 117 117 117 VAL VAL A . n A 1 118 PRO 118 118 118 PRO PRO A . n A 1 119 GLY 119 119 119 GLY GLY A . n A 1 120 LEU 120 120 120 LEU LEU A . n A 1 121 PHE 121 121 121 PHE PHE A . n A 1 122 VAL 122 122 122 VAL VAL A . n A 1 123 TYR 123 123 123 TYR TYR A . n A 1 124 HIS 124 124 124 HIS HIS A . n A 1 125 CYS 125 125 125 CYS CYS A . n A 1 126 ALA 126 126 126 ALA ALA A . n A 1 127 THR 127 127 127 THR THR A . n A 1 128 PRO 128 128 128 PRO PRO A . n A 1 129 MET 129 129 129 MET MET A . n A 1 130 VAL 130 130 130 VAL VAL A . n A 1 131 ALA 131 131 131 ALA ALA A . n A 1 132 GLU 132 132 132 GLU GLU A . n A 1 133 HIS 133 133 133 HIS HIS A . n A 1 134 ILE 134 134 134 ILE ILE A . n A 1 135 ALA 135 135 135 ALA ALA A . n A 1 136 ASN 136 136 136 ASN ASN A . n A 1 137 GLY 137 137 137 GLY GLY A . n A 1 138 MET 138 138 138 MET MET A . n A 1 139 TYR 139 139 139 TYR TYR A . n A 1 140 GLY 140 140 140 GLY GLY A . n A 1 141 MET 141 141 141 MET MET A . n A 1 142 ILE 142 142 142 ILE ILE A . n A 1 143 LEU 143 143 143 LEU LEU A . n A 1 144 VAL 144 144 144 VAL VAL A . n A 1 145 GLU 145 145 145 GLU GLU A . n A 1 146 PRO 146 146 146 PRO PRO A . n A 1 147 GLU 147 147 147 GLU GLU A . n A 1 148 GLY 148 148 148 GLY GLY A . n A 1 149 GLY 149 149 149 GLY GLY A . n A 1 150 LEU 150 150 150 LEU LEU A . n A 1 151 PRO 151 151 151 PRO PRO A . n A 1 152 PRO 152 152 152 PRO PRO A . n A 1 153 VAL 153 153 153 VAL VAL A . n A 1 154 ASP 154 154 154 ASP ASP A . n A 1 155 HIS 155 155 155 HIS HIS A . n A 1 156 GLU 156 156 156 GLU GLU A . n A 1 157 PHE 157 157 157 PHE PHE A . n A 1 158 TYR 158 158 158 TYR TYR A . n A 1 159 VAL 159 159 159 VAL VAL A . n A 1 160 MET 160 160 160 MET MET A . n A 1 161 GLN 161 161 161 GLN GLN A . n A 1 162 GLY 162 162 162 GLY GLY A . n A 1 163 GLU 163 163 163 GLU GLU A . n A 1 164 ILE 164 164 164 ILE ILE A . n A 1 165 TYR 165 165 165 TYR TYR A . n A 1 166 SER 166 166 166 SER SER A . n A 1 167 ASP 167 167 167 ASP ASP A . n A 1 168 ILE 168 168 168 ILE ILE A . n A 1 169 PRO 169 169 169 PRO PRO A . n A 1 170 TYR 170 170 170 TYR TYR A . n A 1 171 GLY 171 171 171 GLY GLY A . n A 1 172 GLN 172 172 172 GLN GLN A . n A 1 173 HIS 173 173 173 HIS HIS A . n A 1 174 GLY 174 174 174 GLY GLY A . n A 1 175 SER 175 175 175 SER SER A . n A 1 176 ALA 176 176 176 ALA ALA A . n A 1 177 GLU 177 177 177 GLU GLU A . n A 1 178 PHE 178 178 178 PHE PHE A . n A 1 179 SER 179 179 179 SER SER A . n A 1 180 VAL 180 180 180 VAL VAL A . n A 1 181 GLU 181 181 181 GLU GLU A . n A 1 182 LYS 182 182 182 LYS LYS A . n A 1 183 LEU 183 183 183 LEU LEU A . n A 1 184 LEU 184 184 184 LEU LEU A . n A 1 185 ALA 185 185 185 ALA ALA A . n A 1 186 GLU 186 186 186 GLU GLU A . n A 1 187 ARG 187 187 187 ARG ARG A . n A 1 188 PRO 188 188 188 PRO PRO A . n A 1 189 GLU 189 189 189 GLU GLU A . n A 1 190 TYR 190 190 190 TYR TYR A . n A 1 191 PHE 191 191 191 PHE PHE A . n A 1 192 VAL 192 192 192 VAL VAL A . n A 1 193 PHE 193 193 193 PHE PHE A . n A 1 194 ASN 194 194 194 ASN ASN A . n A 1 195 GLY 195 195 195 GLY GLY A . n A 1 196 SER 196 196 196 SER SER A . n A 1 197 VAL 197 197 197 VAL VAL A . n A 1 198 GLY 198 198 198 GLY GLY A . n A 1 199 ALA 199 199 199 ALA ALA A . n A 1 200 LEU 200 200 200 LEU LEU A . n A 1 201 SER 201 201 201 SER SER A . n A 1 202 LYS 202 202 202 LYS LYS A . n A 1 203 LEU 203 203 203 LEU LEU A . n A 1 204 HIS 204 204 204 HIS HIS A . n A 1 205 PRO 205 205 205 PRO PRO A . n A 1 206 LEU 206 206 206 LEU LEU A . n A 1 207 LYS 207 207 207 LYS LYS A . n A 1 208 ALA 208 208 208 ALA ALA A . n A 1 209 LYS 209 209 209 LYS LYS A . n A 1 210 VAL 210 210 210 VAL VAL A . n A 1 211 GLY 211 211 211 GLY GLY A . n A 1 212 ASP 212 212 212 ASP ASP A . n A 1 213 THR 213 213 213 THR THR A . n A 1 214 VAL 214 214 214 VAL VAL A . n A 1 215 ARG 215 215 215 ARG ARG A . n A 1 216 ILE 216 216 216 ILE ILE A . n A 1 217 PHE 217 217 217 PHE PHE A . n A 1 218 PHE 218 218 218 PHE PHE A . n A 1 219 GLY 219 219 219 GLY GLY A . n A 1 220 VAL 220 220 220 VAL VAL A . n A 1 221 GLY 221 221 221 GLY GLY A . n A 1 222 GLY 222 222 222 GLY GLY A . n A 1 223 PRO 223 223 223 PRO PRO A . n A 1 224 ASN 224 224 224 ASN ASN A . n A 1 225 HIS 225 225 225 HIS HIS A . n A 1 226 ALA 226 226 226 ALA ALA A . n A 1 227 SER 227 227 227 SER SER A . n A 1 228 SER 228 228 228 SER SER A . n A 1 229 PHE 229 229 229 PHE PHE A . n A 1 230 HIS 230 230 230 HIS HIS A . n A 1 231 VAL 231 231 231 VAL VAL A . n A 1 232 ILE 232 232 232 ILE ILE A . n A 1 233 GLY 233 233 233 GLY GLY A . n A 1 234 GLU 234 234 234 GLU GLU A . n A 1 235 ILE 235 235 235 ILE ILE A . n A 1 236 PHE 236 236 236 PHE PHE A . n A 1 237 ASP 237 237 237 ASP ASP A . n A 1 238 LYS 238 238 238 LYS LYS A . n A 1 239 VAL 239 239 239 VAL VAL A . n A 1 240 ASP 240 240 240 ASP ASP A . n A 1 241 LEU 241 241 241 LEU LEU A . n A 1 242 PHE 242 242 242 PHE PHE A . n A 1 243 GLY 243 243 243 GLY GLY A . n A 1 244 GLY 244 244 244 GLY GLY A . n A 1 245 LEU 245 245 245 LEU LEU A . n A 1 246 THR 246 246 246 THR THR A . n A 1 247 THR 247 247 247 THR THR A . n A 1 248 PRO 248 248 248 PRO PRO A . n A 1 249 PRO 249 249 249 PRO PRO A . n A 1 250 LEU 250 250 250 LEU LEU A . n A 1 251 ALA 251 251 251 ALA ALA A . n A 1 252 GLY 252 252 252 GLY GLY A . n A 1 253 ILE 253 253 253 ILE ILE A . n A 1 254 GLN 254 254 254 GLN GLN A . n A 1 255 THR 255 255 255 THR THR A . n A 1 256 VAL 256 256 256 VAL VAL A . n A 1 257 THR 257 257 257 THR THR A . n A 1 258 VAL 258 258 258 VAL VAL A . n A 1 259 PRO 259 259 259 PRO PRO A . n A 1 260 PRO 260 260 260 PRO PRO A . n A 1 261 GLY 261 261 261 GLY GLY A . n A 1 262 GLY 262 262 262 GLY GLY A . n A 1 263 ALA 263 263 263 ALA ALA A . n A 1 264 ALA 264 264 264 ALA ALA A . n A 1 265 ILE 265 265 265 ILE ILE A . n A 1 266 ALA 266 266 266 ALA ALA A . n A 1 267 GLU 267 267 267 GLU GLU A . n A 1 268 PHE 268 268 268 PHE PHE A . n A 1 269 LYS 269 269 269 LYS LYS A . n A 1 270 VAL 270 270 270 VAL VAL A . n A 1 271 GLU 271 271 271 GLU GLU A . n A 1 272 VAL 272 272 272 VAL VAL A . n A 1 273 PRO 273 273 273 PRO PRO A . n A 1 274 GLY 274 274 274 GLY GLY A . n A 1 275 THR 275 275 275 THR THR A . n A 1 276 TYR 276 276 276 TYR TYR A . n A 1 277 THR 277 277 277 THR THR A . n A 1 278 LEU 278 278 278 LEU LEU A . n A 1 279 VAL 279 279 279 VAL VAL A . n A 1 280 ASP 280 280 280 ASP ASP A . n A 1 281 HIS 281 281 281 HIS HIS A . n A 1 282 ALA 282 282 282 ALA ALA A . n A 1 283 LEU 283 283 283 LEU LEU A . n A 1 284 ALA 284 284 284 ALA ALA A . n A 1 285 ARG 285 285 285 ARG ARG A . n A 1 286 ALA 286 286 286 ALA ALA A . n A 1 287 GLU 287 287 287 GLU GLU A . n A 1 288 ARG 288 288 288 ARG ARG A . n A 1 289 GLY 289 289 289 GLY GLY A . n A 1 290 LEU 290 290 290 LEU LEU A . n A 1 291 LEU 291 291 291 LEU LEU A . n A 1 292 GLY 292 292 292 GLY GLY A . n A 1 293 ILE 293 293 293 ILE ILE A . n A 1 294 LEU 294 294 294 LEU LEU A . n A 1 295 HIS 295 295 295 HIS HIS A . n A 1 296 VAL 296 296 296 VAL VAL A . n A 1 297 GLN 297 297 297 GLN GLN A . n A 1 298 GLY 298 298 298 GLY GLY A . n A 1 299 PRO 299 299 299 PRO PRO A . n A 1 300 GLU 300 300 300 GLU GLU A . n A 1 301 ASN 301 301 301 ASN ASN A . n A 1 302 PRO 302 302 302 PRO PRO A . n A 1 303 ASP 303 303 303 ASP ASP A . n A 1 304 ILE 304 304 304 ILE ILE A . n A 1 305 TYR 305 305 305 TYR TYR A . n A 1 306 ASN 306 306 306 ASN ASN A . n A 1 307 GLY 307 307 ? ? ? A . n A 1 308 VAL 308 308 ? ? ? A . n A 1 309 ALA 309 309 ? ? ? A . n A 1 310 LEU 310 310 ? ? ? A . n A 1 311 PRO 311 311 ? ? ? A . n A 1 312 GLY 312 312 ? ? ? A . n A 1 313 ALA 313 313 ? ? ? A . n A 1 314 GLY 314 314 ? ? ? A . n A 1 315 HIS 315 315 ? ? ? A . n A 1 316 GLU 316 316 ? ? ? A . n A 1 317 ASN 317 317 ? ? ? A . n A 1 318 LEU 318 318 ? ? ? A . n A 1 319 TYR 319 319 ? ? ? A . n A 1 320 PHE 320 320 ? ? ? A . n A 1 321 GLN 321 321 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CU 1 501 501 CU CU A . C 2 CU 1 502 502 CU CU A . D 3 YB 1 503 601 YB YB A . E 3 YB 1 504 603 YB YB A . F 3 YB 1 505 604 YB YB A . G 4 ER3 1 506 610 ER3 ER3 A . H 4 ER3 1 507 614 ER3 ER3 A . I 4 ER3 1 508 615 ER3 ER3 A . J 4 ER3 1 509 616 ER3 ER3 A . K 5 TB 1 510 620 TB TB A . L 6 YT3 1 511 630 YT3 YT3 A . M 6 YT3 1 512 632 YT3 YT3 A . N 7 CL 1 513 701 CL CL A . O 8 9JE 1 514 901 9JE 9JE A . P 8 9JE 1 515 1001 9JE 9JE A . Q 8 9JE 1 516 1101 9JE 9JE A . R 8 9JE 1 517 1201 9JE 9JE A . S 8 9JE 1 518 1301 9JE 9JE A . T 8 9JE 1 519 1601 9JE 9JE A . U 8 9JE 1 520 1701 9JE 9JE A . V 9 HOH 1 601 102 HOH HOH A . V 9 HOH 2 602 297 HOH HOH A . V 9 HOH 3 603 18 HOH HOH A . V 9 HOH 4 604 320 HOH HOH A . V 9 HOH 5 605 110 HOH HOH A . V 9 HOH 6 606 3 HOH HOH A . V 9 HOH 7 607 337 HOH HOH A . V 9 HOH 8 608 303 HOH HOH A . V 9 HOH 9 609 5 HOH HOH A . V 9 HOH 10 610 1 HOH HOH A . V 9 HOH 11 611 126 HOH HOH A . V 9 HOH 12 612 235 HOH HOH A . V 9 HOH 13 613 307 HOH HOH A . V 9 HOH 14 614 305 HOH HOH A . V 9 HOH 15 615 131 HOH HOH A . V 9 HOH 16 616 21 HOH HOH A . V 9 HOH 17 617 301 HOH HOH A . V 9 HOH 18 618 312 HOH HOH A . V 9 HOH 19 619 314 HOH HOH A . V 9 HOH 20 620 311 HOH HOH A . V 9 HOH 21 621 310 HOH HOH A . V 9 HOH 22 622 331 HOH HOH A . V 9 HOH 23 623 13 HOH HOH A . V 9 HOH 24 624 308 HOH HOH A . V 9 HOH 25 625 313 HOH HOH A . V 9 HOH 26 626 302 HOH HOH A . V 9 HOH 27 627 335 HOH HOH A . V 9 HOH 28 628 26 HOH HOH A . V 9 HOH 29 629 109 HOH HOH A . V 9 HOH 30 630 12 HOH HOH A . V 9 HOH 31 631 202 HOH HOH A . V 9 HOH 32 632 233 HOH HOH A . V 9 HOH 33 633 344 HOH HOH A . V 9 HOH 34 634 330 HOH HOH A . V 9 HOH 35 635 306 HOH HOH A . V 9 HOH 36 636 31 HOH HOH A . V 9 HOH 37 637 270 HOH HOH A . V 9 HOH 38 638 231 HOH HOH A . V 9 HOH 39 639 304 HOH HOH A . V 9 HOH 40 640 111 HOH HOH A . V 9 HOH 41 641 11 HOH HOH A . V 9 HOH 42 642 343 HOH HOH A . V 9 HOH 43 643 104 HOH HOH A . V 9 HOH 44 644 7 HOH HOH A . V 9 HOH 45 645 334 HOH HOH A . V 9 HOH 46 646 324 HOH HOH A . V 9 HOH 47 647 300 HOH HOH A . V 9 HOH 48 648 326 HOH HOH A . V 9 HOH 49 649 329 HOH HOH A . V 9 HOH 50 650 341 HOH HOH A . V 9 HOH 51 651 319 HOH HOH A . V 9 HOH 52 652 321 HOH HOH A . V 9 HOH 53 653 325 HOH HOH A . V 9 HOH 54 654 336 HOH HOH A . V 9 HOH 55 655 328 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? xia2 ? ? ? 0.5.769 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? DIALS ? ? ? 1.12.5 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.7.3 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? 11.6.04 4 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot ? ? ? 0.8.9.1 5 ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0238 6 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25 7 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6THE _cell.details ? _cell.formula_units_Z ? _cell.length_a 125.141 _cell.length_a_esd ? _cell.length_b 125.141 _cell.length_b_esd ? _cell.length_c 125.141 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 24 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6THE _symmetry.cell_setting ? _symmetry.Int_Tables_number 197 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'I 2 3' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6THE _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.39 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 48.59 _exptl_crystal.description 'triangular pyramid' _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;10% (w/v) PEG 8,000, 20% (v/v) 1,5-pentanediol, 0.1 M MOPSO/Bis-Tris pH6.5, 0.005 M Yttrium (III) chloride hexahydrate, 0.005 M Erbium (III) chloride hexahydrate, 0.005 M Terbium (III) chloride hexahydrate, 0.005 M Ytterbium (III) chloride hexahydrate ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2019-02-17 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9686 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I24' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9686 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I24 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate 29.2 _reflns.entry_id 6THE _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.87 _reflns.d_resolution_low 39.57 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 7073 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 93.2 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 2.8 _reflns.pdbx_Rmerge_I_obs 0.219 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 3.5 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.275 _reflns.pdbx_Rpim_I_all 0.163 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.939 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.87 _reflns_shell.d_res_low 3.03 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.7 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 958 _reflns_shell.percent_possible_all 88.8 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.481 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 2.6 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 0.607 _reflns_shell.pdbx_Rpim_I_all 0.362 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.738 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] 0.0000 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][2] 0.0000 _refine.aniso_B[2][3] 0.0000 _refine.aniso_B[3][3] 0.0000 _refine.B_iso_max 58.370 _refine.B_iso_mean 23.8820 _refine.B_iso_min 1.720 _refine.correlation_coeff_Fo_to_Fc 0.8930 _refine.correlation_coeff_Fo_to_Fc_free 0.8750 _refine.details 'HYDROGENS HAVE BEEN USED IF PRESENT IN THE INPUT U VALUES : REFINED INDIVIDUALLY' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6THE _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.8700 _refine.ls_d_res_low 39.5700 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 6726 _refine.ls_number_reflns_R_free 330 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 92.6700 _refine.ls_percent_reflns_R_free 4.7000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2257 _refine.ls_R_factor_R_free 0.2344 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2253 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 2DV6 _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free 0.4160 _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 17.3210 _refine.overall_SU_ML 0.3250 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.8700 _refine_hist.d_res_low 39.5700 _refine_hist.number_atoms_solvent 55 _refine_hist.number_atoms_total 2367 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 299 _refine_hist.pdbx_B_iso_mean_ligand 32.79 _refine_hist.pdbx_B_iso_mean_solvent 17.96 _refine_hist.pdbx_number_atoms_protein 2250 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 62 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.002 0.012 2355 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.653 1.636 3191 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 5.870 5.000 298 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 28.341 22.667 105 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 13.663 15.000 341 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 10.431 15.000 10 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.050 0.200 294 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.002 0.020 1806 ? r_gen_planes_refined ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.8710 _refine_ls_shell.d_res_low 2.9450 _refine_ls_shell.number_reflns_all 483 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 24 _refine_ls_shell.number_reflns_R_work 459 _refine_ls_shell.percent_reflns_obs 87.0300 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.3270 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.2730 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 6THE _struct.title 'Crystal structure of core domain of four-domain heme-cupredoxin-Cu nitrite reductase from Bradyrhizobium sp. ORS 375' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6THE _struct_keywords.text 'Four domain Nir, Copper-heme containing nitrite reductase, Bradyrhizobium sp. ORS 375, electron transfer, OXIDOREDUCTASE' _struct_keywords.pdbx_keywords OXIDOREDUCTASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? E N N 3 ? F N N 3 ? G N N 4 ? H N N 4 ? I N N 4 ? J N N 4 ? K N N 5 ? L N N 6 ? M N N 6 ? N N N 7 ? O N N 8 ? P N N 8 ? Q N N 8 ? R N N 8 ? S N N 8 ? T N N 8 ? U N N 8 ? V N N 9 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code H0SHH5_BRAS3 _struct_ref.pdbx_db_accession H0SHH5 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;PQTVVEADISREPDDVPPPIGKRAPQTVRVDLLSVELEGRLAEGTTFGYWTFNGKVPGPLLRVRVGDTVEIHLKNAADSA MIHSVDFHAAIAPGGGAAALQVEPGGEKAITWKALVPGLFVYHCATPMVAEHIANGMYGMILVEPEGGLPPVDHEFYVMQ GEIYSDIPYGQHGSAEFSVEKLLAERPEYFVFNGSVGALSKLHPLKAKVGDTVRIFFGVGGPNHASSFHVIGEIFDKVDL FGGLTTPPLAGIQTVTVPPGGAAIAEFKVEVPGTYTLVDHALARAERGLLGILHVQGPENPDIYNGVALPGAGH ; _struct_ref.pdbx_align_begin 385 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6THE _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 315 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession H0SHH5 _struct_ref_seq.db_align_beg 385 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 698 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 315 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6THE MET A 1 ? UNP H0SHH5 ? ? 'initiating methionine' 1 1 1 6THE GLU A 316 ? UNP H0SHH5 ? ? 'expression tag' 316 2 1 6THE ASN A 317 ? UNP H0SHH5 ? ? 'expression tag' 317 3 1 6THE LEU A 318 ? UNP H0SHH5 ? ? 'expression tag' 318 4 1 6THE TYR A 319 ? UNP H0SHH5 ? ? 'expression tag' 319 5 1 6THE PHE A 320 ? UNP H0SHH5 ? ? 'expression tag' 320 6 1 6THE GLN A 321 ? UNP H0SHH5 ? ? 'expression tag' 321 7 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details trimeric _pdbx_struct_assembly.oligomeric_count 3 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 15280 ? 1 MORE -282 ? 1 'SSA (A^2)' 29180 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U,V # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 6_555 z,-x,-y 0.0000000000 0.0000000000 1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 3 'crystal symmetry operation' 12_555 -y,-z,x 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ALA A 93 ? LEU A 101 ? ALA A 93 LEU A 101 5 ? 9 HELX_P HELX_P2 AA2 MET A 129 ? ASN A 136 ? MET A 129 ASN A 136 1 ? 8 HELX_P HELX_P3 AA3 SER A 179 ? GLU A 186 ? SER A 179 GLU A 186 1 ? 8 HELX_P HELX_P4 AA4 ALA A 284 ? ARG A 288 ? ALA A 284 ARG A 288 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A GLU 13 OE2 ? ? ? 1_555 D YB . YB ? ? A GLU 13 A YB 503 19_555 ? ? ? ? ? ? ? 2.817 ? ? metalc2 metalc ? ? A GLY 49 O ? ? ? 1_555 I ER3 . ER ? ? A GLY 49 A ER3 508 1_555 ? ? ? ? ? ? ? 3.436 ? ? metalc3 metalc ? ? A ARG 63 N ? ? ? 1_555 F YB . YB ? ? A ARG 63 A YB 505 1_555 ? ? ? ? ? ? ? 3.458 ? ? metalc4 metalc ? ? A HIS 84 ND1 ? ? ? 1_555 B CU . CU ? ? A HIS 84 A CU 501 1_555 ? ? ? ? ? ? ? 2.279 ? ? metalc5 metalc ? ? A HIS 89 NE2 ? ? ? 1_555 C CU . CU ? ? A HIS 89 A CU 502 1_555 ? ? ? ? ? ? ? 2.106 ? ? metalc6 metalc ? ? A HIS 124 NE2 ? ? ? 1_555 C CU . CU ? ? A HIS 124 A CU 502 1_555 ? ? ? ? ? ? ? 2.032 ? ? metalc7 metalc ? ? A CYS 125 SG ? ? ? 1_555 B CU . CU ? ? A CYS 125 A CU 501 1_555 ? ? ? ? ? ? ? 2.246 ? ? metalc8 metalc ? ? A HIS 133 ND1 ? ? ? 1_555 B CU . CU ? ? A HIS 133 A CU 501 1_555 ? ? ? ? ? ? ? 2.151 ? ? metalc9 metalc ? ? A MET 138 SD ? ? ? 1_555 B CU . CU ? ? A MET 138 A CU 501 1_555 ? ? ? ? ? ? ? 2.488 ? ? metalc10 metalc ? ? A ASP 154 OD2 ? ? ? 1_555 K TB . TB ? ? A ASP 154 A TB 510 1_555 ? ? ? ? ? ? ? 2.276 ? ? metalc11 metalc ? ? A ASP 167 OD2 ? ? ? 1_555 H ER3 . ER ? ? A ASP 167 A ER3 507 22_545 ? ? ? ? ? ? ? 2.556 ? ? metalc12 metalc ? ? A GLU 177 OE1 ? ? ? 1_555 H ER3 . ER ? ? A GLU 177 A ER3 507 22_545 ? ? ? ? ? ? ? 3.048 ? ? metalc13 metalc ? ? A GLU 177 OE1 ? ? ? 1_555 K TB . TB ? ? A GLU 177 A TB 510 22_545 ? ? ? ? ? ? ? 2.573 ? ? metalc14 metalc ? ? A GLU 177 OE2 ? ? ? 1_555 K TB . TB ? ? A GLU 177 A TB 510 22_545 ? ? ? ? ? ? ? 3.228 ? ? metalc15 metalc ? ? A HIS 281 NE2 ? ? ? 1_555 C CU . CU ? ? A HIS 281 A CU 502 12_555 ? ? ? ? ? ? ? 2.193 ? ? metalc16 metalc ? ? C CU . CU ? ? ? 1_555 V HOH . O ? ? A CU 502 A HOH 610 1_555 ? ? ? ? ? ? ? 2.009 ? ? metalc17 metalc ? ? D YB . YB ? ? ? 1_555 T 9JE . O01 ? ? A YB 503 A 9JE 519 22_545 ? ? ? ? ? ? ? 3.077 ? ? metalc18 metalc ? ? D YB . YB ? ? ? 1_555 T 9JE . O07 ? ? A YB 503 A 9JE 519 22_545 ? ? ? ? ? ? ? 2.465 ? ? metalc19 metalc ? ? F YB . YB ? ? ? 1_555 V HOH . O ? ? A YB 505 A HOH 650 1_555 ? ? ? ? ? ? ? 2.796 ? ? metalc20 metalc ? ? H ER3 . ER ? ? ? 1_555 U 9JE . O07 ? ? A ER3 507 A 9JE 520 19_555 ? ? ? ? ? ? ? 2.953 ? ? metalc21 metalc ? ? K TB . TB ? ? ? 1_555 U 9JE . O07 ? ? A TB 510 A 9JE 520 19_555 ? ? ? ? ? ? ? 2.771 ? ? metalc22 metalc ? ? K TB . TB ? ? ? 1_555 U 9JE . O01 ? ? A TB 510 A 9JE 520 19_555 ? ? ? ? ? ? ? 2.336 ? ? metalc23 metalc ? ? L YT3 . Y ? ? ? 1_555 U 9JE . O07 ? ? A YT3 511 A 9JE 520 19_555 ? ? ? ? ? ? ? 3.103 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OE2 ? A GLU 13 ? A GLU 13 ? 1_555 YB ? D YB . ? A YB 503 ? 19_555 O01 ? T 9JE . ? A 9JE 519 ? 22_545 16.7 ? 2 OE2 ? A GLU 13 ? A GLU 13 ? 1_555 YB ? D YB . ? A YB 503 ? 19_555 O07 ? T 9JE . ? A 9JE 519 ? 22_545 16.4 ? 3 O01 ? T 9JE . ? A 9JE 519 ? 22_545 YB ? D YB . ? A YB 503 ? 19_555 O07 ? T 9JE . ? A 9JE 519 ? 22_545 5.1 ? 4 N ? A ARG 63 ? A ARG 63 ? 1_555 YB ? F YB . ? A YB 505 ? 1_555 O ? V HOH . ? A HOH 650 ? 1_555 147.2 ? 5 ND1 ? A HIS 84 ? A HIS 84 ? 1_555 CU ? B CU . ? A CU 501 ? 1_555 SG ? A CYS 125 ? A CYS 125 ? 1_555 130.0 ? 6 ND1 ? A HIS 84 ? A HIS 84 ? 1_555 CU ? B CU . ? A CU 501 ? 1_555 ND1 ? A HIS 133 ? A HIS 133 ? 1_555 104.8 ? 7 SG ? A CYS 125 ? A CYS 125 ? 1_555 CU ? B CU . ? A CU 501 ? 1_555 ND1 ? A HIS 133 ? A HIS 133 ? 1_555 105.0 ? 8 ND1 ? A HIS 84 ? A HIS 84 ? 1_555 CU ? B CU . ? A CU 501 ? 1_555 SD ? A MET 138 ? A MET 138 ? 1_555 83.6 ? 9 SG ? A CYS 125 ? A CYS 125 ? 1_555 CU ? B CU . ? A CU 501 ? 1_555 SD ? A MET 138 ? A MET 138 ? 1_555 110.2 ? 10 ND1 ? A HIS 133 ? A HIS 133 ? 1_555 CU ? B CU . ? A CU 501 ? 1_555 SD ? A MET 138 ? A MET 138 ? 1_555 124.6 ? 11 NE2 ? A HIS 89 ? A HIS 89 ? 1_555 CU ? C CU . ? A CU 502 ? 1_555 NE2 ? A HIS 124 ? A HIS 124 ? 1_555 107.1 ? 12 NE2 ? A HIS 89 ? A HIS 89 ? 1_555 CU ? C CU . ? A CU 502 ? 1_555 NE2 ? A HIS 281 ? A HIS 281 ? 1_555 69.8 ? 13 NE2 ? A HIS 124 ? A HIS 124 ? 1_555 CU ? C CU . ? A CU 502 ? 1_555 NE2 ? A HIS 281 ? A HIS 281 ? 1_555 96.9 ? 14 NE2 ? A HIS 89 ? A HIS 89 ? 1_555 CU ? C CU . ? A CU 502 ? 1_555 O ? V HOH . ? A HOH 610 ? 1_555 129.3 ? 15 NE2 ? A HIS 124 ? A HIS 124 ? 1_555 CU ? C CU . ? A CU 502 ? 1_555 O ? V HOH . ? A HOH 610 ? 1_555 105.9 ? 16 NE2 ? A HIS 281 ? A HIS 281 ? 1_555 CU ? C CU . ? A CU 502 ? 1_555 O ? V HOH . ? A HOH 610 ? 1_555 141.1 ? 17 OD2 ? A ASP 154 ? A ASP 154 ? 1_555 TB ? K TB . ? A TB 510 ? 1_555 OE1 ? A GLU 177 ? A GLU 177 ? 1_555 24.9 ? 18 OD2 ? A ASP 154 ? A ASP 154 ? 1_555 TB ? K TB . ? A TB 510 ? 1_555 OE2 ? A GLU 177 ? A GLU 177 ? 1_555 23.6 ? 19 OE1 ? A GLU 177 ? A GLU 177 ? 1_555 TB ? K TB . ? A TB 510 ? 1_555 OE2 ? A GLU 177 ? A GLU 177 ? 1_555 2.4 ? 20 OD2 ? A ASP 154 ? A ASP 154 ? 1_555 TB ? K TB . ? A TB 510 ? 1_555 O07 ? U 9JE . ? A 9JE 520 ? 19_555 132.6 ? 21 OE1 ? A GLU 177 ? A GLU 177 ? 1_555 TB ? K TB . ? A TB 510 ? 1_555 O07 ? U 9JE . ? A 9JE 520 ? 19_555 149.9 ? 22 OE2 ? A GLU 177 ? A GLU 177 ? 1_555 TB ? K TB . ? A TB 510 ? 1_555 O07 ? U 9JE . ? A 9JE 520 ? 19_555 147.5 ? 23 OD2 ? A ASP 154 ? A ASP 154 ? 1_555 TB ? K TB . ? A TB 510 ? 1_555 O01 ? U 9JE . ? A 9JE 520 ? 19_555 101.0 ? 24 OE1 ? A GLU 177 ? A GLU 177 ? 1_555 TB ? K TB . ? A TB 510 ? 1_555 O01 ? U 9JE . ? A 9JE 520 ? 19_555 76.9 ? 25 OE2 ? A GLU 177 ? A GLU 177 ? 1_555 TB ? K TB . ? A TB 510 ? 1_555 O01 ? U 9JE . ? A 9JE 520 ? 19_555 77.7 ? 26 O07 ? U 9JE . ? A 9JE 520 ? 19_555 TB ? K TB . ? A TB 510 ? 1_555 O01 ? U 9JE . ? A 9JE 520 ? 19_555 108.8 ? 27 OD2 ? A ASP 167 ? A ASP 167 ? 1_555 ER ? H ER3 . ? A ER3 507 ? 22_545 OE1 ? A GLU 177 ? A GLU 177 ? 1_555 90.8 ? 28 OD2 ? A ASP 167 ? A ASP 167 ? 1_555 ER ? H ER3 . ? A ER3 507 ? 22_545 O07 ? U 9JE . ? A 9JE 520 ? 19_555 70.0 ? 29 OE1 ? A GLU 177 ? A GLU 177 ? 1_555 ER ? H ER3 . ? A ER3 507 ? 22_545 O07 ? U 9JE . ? A 9JE 520 ? 19_555 84.3 ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 VAL 57 A . ? VAL 57 A PRO 58 A ? PRO 58 A 1 -1.49 2 PRO 128 A . ? PRO 128 A MET 129 A ? MET 129 A 1 -4.39 3 GLY 222 A . ? GLY 222 A PRO 223 A ? PRO 223 A 1 6.44 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 4 ? AA3 ? 6 ? AA4 ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? parallel AA1 3 4 ? anti-parallel AA1 4 5 ? parallel AA2 1 2 ? parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? parallel AA3 3 4 ? anti-parallel AA3 4 5 ? anti-parallel AA3 5 6 ? anti-parallel AA4 1 2 ? parallel AA4 2 3 ? anti-parallel AA4 3 4 ? anti-parallel AA4 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLU A 108 ? LYS A 114 ? GLU A 108 LYS A 114 AA1 2 THR A 69 ? ASN A 76 ? THR A 69 ASN A 76 AA1 3 THR A 28 ? ALA A 43 ? THR A 28 ALA A 43 AA1 4 THR A 46 ? PHE A 53 ? THR A 46 PHE A 53 AA1 5 GLY A 174 ? ALA A 176 ? GLY A 174 ALA A 176 AA2 1 LEU A 62 ? ARG A 65 ? LEU A 62 ARG A 65 AA2 2 TYR A 139 ? GLU A 145 ? TYR A 139 GLU A 145 AA2 3 GLY A 119 ? HIS A 124 ? GLY A 119 HIS A 124 AA2 4 ASP A 87 ? PHE A 88 ? ASP A 87 PHE A 88 AA3 1 TYR A 190 ? PHE A 193 ? TYR A 190 PHE A 193 AA3 2 HIS A 155 ? ILE A 164 ? HIS A 155 ILE A 164 AA3 3 THR A 213 ? GLY A 222 ? THR A 213 GLY A 222 AA3 4 ALA A 263 ? LYS A 269 ? ALA A 263 LYS A 269 AA3 5 PHE A 236 ? LEU A 241 ? PHE A 236 LEU A 241 AA3 6 LEU A 250 ? ILE A 253 ? LEU A 250 ILE A 253 AA4 1 LEU A 206 ? LYS A 209 ? LEU A 206 LYS A 209 AA4 2 GLY A 292 ? GLN A 297 ? GLY A 292 GLN A 297 AA4 3 GLY A 274 ? ASP A 280 ? GLY A 274 ASP A 280 AA4 4 SER A 227 ? ILE A 232 ? SER A 227 ILE A 232 AA4 5 VAL A 256 ? VAL A 258 ? VAL A 256 VAL A 258 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O TRP A 113 ? O TRP A 113 N VAL A 70 ? N VAL A 70 AA1 2 3 O GLU A 71 ? O GLU A 71 N VAL A 29 ? N VAL A 29 AA1 3 4 N VAL A 36 ? N VAL A 36 O THR A 52 ? O THR A 52 AA1 4 5 N THR A 47 ? N THR A 47 O ALA A 176 ? O ALA A 176 AA2 1 2 N VAL A 64 ? N VAL A 64 O GLU A 145 ? O GLU A 145 AA2 2 3 O GLY A 140 ? O GLY A 140 N TYR A 123 ? N TYR A 123 AA2 3 4 O HIS A 124 ? O HIS A 124 N ASP A 87 ? N ASP A 87 AA3 1 2 O TYR A 190 ? O TYR A 190 N ILE A 164 ? N ILE A 164 AA3 2 3 N PHE A 157 ? N PHE A 157 O PHE A 217 ? O PHE A 217 AA3 3 4 N VAL A 214 ? N VAL A 214 O PHE A 268 ? O PHE A 268 AA3 4 5 O GLU A 267 ? O GLU A 267 N LYS A 238 ? N LYS A 238 AA3 5 6 N VAL A 239 ? N VAL A 239 O LEU A 250 ? O LEU A 250 AA4 1 2 N LEU A 206 ? N LEU A 206 O HIS A 295 ? O HIS A 295 AA4 2 3 O LEU A 294 ? O LEU A 294 N TYR A 276 ? N TYR A 276 AA4 3 4 O THR A 277 ? O THR A 277 N ILE A 232 ? N ILE A 232 AA4 4 5 N SER A 227 ? N SER A 227 O VAL A 258 ? O VAL A 258 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A CU 501 ? 4 'binding site for residue CU A 501' AC2 Software A CU 502 ? 5 'binding site for residue CU A 502' AC3 Software A YB 503 ? 2 'binding site for residue YB A 503' AC4 Software A YB 505 ? 2 'binding site for residue YB A 505' AC5 Software A ER3 506 ? 1 'binding site for residue ER3 A 506' AC6 Software A ER3 507 ? 4 'binding site for residue ER3 A 507' AC7 Software A ER3 508 ? 1 'binding site for residue ER3 A 508' AC8 Software A TB 510 ? 5 'binding site for residue TB A 510' AC9 Software A YT3 511 ? 4 'binding site for residue YT3 A 511' AD1 Software A YT3 512 ? 1 'binding site for residue YT3 A 512' AD2 Software A CL 513 ? 1 'binding site for residue CL A 513' AD3 Software A 9JE 514 ? 2 'binding site for residue 9JE A 514' AD4 Software A 9JE 515 ? 3 'binding site for residue 9JE A 515' AD5 Software A 9JE 516 ? 1 'binding site for residue 9JE A 516' AD6 Software A 9JE 517 ? 3 'binding site for residue 9JE A 517' AD7 Software A 9JE 518 ? 2 'binding site for residue 9JE A 518' AD8 Software A 9JE 519 ? 5 'binding site for residue 9JE A 519' AD9 Software A 9JE 520 ? 8 'binding site for residue 9JE A 520' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 HIS A 84 ? HIS A 84 . ? 1_555 ? 2 AC1 4 CYS A 125 ? CYS A 125 . ? 1_555 ? 3 AC1 4 HIS A 133 ? HIS A 133 . ? 1_555 ? 4 AC1 4 MET A 138 ? MET A 138 . ? 1_555 ? 5 AC2 5 ASP A 87 ? ASP A 87 . ? 1_555 ? 6 AC2 5 HIS A 89 ? HIS A 89 . ? 1_555 ? 7 AC2 5 HIS A 124 ? HIS A 124 . ? 1_555 ? 8 AC2 5 HIS A 281 ? HIS A 281 . ? 6_555 ? 9 AC2 5 HOH V . ? HOH A 610 . ? 1_555 ? 10 AC3 2 GLU A 13 ? GLU A 13 . ? 22_545 ? 11 AC3 2 9JE T . ? 9JE A 519 . ? 22_545 ? 12 AC4 2 ARG A 63 ? ARG A 63 . ? 1_555 ? 13 AC4 2 HOH V . ? HOH A 650 . ? 1_555 ? 14 AC5 1 ARG A 30 ? ARG A 30 . ? 1_555 ? 15 AC6 4 ASP A 167 ? ASP A 167 . ? 19_555 ? 16 AC6 4 GLU A 177 ? GLU A 177 . ? 19_555 ? 17 AC6 4 TB K . ? TB A 510 . ? 1_555 ? 18 AC6 4 9JE U . ? 9JE A 520 . ? 19_555 ? 19 AC7 1 GLY A 49 ? GLY A 49 . ? 1_555 ? 20 AC8 5 ASP A 154 ? ASP A 154 . ? 1_555 ? 21 AC8 5 GLU A 177 ? GLU A 177 . ? 19_555 ? 22 AC8 5 ER3 H . ? ER3 A 507 . ? 1_555 ? 23 AC8 5 YT3 L . ? YT3 A 511 . ? 1_555 ? 24 AC8 5 9JE U . ? 9JE A 520 . ? 19_555 ? 25 AC9 4 ASP A 167 ? ASP A 167 . ? 19_555 ? 26 AC9 4 GLU A 177 ? GLU A 177 . ? 19_555 ? 27 AC9 4 TB K . ? TB A 510 . ? 1_555 ? 28 AC9 4 9JE U . ? 9JE A 520 . ? 19_555 ? 29 AD1 1 VAL A 17 ? VAL A 17 . ? 1_555 ? 30 AD2 1 ASN A 54 ? ASN A 54 . ? 1_555 ? 31 AD3 2 ASP A 79 ? ASP A 79 . ? 1_555 ? 32 AD3 2 HOH V . ? HOH A 604 . ? 1_555 ? 33 AD4 3 THR A 28 ? THR A 28 . ? 1_555 ? 34 AD4 3 ARG A 30 ? ARG A 30 . ? 1_555 ? 35 AD4 3 GLU A 71 ? GLU A 71 . ? 1_555 ? 36 AD5 1 PRO A 128 ? PRO A 128 . ? 1_555 ? 37 AD6 3 PRO A 18 ? PRO A 18 . ? 1_555 ? 38 AD6 3 ASP A 32 ? ASP A 32 . ? 1_555 ? 39 AD6 3 LEU A 61 ? LEU A 61 . ? 1_555 ? 40 AD7 2 ARG A 30 ? ARG A 30 . ? 1_555 ? 41 AD7 2 GLU A 108 ? GLU A 108 . ? 1_555 ? 42 AD8 5 ASP A 15 ? ASP A 15 . ? 1_555 ? 43 AD8 5 ALA A 81 ? ALA A 81 . ? 19_555 ? 44 AD8 5 GLU A 104 ? GLU A 104 . ? 19_555 ? 45 AD8 5 PRO A 205 ? PRO A 205 . ? 1_555 ? 46 AD8 5 YB D . ? YB A 503 . ? 19_555 ? 47 AD9 8 ASP A 154 ? ASP A 154 . ? 22_545 ? 48 AD9 8 GLU A 177 ? GLU A 177 . ? 1_555 ? 49 AD9 8 VAL A 210 ? VAL A 210 . ? 22_545 ? 50 AD9 8 GLY A 211 ? GLY A 211 . ? 22_545 ? 51 AD9 8 ASP A 212 ? ASP A 212 . ? 22_545 ? 52 AD9 8 ER3 H . ? ER3 A 507 . ? 22_545 ? 53 AD9 8 TB K . ? TB A 510 . ? 22_545 ? 54 AD9 8 YT3 L . ? YT3 A 511 . ? 22_545 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 TYR A 165 ? ? -103.81 68.73 2 1 SER A 201 ? ? -114.53 -72.82 3 1 LEU A 203 ? ? -86.50 -71.62 4 1 THR A 246 ? ? -121.20 -53.05 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id ER3 _pdbx_struct_special_symmetry.auth_seq_id 509 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id J _pdbx_struct_special_symmetry.label_comp_id ER3 _pdbx_struct_special_symmetry.label_seq_id . # _pdbx_entry_details.entry_id 6THE _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # _pdbx_distant_solvent_atoms.id 1 _pdbx_distant_solvent_atoms.PDB_model_num 1 _pdbx_distant_solvent_atoms.auth_atom_id O _pdbx_distant_solvent_atoms.label_alt_id ? _pdbx_distant_solvent_atoms.auth_asym_id A _pdbx_distant_solvent_atoms.auth_comp_id HOH _pdbx_distant_solvent_atoms.auth_seq_id 655 _pdbx_distant_solvent_atoms.PDB_ins_code ? _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 6.12 _pdbx_distant_solvent_atoms.neighbor_ligand_distance . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A PRO 2 ? A PRO 2 3 1 Y 1 A GLN 3 ? A GLN 3 4 1 Y 1 A THR 4 ? A THR 4 5 1 Y 1 A VAL 5 ? A VAL 5 6 1 Y 1 A VAL 6 ? A VAL 6 7 1 Y 1 A GLU 7 ? A GLU 7 8 1 Y 1 A GLY 307 ? A GLY 307 9 1 Y 1 A VAL 308 ? A VAL 308 10 1 Y 1 A ALA 309 ? A ALA 309 11 1 Y 1 A LEU 310 ? A LEU 310 12 1 Y 1 A PRO 311 ? A PRO 311 13 1 Y 1 A GLY 312 ? A GLY 312 14 1 Y 1 A ALA 313 ? A ALA 313 15 1 Y 1 A GLY 314 ? A GLY 314 16 1 Y 1 A HIS 315 ? A HIS 315 17 1 Y 1 A GLU 316 ? A GLU 316 18 1 Y 1 A ASN 317 ? A ASN 317 19 1 Y 1 A LEU 318 ? A LEU 318 20 1 Y 1 A TYR 319 ? A TYR 319 21 1 Y 1 A PHE 320 ? A PHE 320 22 1 Y 1 A GLN 321 ? A GLN 321 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal 9JE C02 C N N 1 9JE C03 C N N 2 9JE C04 C N N 3 9JE C05 C N N 4 9JE C06 C N N 5 9JE O01 O N N 6 9JE O07 O N N 7 9JE H1 H N N 8 9JE H2 H N N 9 9JE H3 H N N 10 9JE H4 H N N 11 9JE H5 H N N 12 9JE H6 H N N 13 9JE H7 H N N 14 9JE H8 H N N 15 9JE H9 H N N 16 9JE H10 H N N 17 9JE H11 H N N 18 9JE H12 H N N 19 ALA N N N N 20 ALA CA C N S 21 ALA C C N N 22 ALA O O N N 23 ALA CB C N N 24 ALA OXT O N N 25 ALA H H N N 26 ALA H2 H N N 27 ALA HA H N N 28 ALA HB1 H N N 29 ALA HB2 H N N 30 ALA HB3 H N N 31 ALA HXT H N N 32 ARG N N N N 33 ARG CA C N S 34 ARG C C N N 35 ARG O O N N 36 ARG CB C N N 37 ARG CG C N N 38 ARG CD C N N 39 ARG NE N N N 40 ARG CZ C N N 41 ARG NH1 N N N 42 ARG NH2 N N N 43 ARG OXT O N N 44 ARG H H N N 45 ARG H2 H N N 46 ARG HA H N N 47 ARG HB2 H N N 48 ARG HB3 H N N 49 ARG HG2 H N N 50 ARG HG3 H N N 51 ARG HD2 H N N 52 ARG HD3 H N N 53 ARG HE H N N 54 ARG HH11 H N N 55 ARG HH12 H N N 56 ARG HH21 H N N 57 ARG HH22 H N N 58 ARG HXT H N N 59 ASN N N N N 60 ASN CA C N S 61 ASN C C N N 62 ASN O O N N 63 ASN CB C N N 64 ASN CG C N N 65 ASN OD1 O N N 66 ASN ND2 N N N 67 ASN OXT O N N 68 ASN H H N N 69 ASN H2 H N N 70 ASN HA H N N 71 ASN HB2 H N N 72 ASN HB3 H N N 73 ASN HD21 H N N 74 ASN HD22 H N N 75 ASN HXT H N N 76 ASP N N N N 77 ASP CA C N S 78 ASP C C N N 79 ASP O O N N 80 ASP CB C N N 81 ASP CG C N N 82 ASP OD1 O N N 83 ASP OD2 O N N 84 ASP OXT O N N 85 ASP H H N N 86 ASP H2 H N N 87 ASP HA H N N 88 ASP HB2 H N N 89 ASP HB3 H N N 90 ASP HD2 H N N 91 ASP HXT H N N 92 CL CL CL N N 93 CU CU CU N N 94 CYS N N N N 95 CYS CA C N R 96 CYS C C N N 97 CYS O O N N 98 CYS CB C N N 99 CYS SG S N N 100 CYS OXT O N N 101 CYS H H N N 102 CYS H2 H N N 103 CYS HA H N N 104 CYS HB2 H N N 105 CYS HB3 H N N 106 CYS HG H N N 107 CYS HXT H N N 108 ER3 ER ER N N 109 GLN N N N N 110 GLN CA C N S 111 GLN C C N N 112 GLN O O N N 113 GLN CB C N N 114 GLN CG C N N 115 GLN CD C N N 116 GLN OE1 O N N 117 GLN NE2 N N N 118 GLN OXT O N N 119 GLN H H N N 120 GLN H2 H N N 121 GLN HA H N N 122 GLN HB2 H N N 123 GLN HB3 H N N 124 GLN HG2 H N N 125 GLN HG3 H N N 126 GLN HE21 H N N 127 GLN HE22 H N N 128 GLN HXT H N N 129 GLU N N N N 130 GLU CA C N S 131 GLU C C N N 132 GLU O O N N 133 GLU CB C N N 134 GLU CG C N N 135 GLU CD C N N 136 GLU OE1 O N N 137 GLU OE2 O N N 138 GLU OXT O N N 139 GLU H H N N 140 GLU H2 H N N 141 GLU HA H N N 142 GLU HB2 H N N 143 GLU HB3 H N N 144 GLU HG2 H N N 145 GLU HG3 H N N 146 GLU HE2 H N N 147 GLU HXT H N N 148 GLY N N N N 149 GLY CA C N N 150 GLY C C N N 151 GLY O O N N 152 GLY OXT O N N 153 GLY H H N N 154 GLY H2 H N N 155 GLY HA2 H N N 156 GLY HA3 H N N 157 GLY HXT H N N 158 HIS N N N N 159 HIS CA C N S 160 HIS C C N N 161 HIS O O N N 162 HIS CB C N N 163 HIS CG C Y N 164 HIS ND1 N Y N 165 HIS CD2 C Y N 166 HIS CE1 C Y N 167 HIS NE2 N Y N 168 HIS OXT O N N 169 HIS H H N N 170 HIS H2 H N N 171 HIS HA H N N 172 HIS HB2 H N N 173 HIS HB3 H N N 174 HIS HD1 H N N 175 HIS HD2 H N N 176 HIS HE1 H N N 177 HIS HE2 H N N 178 HIS HXT H N N 179 HOH O O N N 180 HOH H1 H N N 181 HOH H2 H N N 182 ILE N N N N 183 ILE CA C N S 184 ILE C C N N 185 ILE O O N N 186 ILE CB C N S 187 ILE CG1 C N N 188 ILE CG2 C N N 189 ILE CD1 C N N 190 ILE OXT O N N 191 ILE H H N N 192 ILE H2 H N N 193 ILE HA H N N 194 ILE HB H N N 195 ILE HG12 H N N 196 ILE HG13 H N N 197 ILE HG21 H N N 198 ILE HG22 H N N 199 ILE HG23 H N N 200 ILE HD11 H N N 201 ILE HD12 H N N 202 ILE HD13 H N N 203 ILE HXT H N N 204 LEU N N N N 205 LEU CA C N S 206 LEU C C N N 207 LEU O O N N 208 LEU CB C N N 209 LEU CG C N N 210 LEU CD1 C N N 211 LEU CD2 C N N 212 LEU OXT O N N 213 LEU H H N N 214 LEU H2 H N N 215 LEU HA H N N 216 LEU HB2 H N N 217 LEU HB3 H N N 218 LEU HG H N N 219 LEU HD11 H N N 220 LEU HD12 H N N 221 LEU HD13 H N N 222 LEU HD21 H N N 223 LEU HD22 H N N 224 LEU HD23 H N N 225 LEU HXT H N N 226 LYS N N N N 227 LYS CA C N S 228 LYS C C N N 229 LYS O O N N 230 LYS CB C N N 231 LYS CG C N N 232 LYS CD C N N 233 LYS CE C N N 234 LYS NZ N N N 235 LYS OXT O N N 236 LYS H H N N 237 LYS H2 H N N 238 LYS HA H N N 239 LYS HB2 H N N 240 LYS HB3 H N N 241 LYS HG2 H N N 242 LYS HG3 H N N 243 LYS HD2 H N N 244 LYS HD3 H N N 245 LYS HE2 H N N 246 LYS HE3 H N N 247 LYS HZ1 H N N 248 LYS HZ2 H N N 249 LYS HZ3 H N N 250 LYS HXT H N N 251 MET N N N N 252 MET CA C N S 253 MET C C N N 254 MET O O N N 255 MET CB C N N 256 MET CG C N N 257 MET SD S N N 258 MET CE C N N 259 MET OXT O N N 260 MET H H N N 261 MET H2 H N N 262 MET HA H N N 263 MET HB2 H N N 264 MET HB3 H N N 265 MET HG2 H N N 266 MET HG3 H N N 267 MET HE1 H N N 268 MET HE2 H N N 269 MET HE3 H N N 270 MET HXT H N N 271 PHE N N N N 272 PHE CA C N S 273 PHE C C N N 274 PHE O O N N 275 PHE CB C N N 276 PHE CG C Y N 277 PHE CD1 C Y N 278 PHE CD2 C Y N 279 PHE CE1 C Y N 280 PHE CE2 C Y N 281 PHE CZ C Y N 282 PHE OXT O N N 283 PHE H H N N 284 PHE H2 H N N 285 PHE HA H N N 286 PHE HB2 H N N 287 PHE HB3 H N N 288 PHE HD1 H N N 289 PHE HD2 H N N 290 PHE HE1 H N N 291 PHE HE2 H N N 292 PHE HZ H N N 293 PHE HXT H N N 294 PRO N N N N 295 PRO CA C N S 296 PRO C C N N 297 PRO O O N N 298 PRO CB C N N 299 PRO CG C N N 300 PRO CD C N N 301 PRO OXT O N N 302 PRO H H N N 303 PRO HA H N N 304 PRO HB2 H N N 305 PRO HB3 H N N 306 PRO HG2 H N N 307 PRO HG3 H N N 308 PRO HD2 H N N 309 PRO HD3 H N N 310 PRO HXT H N N 311 SER N N N N 312 SER CA C N S 313 SER C C N N 314 SER O O N N 315 SER CB C N N 316 SER OG O N N 317 SER OXT O N N 318 SER H H N N 319 SER H2 H N N 320 SER HA H N N 321 SER HB2 H N N 322 SER HB3 H N N 323 SER HG H N N 324 SER HXT H N N 325 TB TB TB N N 326 THR N N N N 327 THR CA C N S 328 THR C C N N 329 THR O O N N 330 THR CB C N R 331 THR OG1 O N N 332 THR CG2 C N N 333 THR OXT O N N 334 THR H H N N 335 THR H2 H N N 336 THR HA H N N 337 THR HB H N N 338 THR HG1 H N N 339 THR HG21 H N N 340 THR HG22 H N N 341 THR HG23 H N N 342 THR HXT H N N 343 TRP N N N N 344 TRP CA C N S 345 TRP C C N N 346 TRP O O N N 347 TRP CB C N N 348 TRP CG C Y N 349 TRP CD1 C Y N 350 TRP CD2 C Y N 351 TRP NE1 N Y N 352 TRP CE2 C Y N 353 TRP CE3 C Y N 354 TRP CZ2 C Y N 355 TRP CZ3 C Y N 356 TRP CH2 C Y N 357 TRP OXT O N N 358 TRP H H N N 359 TRP H2 H N N 360 TRP HA H N N 361 TRP HB2 H N N 362 TRP HB3 H N N 363 TRP HD1 H N N 364 TRP HE1 H N N 365 TRP HE3 H N N 366 TRP HZ2 H N N 367 TRP HZ3 H N N 368 TRP HH2 H N N 369 TRP HXT H N N 370 TYR N N N N 371 TYR CA C N S 372 TYR C C N N 373 TYR O O N N 374 TYR CB C N N 375 TYR CG C Y N 376 TYR CD1 C Y N 377 TYR CD2 C Y N 378 TYR CE1 C Y N 379 TYR CE2 C Y N 380 TYR CZ C Y N 381 TYR OH O N N 382 TYR OXT O N N 383 TYR H H N N 384 TYR H2 H N N 385 TYR HA H N N 386 TYR HB2 H N N 387 TYR HB3 H N N 388 TYR HD1 H N N 389 TYR HD2 H N N 390 TYR HE1 H N N 391 TYR HE2 H N N 392 TYR HH H N N 393 TYR HXT H N N 394 VAL N N N N 395 VAL CA C N S 396 VAL C C N N 397 VAL O O N N 398 VAL CB C N N 399 VAL CG1 C N N 400 VAL CG2 C N N 401 VAL OXT O N N 402 VAL H H N N 403 VAL H2 H N N 404 VAL HA H N N 405 VAL HB H N N 406 VAL HG11 H N N 407 VAL HG12 H N N 408 VAL HG13 H N N 409 VAL HG21 H N N 410 VAL HG22 H N N 411 VAL HG23 H N N 412 VAL HXT H N N 413 YB YB YB N N 414 YT3 Y Y N N 415 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal 9JE O01 C02 sing N N 1 9JE C02 C03 sing N N 2 9JE C03 C04 sing N N 3 9JE C04 C05 sing N N 4 9JE C05 C06 sing N N 5 9JE O07 C06 sing N N 6 9JE C02 H1 sing N N 7 9JE C02 H2 sing N N 8 9JE C03 H3 sing N N 9 9JE C03 H4 sing N N 10 9JE C04 H5 sing N N 11 9JE C04 H6 sing N N 12 9JE C05 H7 sing N N 13 9JE C05 H8 sing N N 14 9JE C06 H9 sing N N 15 9JE C06 H10 sing N N 16 9JE O01 H11 sing N N 17 9JE O07 H12 sing N N 18 ALA N CA sing N N 19 ALA N H sing N N 20 ALA N H2 sing N N 21 ALA CA C sing N N 22 ALA CA CB sing N N 23 ALA CA HA sing N N 24 ALA C O doub N N 25 ALA C OXT sing N N 26 ALA CB HB1 sing N N 27 ALA CB HB2 sing N N 28 ALA CB HB3 sing N N 29 ALA OXT HXT sing N N 30 ARG N CA sing N N 31 ARG N H sing N N 32 ARG N H2 sing N N 33 ARG CA C sing N N 34 ARG CA CB sing N N 35 ARG CA HA sing N N 36 ARG C O doub N N 37 ARG C OXT sing N N 38 ARG CB CG sing N N 39 ARG CB HB2 sing N N 40 ARG CB HB3 sing N N 41 ARG CG CD sing N N 42 ARG CG HG2 sing N N 43 ARG CG HG3 sing N N 44 ARG CD NE sing N N 45 ARG CD HD2 sing N N 46 ARG CD HD3 sing N N 47 ARG NE CZ sing N N 48 ARG NE HE sing N N 49 ARG CZ NH1 sing N N 50 ARG CZ NH2 doub N N 51 ARG NH1 HH11 sing N N 52 ARG NH1 HH12 sing N N 53 ARG NH2 HH21 sing N N 54 ARG NH2 HH22 sing N N 55 ARG OXT HXT sing N N 56 ASN N CA sing N N 57 ASN N H sing N N 58 ASN N H2 sing N N 59 ASN CA C sing N N 60 ASN CA CB sing N N 61 ASN CA HA sing N N 62 ASN C O doub N N 63 ASN C OXT sing N N 64 ASN CB CG sing N N 65 ASN CB HB2 sing N N 66 ASN CB HB3 sing N N 67 ASN CG OD1 doub N N 68 ASN CG ND2 sing N N 69 ASN ND2 HD21 sing N N 70 ASN ND2 HD22 sing N N 71 ASN OXT HXT sing N N 72 ASP N CA sing N N 73 ASP N H sing N N 74 ASP N H2 sing N N 75 ASP CA C sing N N 76 ASP CA CB sing N N 77 ASP CA HA sing N N 78 ASP C O doub N N 79 ASP C OXT sing N N 80 ASP CB CG sing N N 81 ASP CB HB2 sing N N 82 ASP CB HB3 sing N N 83 ASP CG OD1 doub N N 84 ASP CG OD2 sing N N 85 ASP OD2 HD2 sing N N 86 ASP OXT HXT sing N N 87 CYS N CA sing N N 88 CYS N H sing N N 89 CYS N H2 sing N N 90 CYS CA C sing N N 91 CYS CA CB sing N N 92 CYS CA HA sing N N 93 CYS C O doub N N 94 CYS C OXT sing N N 95 CYS CB SG sing N N 96 CYS CB HB2 sing N N 97 CYS CB HB3 sing N N 98 CYS SG HG sing N N 99 CYS OXT HXT sing N N 100 GLN N CA sing N N 101 GLN N H sing N N 102 GLN N H2 sing N N 103 GLN CA C sing N N 104 GLN CA CB sing N N 105 GLN CA HA sing N N 106 GLN C O doub N N 107 GLN C OXT sing N N 108 GLN CB CG sing N N 109 GLN CB HB2 sing N N 110 GLN CB HB3 sing N N 111 GLN CG CD sing N N 112 GLN CG HG2 sing N N 113 GLN CG HG3 sing N N 114 GLN CD OE1 doub N N 115 GLN CD NE2 sing N N 116 GLN NE2 HE21 sing N N 117 GLN NE2 HE22 sing N N 118 GLN OXT HXT sing N N 119 GLU N CA sing N N 120 GLU N H sing N N 121 GLU N H2 sing N N 122 GLU CA C sing N N 123 GLU CA CB sing N N 124 GLU CA HA sing N N 125 GLU C O doub N N 126 GLU C OXT sing N N 127 GLU CB CG sing N N 128 GLU CB HB2 sing N N 129 GLU CB HB3 sing N N 130 GLU CG CD sing N N 131 GLU CG HG2 sing N N 132 GLU CG HG3 sing N N 133 GLU CD OE1 doub N N 134 GLU CD OE2 sing N N 135 GLU OE2 HE2 sing N N 136 GLU OXT HXT sing N N 137 GLY N CA sing N N 138 GLY N H sing N N 139 GLY N H2 sing N N 140 GLY CA C sing N N 141 GLY CA HA2 sing N N 142 GLY CA HA3 sing N N 143 GLY C O doub N N 144 GLY C OXT sing N N 145 GLY OXT HXT sing N N 146 HIS N CA sing N N 147 HIS N H sing N N 148 HIS N H2 sing N N 149 HIS CA C sing N N 150 HIS CA CB sing N N 151 HIS CA HA sing N N 152 HIS C O doub N N 153 HIS C OXT sing N N 154 HIS CB CG sing N N 155 HIS CB HB2 sing N N 156 HIS CB HB3 sing N N 157 HIS CG ND1 sing Y N 158 HIS CG CD2 doub Y N 159 HIS ND1 CE1 doub Y N 160 HIS ND1 HD1 sing N N 161 HIS CD2 NE2 sing Y N 162 HIS CD2 HD2 sing N N 163 HIS CE1 NE2 sing Y N 164 HIS CE1 HE1 sing N N 165 HIS NE2 HE2 sing N N 166 HIS OXT HXT sing N N 167 HOH O H1 sing N N 168 HOH O H2 sing N N 169 ILE N CA sing N N 170 ILE N H sing N N 171 ILE N H2 sing N N 172 ILE CA C sing N N 173 ILE CA CB sing N N 174 ILE CA HA sing N N 175 ILE C O doub N N 176 ILE C OXT sing N N 177 ILE CB CG1 sing N N 178 ILE CB CG2 sing N N 179 ILE CB HB sing N N 180 ILE CG1 CD1 sing N N 181 ILE CG1 HG12 sing N N 182 ILE CG1 HG13 sing N N 183 ILE CG2 HG21 sing N N 184 ILE CG2 HG22 sing N N 185 ILE CG2 HG23 sing N N 186 ILE CD1 HD11 sing N N 187 ILE CD1 HD12 sing N N 188 ILE CD1 HD13 sing N N 189 ILE OXT HXT sing N N 190 LEU N CA sing N N 191 LEU N H sing N N 192 LEU N H2 sing N N 193 LEU CA C sing N N 194 LEU CA CB sing N N 195 LEU CA HA sing N N 196 LEU C O doub N N 197 LEU C OXT sing N N 198 LEU CB CG sing N N 199 LEU CB HB2 sing N N 200 LEU CB HB3 sing N N 201 LEU CG CD1 sing N N 202 LEU CG CD2 sing N N 203 LEU CG HG sing N N 204 LEU CD1 HD11 sing N N 205 LEU CD1 HD12 sing N N 206 LEU CD1 HD13 sing N N 207 LEU CD2 HD21 sing N N 208 LEU CD2 HD22 sing N N 209 LEU CD2 HD23 sing N N 210 LEU OXT HXT sing N N 211 LYS N CA sing N N 212 LYS N H sing N N 213 LYS N H2 sing N N 214 LYS CA C sing N N 215 LYS CA CB sing N N 216 LYS CA HA sing N N 217 LYS C O doub N N 218 LYS C OXT sing N N 219 LYS CB CG sing N N 220 LYS CB HB2 sing N N 221 LYS CB HB3 sing N N 222 LYS CG CD sing N N 223 LYS CG HG2 sing N N 224 LYS CG HG3 sing N N 225 LYS CD CE sing N N 226 LYS CD HD2 sing N N 227 LYS CD HD3 sing N N 228 LYS CE NZ sing N N 229 LYS CE HE2 sing N N 230 LYS CE HE3 sing N N 231 LYS NZ HZ1 sing N N 232 LYS NZ HZ2 sing N N 233 LYS NZ HZ3 sing N N 234 LYS OXT HXT sing N N 235 MET N CA sing N N 236 MET N H sing N N 237 MET N H2 sing N N 238 MET CA C sing N N 239 MET CA CB sing N N 240 MET CA HA sing N N 241 MET C O doub N N 242 MET C OXT sing N N 243 MET CB CG sing N N 244 MET CB HB2 sing N N 245 MET CB HB3 sing N N 246 MET CG SD sing N N 247 MET CG HG2 sing N N 248 MET CG HG3 sing N N 249 MET SD CE sing N N 250 MET CE HE1 sing N N 251 MET CE HE2 sing N N 252 MET CE HE3 sing N N 253 MET OXT HXT sing N N 254 PHE N CA sing N N 255 PHE N H sing N N 256 PHE N H2 sing N N 257 PHE CA C sing N N 258 PHE CA CB sing N N 259 PHE CA HA sing N N 260 PHE C O doub N N 261 PHE C OXT sing N N 262 PHE CB CG sing N N 263 PHE CB HB2 sing N N 264 PHE CB HB3 sing N N 265 PHE CG CD1 doub Y N 266 PHE CG CD2 sing Y N 267 PHE CD1 CE1 sing Y N 268 PHE CD1 HD1 sing N N 269 PHE CD2 CE2 doub Y N 270 PHE CD2 HD2 sing N N 271 PHE CE1 CZ doub Y N 272 PHE CE1 HE1 sing N N 273 PHE CE2 CZ sing Y N 274 PHE CE2 HE2 sing N N 275 PHE CZ HZ sing N N 276 PHE OXT HXT sing N N 277 PRO N CA sing N N 278 PRO N CD sing N N 279 PRO N H sing N N 280 PRO CA C sing N N 281 PRO CA CB sing N N 282 PRO CA HA sing N N 283 PRO C O doub N N 284 PRO C OXT sing N N 285 PRO CB CG sing N N 286 PRO CB HB2 sing N N 287 PRO CB HB3 sing N N 288 PRO CG CD sing N N 289 PRO CG HG2 sing N N 290 PRO CG HG3 sing N N 291 PRO CD HD2 sing N N 292 PRO CD HD3 sing N N 293 PRO OXT HXT sing N N 294 SER N CA sing N N 295 SER N H sing N N 296 SER N H2 sing N N 297 SER CA C sing N N 298 SER CA CB sing N N 299 SER CA HA sing N N 300 SER C O doub N N 301 SER C OXT sing N N 302 SER CB OG sing N N 303 SER CB HB2 sing N N 304 SER CB HB3 sing N N 305 SER OG HG sing N N 306 SER OXT HXT sing N N 307 THR N CA sing N N 308 THR N H sing N N 309 THR N H2 sing N N 310 THR CA C sing N N 311 THR CA CB sing N N 312 THR CA HA sing N N 313 THR C O doub N N 314 THR C OXT sing N N 315 THR CB OG1 sing N N 316 THR CB CG2 sing N N 317 THR CB HB sing N N 318 THR OG1 HG1 sing N N 319 THR CG2 HG21 sing N N 320 THR CG2 HG22 sing N N 321 THR CG2 HG23 sing N N 322 THR OXT HXT sing N N 323 TRP N CA sing N N 324 TRP N H sing N N 325 TRP N H2 sing N N 326 TRP CA C sing N N 327 TRP CA CB sing N N 328 TRP CA HA sing N N 329 TRP C O doub N N 330 TRP C OXT sing N N 331 TRP CB CG sing N N 332 TRP CB HB2 sing N N 333 TRP CB HB3 sing N N 334 TRP CG CD1 doub Y N 335 TRP CG CD2 sing Y N 336 TRP CD1 NE1 sing Y N 337 TRP CD1 HD1 sing N N 338 TRP CD2 CE2 doub Y N 339 TRP CD2 CE3 sing Y N 340 TRP NE1 CE2 sing Y N 341 TRP NE1 HE1 sing N N 342 TRP CE2 CZ2 sing Y N 343 TRP CE3 CZ3 doub Y N 344 TRP CE3 HE3 sing N N 345 TRP CZ2 CH2 doub Y N 346 TRP CZ2 HZ2 sing N N 347 TRP CZ3 CH2 sing Y N 348 TRP CZ3 HZ3 sing N N 349 TRP CH2 HH2 sing N N 350 TRP OXT HXT sing N N 351 TYR N CA sing N N 352 TYR N H sing N N 353 TYR N H2 sing N N 354 TYR CA C sing N N 355 TYR CA CB sing N N 356 TYR CA HA sing N N 357 TYR C O doub N N 358 TYR C OXT sing N N 359 TYR CB CG sing N N 360 TYR CB HB2 sing N N 361 TYR CB HB3 sing N N 362 TYR CG CD1 doub Y N 363 TYR CG CD2 sing Y N 364 TYR CD1 CE1 sing Y N 365 TYR CD1 HD1 sing N N 366 TYR CD2 CE2 doub Y N 367 TYR CD2 HD2 sing N N 368 TYR CE1 CZ doub Y N 369 TYR CE1 HE1 sing N N 370 TYR CE2 CZ sing Y N 371 TYR CE2 HE2 sing N N 372 TYR CZ OH sing N N 373 TYR OH HH sing N N 374 TYR OXT HXT sing N N 375 VAL N CA sing N N 376 VAL N H sing N N 377 VAL N H2 sing N N 378 VAL CA C sing N N 379 VAL CA CB sing N N 380 VAL CA HA sing N N 381 VAL C O doub N N 382 VAL C OXT sing N N 383 VAL CB CG1 sing N N 384 VAL CB CG2 sing N N 385 VAL CB HB sing N N 386 VAL CG1 HG11 sing N N 387 VAL CG1 HG12 sing N N 388 VAL CG1 HG13 sing N N 389 VAL CG2 HG21 sing N N 390 VAL CG2 HG22 sing N N 391 VAL CG2 HG23 sing N N 392 VAL OXT HXT sing N N 393 # _pdbx_audit_support.funding_organization 'Biotechnology and Biological Sciences Research Council' _pdbx_audit_support.country 'United Kingdom' _pdbx_audit_support.grant_number BB/N013972/1 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2DV6 _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 6THE _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.007991 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.007991 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007991 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C CL CU ER N O S TB Y YB # loop_