data_6THI # _entry.id 6THI # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6THI pdb_00006thi 10.2210/pdb6thi/pdb WWPDB D_1292105490 ? ? BMRB 34453 ? ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Solution structure of MeuNaTxalpha-1 toxin from Mesobuthus Eupeus' _pdbx_database_related.db_id 34453 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 6THI _pdbx_database_status.recvd_initial_deposition_date 2019-11-20 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Mineev, K.S.' 1 ? 'Kuzmenkov, A.I.' 2 ? 'Khusainov, G.A.' 3 ? 'Arseniev, A.S.' 4 ? 'Vassilevski, A.A.' 5 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Proteins _citation.journal_id_ASTM PSFGEY _citation.journal_id_CSD 0867 _citation.journal_id_ISSN 1097-0134 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Structure of MeuNaTx alpha-1 toxin from scorpion venom highlights the importance of the nest motif.' _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1002/prot.26074 _citation.pdbx_database_id_PubMed 33713480 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Mineev, K.S.' 1 ? primary 'Kuzmenkov, A.I.' 2 ? primary 'Arseniev, A.S.' 3 ? primary 'Vassilevski, A.A.' 4 0000-0002-1359-0076 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Sodium channel neurotoxin MeuNaTxalpha-1' _entity.formula_weight 7196.148 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code VRDGYIADDKNCAYFCGRNAYCDEECKKKGAESGYCQWAGQYGNACWCYKLPDKVPIKVSGKCN _entity_poly.pdbx_seq_one_letter_code_can VRDGYIADDKNCAYFCGRNAYCDEECKKKGAESGYCQWAGQYGNACWCYKLPDKVPIKVSGKCN _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 VAL n 1 2 ARG n 1 3 ASP n 1 4 GLY n 1 5 TYR n 1 6 ILE n 1 7 ALA n 1 8 ASP n 1 9 ASP n 1 10 LYS n 1 11 ASN n 1 12 CYS n 1 13 ALA n 1 14 TYR n 1 15 PHE n 1 16 CYS n 1 17 GLY n 1 18 ARG n 1 19 ASN n 1 20 ALA n 1 21 TYR n 1 22 CYS n 1 23 ASP n 1 24 GLU n 1 25 GLU n 1 26 CYS n 1 27 LYS n 1 28 LYS n 1 29 LYS n 1 30 GLY n 1 31 ALA n 1 32 GLU n 1 33 SER n 1 34 GLY n 1 35 TYR n 1 36 CYS n 1 37 GLN n 1 38 TRP n 1 39 ALA n 1 40 GLY n 1 41 GLN n 1 42 TYR n 1 43 GLY n 1 44 ASN n 1 45 ALA n 1 46 CYS n 1 47 TRP n 1 48 CYS n 1 49 TYR n 1 50 LYS n 1 51 LEU n 1 52 PRO n 1 53 ASP n 1 54 LYS n 1 55 VAL n 1 56 PRO n 1 57 ILE n 1 58 LYS n 1 59 VAL n 1 60 SER n 1 61 GLY n 1 62 LYS n 1 63 CYS n 1 64 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 64 _entity_src_gen.gene_src_common_name 'Lesser Asian scorpion' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mesobuthus eupeus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 34648 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SCXN1_MESEU _struct_ref.pdbx_db_accession P86408 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code VRDGYIADDKNCAYFCGRNAYCDEECKKKGAESGYCQWAGQYGNACWCYKLPDKVPIKVSGKCN _struct_ref.pdbx_align_begin 20 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6THI _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 64 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P86408 _struct_ref_seq.db_align_beg 20 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 83 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 64 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-1H TOCSY' 1 isotropic 2 1 1 '2D 1H-1H NOESY' 1 isotropic 3 1 1 '2D DQF-COSY' 1 isotropic 4 1 1 '2D 1H-15N HSQC' 1 isotropic 5 1 1 '2D 1H-13C HSQC' 1 isotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 303 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7 _pdbx_nmr_exptl_sample_conditions.ionic_strength 30 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label conditions1 _pdbx_nmr_exptl_sample_conditions.pH_err 0.1 _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '2 mM MeuNaTx1, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' _pdbx_nmr_sample_details.label sample1 _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AVANCE III' _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.details ? # _pdbx_nmr_refine.entry_id 6THI _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 6THI _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 6THI _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'fewest violations' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 'structure calculation' CYANA 3.98 'Guntert P.' 2 'chemical shift assignment' CARA 1.9 'Keller and Wuthrich' 3 processing TopSpin 3.5 'Bruker Biospin' # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6THI _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 6THI _struct.title 'Solution structure of MeuNaTxalpha-1 toxin from Mesobuthus Eupeus' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6THI _struct_keywords.text 'Toxin, alpha-toxin, Sodium channel blocker' _struct_keywords.pdbx_keywords TOXIN # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id ARG _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 18 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id LYS _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 29 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ARG _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 18 _struct_conf.end_auth_comp_id LYS _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 29 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 12 SG ? ? ? 1_555 A CYS 63 SG ? ? A CYS 12 A CYS 63 1_555 ? ? ? ? ? ? ? 1.991 ? ? disulf2 disulf ? ? A CYS 16 SG ? ? ? 1_555 A CYS 22 SG ? ? A CYS 16 A CYS 22 1_555 ? ? ? ? ? ? ? 2.707 ? ? disulf3 disulf ? ? A CYS 16 SG ? ? ? 1_555 A CYS 36 SG ? ? A CYS 16 A CYS 36 1_555 ? ? ? ? ? ? ? 1.998 ? ? disulf4 disulf ? ? A CYS 22 SG ? ? ? 1_555 A CYS 46 SG ? ? A CYS 22 A CYS 46 1_555 ? ? ? ? ? ? ? 2.127 ? ? disulf5 disulf ? ? A CYS 26 SG ? ? ? 1_555 A CYS 48 SG ? ? A CYS 26 A CYS 48 1_555 ? ? ? ? ? ? ? 1.933 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ARG A 2 ? TYR A 5 ? ARG A 2 TYR A 5 AA1 2 ALA A 45 ? LEU A 51 ? ALA A 45 LEU A 51 AA1 3 SER A 33 ? GLN A 37 ? SER A 33 GLN A 37 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ARG A 2 ? N ARG A 2 O LEU A 51 ? O LEU A 51 AA1 2 3 O TRP A 47 ? O TRP A 47 N TYR A 35 ? N TYR A 35 # _atom_sites.entry_id 6THI _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 VAL 1 1 1 VAL VAL A . n A 1 2 ARG 2 2 2 ARG ARG A . n A 1 3 ASP 3 3 3 ASP ASP A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 TYR 5 5 5 TYR TYR A . n A 1 6 ILE 6 6 6 ILE ILE A . n A 1 7 ALA 7 7 7 ALA ALA A . n A 1 8 ASP 8 8 8 ASP ASP A . n A 1 9 ASP 9 9 9 ASP ASP A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 ASN 11 11 11 ASN ASN A . n A 1 12 CYS 12 12 12 CYS CYS A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 TYR 14 14 14 TYR TYR A . n A 1 15 PHE 15 15 15 PHE PHE A . n A 1 16 CYS 16 16 16 CYS CYS A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 ARG 18 18 18 ARG ARG A . n A 1 19 ASN 19 19 19 ASN ASN A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 TYR 21 21 21 TYR TYR A . n A 1 22 CYS 22 22 22 CYS CYS A . n A 1 23 ASP 23 23 23 ASP ASP A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 CYS 26 26 26 CYS CYS A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 TYR 35 35 35 TYR TYR A . n A 1 36 CYS 36 36 36 CYS CYS A . n A 1 37 GLN 37 37 37 GLN GLN A . n A 1 38 TRP 38 38 38 TRP TRP A . n A 1 39 ALA 39 39 39 ALA ALA A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 GLN 41 41 41 GLN GLN A . n A 1 42 TYR 42 42 42 TYR TYR A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 ASN 44 44 44 ASN ASN A . n A 1 45 ALA 45 45 45 ALA ALA A . n A 1 46 CYS 46 46 46 CYS CYS A . n A 1 47 TRP 47 47 47 TRP TRP A . n A 1 48 CYS 48 48 48 CYS CYS A . n A 1 49 TYR 49 49 49 TYR TYR A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 PRO 52 52 52 PRO PRO A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 PRO 56 56 56 PRO PRO A . n A 1 57 ILE 57 57 57 ILE ILE A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 VAL 59 59 59 VAL VAL A . n A 1 60 SER 60 60 60 SER SER A . n A 1 61 GLY 61 61 61 GLY GLY A . n A 1 62 LYS 62 62 62 LYS LYS A . n A 1 63 CYS 63 63 63 CYS CYS A . n A 1 64 ASN 64 64 64 ASN ASN A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 4210 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-12-02 2 'Structure model' 1 1 2021-04-28 3 'Structure model' 1 2 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' database_2 4 3 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.pdbx_database_id_DOI' 7 2 'Structure model' '_citation.pdbx_database_id_PubMed' 8 2 'Structure model' '_citation.title' 9 2 'Structure model' '_citation.year' 10 3 'Structure model' '_database_2.pdbx_DOI' 11 3 'Structure model' '_database_2.pdbx_database_accession' 12 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' # _pdbx_nmr_exptl_sample.solution_id 1 _pdbx_nmr_exptl_sample.component MeuNaTx1 _pdbx_nmr_exptl_sample.concentration 2 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling 'natural abundance' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 TYR A 14 ? ? -66.08 95.79 2 1 ALA A 31 ? ? -49.11 166.30 3 1 SER A 33 ? ? 175.87 158.82 4 1 TYR A 42 ? ? -99.65 31.57 5 1 SER A 60 ? ? -51.10 103.50 6 1 CYS A 63 ? ? -174.57 144.19 7 2 TYR A 14 ? ? -67.30 95.39 8 2 PHE A 15 ? ? -69.47 76.43 9 2 ALA A 31 ? ? -48.38 165.11 10 2 SER A 33 ? ? 176.27 156.58 11 2 TYR A 35 ? ? -175.25 -175.13 12 2 TRP A 38 ? ? -54.19 174.43 13 2 ALA A 39 ? ? -138.56 -42.64 14 2 SER A 60 ? ? 49.35 26.54 15 3 TYR A 14 ? ? -67.39 92.36 16 3 ALA A 31 ? ? -46.81 162.42 17 3 SER A 33 ? ? 173.22 155.26 18 3 TYR A 35 ? ? -163.86 -167.04 19 4 TYR A 14 ? ? -65.62 90.78 20 4 PHE A 15 ? ? -68.36 83.19 21 4 ALA A 31 ? ? -48.49 165.00 22 4 SER A 33 ? ? 175.19 160.98 23 4 TYR A 42 ? ? -98.44 32.90 24 4 SER A 60 ? ? -50.96 106.98 25 4 LYS A 62 ? ? -176.58 125.24 26 5 TYR A 14 ? ? -65.81 95.38 27 5 SER A 33 ? ? 176.58 157.30 28 5 TYR A 42 ? ? -99.76 34.54 29 5 LYS A 62 ? ? -172.54 122.34 30 6 TYR A 14 ? ? -66.61 96.31 31 6 ALA A 31 ? ? -47.46 163.20 32 6 SER A 33 ? ? 175.15 153.84 33 6 TYR A 35 ? ? -175.37 -175.93 34 6 ALA A 39 ? ? 175.74 166.83 35 6 SER A 60 ? ? 49.22 26.37 36 7 TYR A 14 ? ? -67.14 96.41 37 7 SER A 33 ? ? 173.42 158.97 38 7 CYS A 36 ? ? -100.77 78.71 39 7 TYR A 42 ? ? -95.53 30.19 40 7 SER A 60 ? ? -50.65 103.68 41 8 TYR A 14 ? ? -67.78 93.82 42 8 PHE A 15 ? ? -69.69 76.72 43 8 SER A 33 ? ? 173.63 151.17 44 8 TYR A 35 ? ? -175.72 -175.84 45 8 ALA A 39 ? ? 175.28 165.66 46 8 SER A 60 ? ? -47.03 105.41 47 8 LYS A 62 ? ? -61.88 95.42 48 9 TYR A 14 ? ? -66.11 92.29 49 9 PHE A 15 ? ? -69.64 79.58 50 9 CYS A 26 ? ? -65.20 -70.16 51 9 ALA A 31 ? ? -48.33 165.07 52 9 SER A 33 ? ? 174.85 157.27 53 9 TYR A 42 ? ? -99.68 30.07 54 9 LYS A 62 ? ? -173.72 123.02 55 10 TYR A 14 ? ? -67.53 96.87 56 10 ALA A 31 ? ? -47.93 164.32 57 10 SER A 33 ? ? 178.03 156.10 58 10 ALA A 45 ? ? -175.17 136.79 59 10 SER A 60 ? ? -48.34 106.10 60 10 LYS A 62 ? ? 52.30 90.55 61 11 TYR A 14 ? ? -68.10 95.55 62 11 SER A 33 ? ? 174.72 150.55 63 11 TYR A 35 ? ? -174.68 -175.97 64 11 ALA A 39 ? ? -160.09 -164.99 65 11 GLN A 41 ? ? -45.20 -73.76 66 11 TYR A 42 ? ? -96.32 32.24 67 11 LYS A 62 ? ? -174.48 145.17 68 12 TYR A 14 ? ? -66.08 96.81 69 12 CYS A 26 ? ? -64.77 -70.07 70 12 ALA A 31 ? ? -47.54 164.31 71 12 SER A 33 ? ? 174.69 166.34 72 12 TYR A 42 ? ? -99.64 30.04 73 13 TYR A 14 ? ? -68.28 96.27 74 13 SER A 33 ? ? 174.39 149.58 75 13 TYR A 35 ? ? -175.29 -175.64 76 13 ALA A 39 ? ? 178.12 162.06 77 13 TYR A 42 ? ? -95.31 32.12 78 13 SER A 60 ? ? -49.97 104.57 79 14 TYR A 14 ? ? -67.94 93.48 80 14 SER A 33 ? ? 172.80 149.90 81 14 TYR A 35 ? ? -166.87 -166.95 82 15 TYR A 14 ? ? -67.43 96.93 83 15 ALA A 31 ? ? -48.95 167.05 84 15 SER A 33 ? ? 175.35 162.79 85 15 LYS A 62 ? ? -174.98 129.30 86 16 TYR A 14 ? ? -68.15 97.19 87 16 CYS A 26 ? ? -65.67 -70.05 88 16 ALA A 31 ? ? -48.05 164.96 89 16 SER A 33 ? ? 177.23 157.22 90 16 TYR A 42 ? ? -99.13 34.45 91 16 SER A 60 ? ? -47.30 105.89 92 16 LYS A 62 ? ? -168.97 118.85 93 17 TYR A 14 ? ? -68.12 95.79 94 17 ALA A 31 ? ? -48.55 163.82 95 17 SER A 33 ? ? 177.08 156.89 96 17 TYR A 35 ? ? -171.90 -176.20 97 17 TRP A 38 ? ? -58.12 -174.10 98 17 ALA A 39 ? ? -145.19 -53.01 99 17 SER A 60 ? ? -48.18 107.12 100 17 LYS A 62 ? ? 58.57 99.96 101 17 CYS A 63 ? ? -142.20 31.87 102 18 PHE A 15 ? ? -69.56 75.41 103 18 CYS A 26 ? ? -64.08 -70.42 104 18 ALA A 31 ? ? -47.17 162.88 105 18 SER A 33 ? ? 174.87 156.81 106 18 SER A 60 ? ? -50.22 106.91 107 19 TYR A 14 ? ? -66.71 93.67 108 19 PHE A 15 ? ? -68.38 78.16 109 19 CYS A 26 ? ? -64.89 -70.18 110 19 ALA A 31 ? ? -47.84 164.12 111 19 SER A 33 ? ? 175.39 152.52 112 19 TYR A 35 ? ? -175.53 -174.25 113 19 ALA A 39 ? ? 178.02 156.79 114 19 LYS A 62 ? ? -170.06 144.28 115 20 TYR A 14 ? ? -68.15 96.81 116 20 PHE A 15 ? ? -69.76 78.05 117 20 SER A 33 ? ? 175.67 156.57 118 20 TYR A 42 ? ? -99.61 33.56 # _pdbx_audit_support.funding_organization 'Russian Foundation for Basic Research' _pdbx_audit_support.country 'Russian Federation' _pdbx_audit_support.grant_number 19-54-12015 _pdbx_audit_support.ordinal 1 # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #