data_6TRI # _entry.id 6TRI # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6TRI pdb_00006tri 10.2210/pdb6tri/pdb WWPDB D_1292105697 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-08-19 2 'Structure model' 1 1 2020-08-26 3 'Structure model' 1 2 2020-09-02 4 'Structure model' 1 3 2024-01-24 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 4 'Structure model' chem_comp_atom 5 4 'Structure model' chem_comp_bond 6 4 'Structure model' database_2 7 4 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.pdbx_database_id_PubMed' 2 2 'Structure model' '_citation.title' 3 2 'Structure model' '_citation_author.identifier_ORCID' 4 3 'Structure model' '_citation.journal_volume' 5 3 'Structure model' '_citation.page_first' 6 3 'Structure model' '_citation.page_last' 7 4 'Structure model' '_database_2.pdbx_DOI' 8 4 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6TRI _pdbx_database_status.recvd_initial_deposition_date 2019-12-18 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Rasmussen, K.K.' 1 ? 'Blackledge, M.' 2 ? 'Herrmann, T.' 3 ? 'Jensen, M.R.' 4 ? 'Lo Leggio, L.' 5 0000-0002-5135-0882 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Proc.Natl.Acad.Sci.USA _citation.journal_id_ASTM PNASA6 _citation.journal_id_CSD 0040 _citation.journal_id_ISSN 1091-6490 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 117 _citation.language ? _citation.page_first 20576 _citation.page_last 20585 _citation.title 'Revealing the mechanism of repressor inactivation during switching of a temperate bacteriophage.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1073/pnas.2005218117 _citation.pdbx_database_id_PubMed 32788352 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Rasmussen, K.K.' 1 ? primary 'Palencia, A.' 2 ? primary 'Varming, A.K.' 3 ? primary 'El-Wali, H.' 4 ? primary 'Boeri Erba, E.' 5 ? primary 'Blackledge, M.' 6 ? primary 'Hammer, K.' 7 ? primary 'Herrmann, T.' 8 ? primary 'Kilstrup, M.' 9 ? primary 'Lo Leggio, L.' 10 ? primary 'Jensen, M.R.' 11 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man CI 10947.503 1 ? ? ? ? 2 polymer man MOR 8422.644 1 ? ? ? ? 3 non-polymer syn 'SULFATE ION' 96.063 2 ? ? ? ? 4 water nat water 18.015 20 ? ? ? ? # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;MQTDTSNRLKQIMAERNLKQVDILNLSIPFQKKFGIKLSKSTLSQYVNSVQSPDQNRIYLLAKTLGVSEAWLMGFDVPMV ESSKIENDSHHHHHH ; ;MQTDTSNRLKQIMAERNLKQVDILNLSIPFQKKFGIKLSKSTLSQYVNSVQSPDQNRIYLLAKTLGVSEAWLMGFDVPMV ESSKIENDSHHHHHH ; A ? 2 'polypeptide(L)' no no GSMSYDYSSLLGKITEKCGTQYNFAIAMGLSERTVSLKLNDKVTWKDDEILKAVHVLELNPQDIPKYFFNAKVH GSMSYDYSSLLGKITEKCGTQYNFAIAMGLSERTVSLKLNDKVTWKDDEILKAVHVLELNPQDIPKYFFNAKVH B ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 'SULFATE ION' SO4 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLN n 1 3 THR n 1 4 ASP n 1 5 THR n 1 6 SER n 1 7 ASN n 1 8 ARG n 1 9 LEU n 1 10 LYS n 1 11 GLN n 1 12 ILE n 1 13 MET n 1 14 ALA n 1 15 GLU n 1 16 ARG n 1 17 ASN n 1 18 LEU n 1 19 LYS n 1 20 GLN n 1 21 VAL n 1 22 ASP n 1 23 ILE n 1 24 LEU n 1 25 ASN n 1 26 LEU n 1 27 SER n 1 28 ILE n 1 29 PRO n 1 30 PHE n 1 31 GLN n 1 32 LYS n 1 33 LYS n 1 34 PHE n 1 35 GLY n 1 36 ILE n 1 37 LYS n 1 38 LEU n 1 39 SER n 1 40 LYS n 1 41 SER n 1 42 THR n 1 43 LEU n 1 44 SER n 1 45 GLN n 1 46 TYR n 1 47 VAL n 1 48 ASN n 1 49 SER n 1 50 VAL n 1 51 GLN n 1 52 SER n 1 53 PRO n 1 54 ASP n 1 55 GLN n 1 56 ASN n 1 57 ARG n 1 58 ILE n 1 59 TYR n 1 60 LEU n 1 61 LEU n 1 62 ALA n 1 63 LYS n 1 64 THR n 1 65 LEU n 1 66 GLY n 1 67 VAL n 1 68 SER n 1 69 GLU n 1 70 ALA n 1 71 TRP n 1 72 LEU n 1 73 MET n 1 74 GLY n 1 75 PHE n 1 76 ASP n 1 77 VAL n 1 78 PRO n 1 79 MET n 1 80 VAL n 1 81 GLU n 1 82 SER n 1 83 SER n 1 84 LYS n 1 85 ILE n 1 86 GLU n 1 87 ASN n 1 88 ASP n 1 89 SER n 1 90 HIS n 1 91 HIS n 1 92 HIS n 1 93 HIS n 1 94 HIS n 1 95 HIS n 2 1 GLY n 2 2 SER n 2 3 MET n 2 4 SER n 2 5 TYR n 2 6 ASP n 2 7 TYR n 2 8 SER n 2 9 SER n 2 10 LEU n 2 11 LEU n 2 12 GLY n 2 13 LYS n 2 14 ILE n 2 15 THR n 2 16 GLU n 2 17 LYS n 2 18 CYS n 2 19 GLY n 2 20 THR n 2 21 GLN n 2 22 TYR n 2 23 ASN n 2 24 PHE n 2 25 ALA n 2 26 ILE n 2 27 ALA n 2 28 MET n 2 29 GLY n 2 30 LEU n 2 31 SER n 2 32 GLU n 2 33 ARG n 2 34 THR n 2 35 VAL n 2 36 SER n 2 37 LEU n 2 38 LYS n 2 39 LEU n 2 40 ASN n 2 41 ASP n 2 42 LYS n 2 43 VAL n 2 44 THR n 2 45 TRP n 2 46 LYS n 2 47 ASP n 2 48 ASP n 2 49 GLU n 2 50 ILE n 2 51 LEU n 2 52 LYS n 2 53 ALA n 2 54 VAL n 2 55 HIS n 2 56 VAL n 2 57 LEU n 2 58 GLU n 2 59 LEU n 2 60 ASN n 2 61 PRO n 2 62 GLN n 2 63 ASP n 2 64 ILE n 2 65 PRO n 2 66 LYS n 2 67 TYR n 2 68 PHE n 2 69 PHE n 2 70 ASN n 2 71 ALA n 2 72 LYS n 2 73 VAL n 2 74 HIS n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 95 ? ? cI ? ? ? ? ? ? 'Lactococcus phage TP901-1' 35345 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2 1 sample 'Biological sequence' 1 74 ? ? mor ? ? ? ? ? ? 'Lactococcus phage TP901-1' 35345 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 GLN 2 2 2 GLN GLN A . n A 1 3 THR 3 3 3 THR THR A . n A 1 4 ASP 4 4 4 ASP ASP A . n A 1 5 THR 5 5 5 THR THR A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 ASN 7 7 7 ASN ASN A . n A 1 8 ARG 8 8 8 ARG ARG A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 GLN 11 11 11 GLN GLN A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 MET 13 13 13 MET MET A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 ARG 16 16 16 ARG ARG A . n A 1 17 ASN 17 17 17 ASN ASN A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 GLN 20 20 20 GLN GLN A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 ASP 22 22 22 ASP ASP A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 ASN 25 25 25 ASN ASN A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 SER 27 27 27 SER SER A . n A 1 28 ILE 28 28 28 ILE ILE A . n A 1 29 PRO 29 29 29 PRO PRO A . n A 1 30 PHE 30 30 30 PHE PHE A . n A 1 31 GLN 31 31 31 GLN GLN A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 PHE 34 34 34 PHE PHE A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 ILE 36 36 36 ILE ILE A . n A 1 37 LYS 37 37 37 LYS LYS A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 SER 39 39 39 SER SER A . n A 1 40 LYS 40 40 40 LYS LYS A . n A 1 41 SER 41 41 41 SER SER A . n A 1 42 THR 42 42 42 THR THR A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 SER 44 44 44 SER SER A . n A 1 45 GLN 45 45 45 GLN GLN A . n A 1 46 TYR 46 46 46 TYR TYR A . n A 1 47 VAL 47 47 47 VAL VAL A . n A 1 48 ASN 48 48 48 ASN ASN A . n A 1 49 SER 49 49 49 SER SER A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 GLN 51 51 51 GLN GLN A . n A 1 52 SER 52 52 52 SER SER A . n A 1 53 PRO 53 53 53 PRO PRO A . n A 1 54 ASP 54 54 54 ASP ASP A . n A 1 55 GLN 55 55 55 GLN GLN A . n A 1 56 ASN 56 56 56 ASN ASN A . n A 1 57 ARG 57 57 57 ARG ARG A . n A 1 58 ILE 58 58 58 ILE ILE A . n A 1 59 TYR 59 59 59 TYR TYR A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 ALA 62 62 62 ALA ALA A . n A 1 63 LYS 63 63 63 LYS LYS A . n A 1 64 THR 64 64 64 THR THR A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 VAL 67 67 67 VAL VAL A . n A 1 68 SER 68 68 68 SER SER A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 ALA 70 70 70 ALA ALA A . n A 1 71 TRP 71 71 71 TRP TRP A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 MET 73 73 73 MET MET A . n A 1 74 GLY 74 74 74 GLY GLY A . n A 1 75 PHE 75 75 75 PHE PHE A . n A 1 76 ASP 76 76 76 ASP ASP A . n A 1 77 VAL 77 77 77 VAL VAL A . n A 1 78 PRO 78 78 78 PRO PRO A . n A 1 79 MET 79 79 79 MET MET A . n A 1 80 VAL 80 80 80 VAL VAL A . n A 1 81 GLU 81 81 ? ? ? A . n A 1 82 SER 82 82 ? ? ? A . n A 1 83 SER 83 83 ? ? ? A . n A 1 84 LYS 84 84 ? ? ? A . n A 1 85 ILE 85 85 ? ? ? A . n A 1 86 GLU 86 86 ? ? ? A . n A 1 87 ASN 87 87 ? ? ? A . n A 1 88 ASP 88 88 ? ? ? A . n A 1 89 SER 89 89 ? ? ? A . n A 1 90 HIS 90 90 ? ? ? A . n A 1 91 HIS 91 91 ? ? ? A . n A 1 92 HIS 92 92 ? ? ? A . n A 1 93 HIS 93 93 ? ? ? A . n A 1 94 HIS 94 94 ? ? ? A . n A 1 95 HIS 95 95 ? ? ? A . n B 2 1 GLY 1 -1 ? ? ? B . n B 2 2 SER 2 0 ? ? ? B . n B 2 3 MET 3 1 ? ? ? B . n B 2 4 SER 4 2 2 SER SER B . n B 2 5 TYR 5 3 3 TYR TYR B . n B 2 6 ASP 6 4 4 ASP ASP B . n B 2 7 TYR 7 5 5 TYR TYR B . n B 2 8 SER 8 6 6 SER SER B . n B 2 9 SER 9 7 7 SER SER B . n B 2 10 LEU 10 8 8 LEU LEU B . n B 2 11 LEU 11 9 9 LEU LEU B . n B 2 12 GLY 12 10 10 GLY GLY B . n B 2 13 LYS 13 11 11 LYS LYS B . n B 2 14 ILE 14 12 12 ILE ILE B . n B 2 15 THR 15 13 13 THR THR B . n B 2 16 GLU 16 14 14 GLU GLU B . n B 2 17 LYS 17 15 15 LYS LYS B . n B 2 18 CYS 18 16 16 CYS CYS B . n B 2 19 GLY 19 17 17 GLY GLY B . n B 2 20 THR 20 18 18 THR THR B . n B 2 21 GLN 21 19 19 GLN GLN B . n B 2 22 TYR 22 20 20 TYR TYR B . n B 2 23 ASN 23 21 21 ASN ASN B . n B 2 24 PHE 24 22 22 PHE PHE B . n B 2 25 ALA 25 23 23 ALA ALA B . n B 2 26 ILE 26 24 24 ILE ILE B . n B 2 27 ALA 27 25 25 ALA ALA B . n B 2 28 MET 28 26 26 MET MET B . n B 2 29 GLY 29 27 27 GLY GLY B . n B 2 30 LEU 30 28 28 LEU LEU B . n B 2 31 SER 31 29 29 SER SER B . n B 2 32 GLU 32 30 30 GLU GLU B . n B 2 33 ARG 33 31 31 ARG ARG B . n B 2 34 THR 34 32 32 THR THR B . n B 2 35 VAL 35 33 33 VAL VAL B . n B 2 36 SER 36 34 34 SER SER B . n B 2 37 LEU 37 35 35 LEU LEU B . n B 2 38 LYS 38 36 36 LYS LYS B . n B 2 39 LEU 39 37 37 LEU LEU B . n B 2 40 ASN 40 38 38 ASN ASN B . n B 2 41 ASP 41 39 39 ASP ASP B . n B 2 42 LYS 42 40 40 LYS LYS B . n B 2 43 VAL 43 41 41 VAL VAL B . n B 2 44 THR 44 42 42 THR THR B . n B 2 45 TRP 45 43 43 TRP TRP B . n B 2 46 LYS 46 44 44 LYS LYS B . n B 2 47 ASP 47 45 45 ASP ASP B . n B 2 48 ASP 48 46 46 ASP ASP B . n B 2 49 GLU 49 47 47 GLU GLU B . n B 2 50 ILE 50 48 48 ILE ILE B . n B 2 51 LEU 51 49 49 LEU LEU B . n B 2 52 LYS 52 50 50 LYS LYS B . n B 2 53 ALA 53 51 51 ALA ALA B . n B 2 54 VAL 54 52 52 VAL VAL B . n B 2 55 HIS 55 53 53 HIS HIS B . n B 2 56 VAL 56 54 54 VAL VAL B . n B 2 57 LEU 57 55 55 LEU LEU B . n B 2 58 GLU 58 56 56 GLU GLU B . n B 2 59 LEU 59 57 57 LEU LEU B . n B 2 60 ASN 60 58 58 ASN ASN B . n B 2 61 PRO 61 59 59 PRO PRO B . n B 2 62 GLN 62 60 60 GLN GLN B . n B 2 63 ASP 63 61 61 ASP ASP B . n B 2 64 ILE 64 62 62 ILE ILE B . n B 2 65 PRO 65 63 63 PRO PRO B . n B 2 66 LYS 66 64 64 LYS LYS B . n B 2 67 TYR 67 65 65 TYR TYR B . n B 2 68 PHE 68 66 66 PHE PHE B . n B 2 69 PHE 69 67 67 PHE PHE B . n B 2 70 ASN 70 68 68 ASN ASN B . n B 2 71 ALA 71 69 69 ALA ALA B . n B 2 72 LYS 72 70 70 LYS LYS B . n B 2 73 VAL 73 71 ? ? ? B . n B 2 74 HIS 74 72 ? ? ? B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 SO4 1 101 2 SO4 SO4 A . D 3 SO4 1 101 1 SO4 SO4 B . E 4 HOH 1 201 49 HOH HOH A . E 4 HOH 2 202 50 HOH HOH A . E 4 HOH 3 203 4 HOH HOH A . E 4 HOH 4 204 56 HOH HOH A . E 4 HOH 5 205 32 HOH HOH A . E 4 HOH 6 206 51 HOH HOH A . E 4 HOH 7 207 30 HOH HOH A . F 4 HOH 1 201 47 HOH HOH B . F 4 HOH 2 202 43 HOH HOH B . F 4 HOH 3 203 45 HOH HOH B . F 4 HOH 4 204 48 HOH HOH B . F 4 HOH 5 205 2 HOH HOH B . F 4 HOH 6 206 18 HOH HOH B . F 4 HOH 7 207 44 HOH HOH B . F 4 HOH 8 208 42 HOH HOH B . F 4 HOH 9 209 53 HOH HOH B . F 4 HOH 10 210 55 HOH HOH B . F 4 HOH 11 211 52 HOH HOH B . F 4 HOH 12 212 54 HOH HOH B . F 4 HOH 13 213 46 HOH HOH B . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.9_1692 1 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 6TRI _cell.details ? _cell.formula_units_Z ? _cell.length_a 94.405 _cell.length_a_esd ? _cell.length_b 94.405 _cell.length_b_esd ? _cell.length_c 30.558 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6TRI _symmetry.cell_setting ? _symmetry.Int_Tables_number 150 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 3 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6TRI _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.03 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 39.39 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2 M lithium sulfate, 0.1 M Bis-Tris pH 5.5, 25% PEG 3350 in reservoir' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 S 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-02-04 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.972 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE ID23-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.972 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ID23-1 _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6TRI _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.2770 _reflns.d_resolution_low 42.7 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 7285 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 16.1 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 7.95 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.996 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.2770 _reflns_shell.d_res_low 2.41 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1184 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.377 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 180.600 _refine.B_iso_mean 58.2949 _refine.B_iso_min 29.950 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6TRI _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.2770 _refine.ls_d_res_low 40.8790 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 7282 _refine.ls_number_reflns_R_free 365 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.6200 _refine.ls_percent_reflns_R_free 5.0100 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1904 _refine.ls_R_factor_R_free 0.2174 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1889 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.340 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model '5A7L + MOR NMR structure (just deposited 6TO6)' _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 28.3000 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2900 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.2770 _refine_hist.d_res_low 40.8790 _refine_hist.number_atoms_solvent 20 _refine_hist.number_atoms_total 1224 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 149 _refine_hist.pdbx_B_iso_mean_ligand 83.20 _refine_hist.pdbx_B_iso_mean_solvent 59.44 _refine_hist.pdbx_number_atoms_protein 1194 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 10 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.002 ? 1222 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.642 ? 1648 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.021 ? 188 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.004 ? 204 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 10.799 ? 460 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.2770 2.60 . . 117 . . . . . 0.3260 . . . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.60 3.28 . . 122 . . . . . 0.3171 . . . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.28 40.87 . . 126 . . . . . 0.1655 . . . . . . . . . . . . . # _struct.entry_id 6TRI _struct.title 'CI-MOR repressor-antirepressor complex of the temperate bacteriophage TP901-1 from Lactococcus lactis' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6TRI _struct_keywords.text 'Complex, regulation, DNA-binding, temperate virus, VIRAL PROTEIN' _struct_keywords.pdbx_keywords 'VIRAL PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 4 ? F N N 4 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP O48503_9CAUD O48503 ? 1 ;MKTDTSNRLKQIMAERNLKQVDILNLSIPFQKKFGIKLSKSTLSQYVNSVQSPDQNRIYLLAKTLGVSEAWLMGFDVPMV ESSKIENDS ; 1 2 UNP O48504_9CAUD O48504 ? 2 MSYDYSSLLGKITEKCGTQYNFAIAMGLSERTVSLKLNDKVTWKDDEILKAVHVLELNPQDIPKYFFNAKVH 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 6TRI A 1 ? 89 ? O48503 1 ? 89 ? 1 89 2 2 6TRI B 3 ? 74 ? O48504 1 ? 72 ? 1 72 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6TRI GLN A 2 ? UNP O48503 LYS 2 conflict 2 1 1 6TRI HIS A 90 ? UNP O48503 ? ? 'expression tag' 90 2 1 6TRI HIS A 91 ? UNP O48503 ? ? 'expression tag' 91 3 1 6TRI HIS A 92 ? UNP O48503 ? ? 'expression tag' 92 4 1 6TRI HIS A 93 ? UNP O48503 ? ? 'expression tag' 93 5 1 6TRI HIS A 94 ? UNP O48503 ? ? 'expression tag' 94 6 1 6TRI HIS A 95 ? UNP O48503 ? ? 'expression tag' 95 7 2 6TRI GLY B 1 ? UNP O48504 ? ? 'expression tag' -1 8 2 6TRI SER B 2 ? UNP O48504 ? ? 'expression tag' 0 9 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1630 ? 1 MORE -33 ? 1 'SSA (A^2)' 7950 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details 'information from mass spectrometry, NMR, gel filtration' # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 4 ? ARG A 16 ? ASP A 4 ARG A 16 1 ? 13 HELX_P HELX_P2 AA2 LYS A 19 ? GLY A 35 ? LYS A 19 GLY A 35 1 ? 17 HELX_P HELX_P3 AA3 SER A 39 ? ASN A 48 ? SER A 39 ASN A 48 1 ? 10 HELX_P HELX_P4 AA4 ASP A 54 ? GLY A 66 ? ASP A 54 GLY A 66 1 ? 13 HELX_P HELX_P5 AA5 SER A 68 ? MET A 73 ? SER A 68 MET A 73 1 ? 6 HELX_P HELX_P6 AA6 TYR B 7 ? CYS B 18 ? TYR B 5 CYS B 16 1 ? 12 HELX_P HELX_P7 AA7 THR B 20 ? GLY B 29 ? THR B 18 GLY B 27 1 ? 10 HELX_P HELX_P8 AA8 SER B 31 ? ASN B 40 ? SER B 29 ASN B 38 1 ? 10 HELX_P HELX_P9 AA9 LYS B 46 ? GLU B 58 ? LYS B 44 GLU B 56 1 ? 13 HELX_P HELX_P10 AB1 ASN B 60 ? GLN B 62 ? ASN B 58 GLN B 60 5 ? 3 HELX_P HELX_P11 AB2 ASP B 63 ? PHE B 69 ? ASP B 61 PHE B 67 1 ? 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A SO4 101 ? 5 'binding site for residue SO4 A 101' AC2 Software B SO4 101 ? 2 'binding site for residue SO4 B 101' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 GLN A 20 ? GLN A 20 . ? 3_565 ? 2 AC1 5 LYS A 40 ? LYS A 40 . ? 3_565 ? 3 AC1 5 ASN A 56 ? ASN A 56 . ? 1_555 ? 4 AC1 5 LYS B 42 ? LYS B 40 . ? 1_555 ? 5 AC1 5 THR B 44 ? THR B 42 . ? 1_555 ? 6 AC2 2 ARG B 33 ? ARG B 31 . ? 1_555 ? 7 AC2 2 ARG B 33 ? ARG B 31 . ? 6_556 ? # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id THR _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 3 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -131.69 _pdbx_validate_torsion.psi -149.50 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 B SO4 101 ? D SO4 . 2 1 B HOH 210 ? F HOH . # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined 10.3585 41.7255 6.0448 0.2272 ? 0.0023 ? 0.0184 ? 0.3120 ? 0.0032 ? 0.3875 ? 7.0564 ? 0.9752 ? 1.1269 ? 6.1440 ? -0.2618 ? 9.5254 ? -0.0176 ? 0.0739 ? 0.1541 ? -0.0534 ? -0.0032 ? -0.0442 ? -0.3113 ? 0.3060 ? 0.0547 ? 2 'X-RAY DIFFRACTION' ? refined -5.7927 31.2344 14.8720 0.2815 ? -0.0689 ? 0.0055 ? 0.2527 ? 0.0046 ? 0.3611 ? 8.1192 ? -1.4693 ? -0.8413 ? 5.0523 ? -1.1533 ? 6.0800 ? -0.0197 ? -0.0727 ? -0.2458 ? 0.0144 ? 0.0866 ? -0.0616 ? -0.0038 ? 0.1871 ? -0.1000 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? A 1 ? ? A 80 ? 'chain A' 2 'X-RAY DIFFRACTION' 2 ? ? B 2 ? ? B 70 ? 'chain B' # _pdbx_entry_details.entry_id 6TRI _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLU 81 ? A GLU 81 2 1 Y 1 A SER 82 ? A SER 82 3 1 Y 1 A SER 83 ? A SER 83 4 1 Y 1 A LYS 84 ? A LYS 84 5 1 Y 1 A ILE 85 ? A ILE 85 6 1 Y 1 A GLU 86 ? A GLU 86 7 1 Y 1 A ASN 87 ? A ASN 87 8 1 Y 1 A ASP 88 ? A ASP 88 9 1 Y 1 A SER 89 ? A SER 89 10 1 Y 1 A HIS 90 ? A HIS 90 11 1 Y 1 A HIS 91 ? A HIS 91 12 1 Y 1 A HIS 92 ? A HIS 92 13 1 Y 1 A HIS 93 ? A HIS 93 14 1 Y 1 A HIS 94 ? A HIS 94 15 1 Y 1 A HIS 95 ? A HIS 95 16 1 Y 1 B GLY -1 ? B GLY 1 17 1 Y 1 B SER 0 ? B SER 2 18 1 Y 1 B MET 1 ? B MET 3 19 1 Y 1 B VAL 71 ? B VAL 73 20 1 Y 1 B HIS 72 ? B HIS 74 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SER N N N N 290 SER CA C N S 291 SER C C N N 292 SER O O N N 293 SER CB C N N 294 SER OG O N N 295 SER OXT O N N 296 SER H H N N 297 SER H2 H N N 298 SER HA H N N 299 SER HB2 H N N 300 SER HB3 H N N 301 SER HG H N N 302 SER HXT H N N 303 SO4 S S N N 304 SO4 O1 O N N 305 SO4 O2 O N N 306 SO4 O3 O N N 307 SO4 O4 O N N 308 THR N N N N 309 THR CA C N S 310 THR C C N N 311 THR O O N N 312 THR CB C N R 313 THR OG1 O N N 314 THR CG2 C N N 315 THR OXT O N N 316 THR H H N N 317 THR H2 H N N 318 THR HA H N N 319 THR HB H N N 320 THR HG1 H N N 321 THR HG21 H N N 322 THR HG22 H N N 323 THR HG23 H N N 324 THR HXT H N N 325 TRP N N N N 326 TRP CA C N S 327 TRP C C N N 328 TRP O O N N 329 TRP CB C N N 330 TRP CG C Y N 331 TRP CD1 C Y N 332 TRP CD2 C Y N 333 TRP NE1 N Y N 334 TRP CE2 C Y N 335 TRP CE3 C Y N 336 TRP CZ2 C Y N 337 TRP CZ3 C Y N 338 TRP CH2 C Y N 339 TRP OXT O N N 340 TRP H H N N 341 TRP H2 H N N 342 TRP HA H N N 343 TRP HB2 H N N 344 TRP HB3 H N N 345 TRP HD1 H N N 346 TRP HE1 H N N 347 TRP HE3 H N N 348 TRP HZ2 H N N 349 TRP HZ3 H N N 350 TRP HH2 H N N 351 TRP HXT H N N 352 TYR N N N N 353 TYR CA C N S 354 TYR C C N N 355 TYR O O N N 356 TYR CB C N N 357 TYR CG C Y N 358 TYR CD1 C Y N 359 TYR CD2 C Y N 360 TYR CE1 C Y N 361 TYR CE2 C Y N 362 TYR CZ C Y N 363 TYR OH O N N 364 TYR OXT O N N 365 TYR H H N N 366 TYR H2 H N N 367 TYR HA H N N 368 TYR HB2 H N N 369 TYR HB3 H N N 370 TYR HD1 H N N 371 TYR HD2 H N N 372 TYR HE1 H N N 373 TYR HE2 H N N 374 TYR HH H N N 375 TYR HXT H N N 376 VAL N N N N 377 VAL CA C N S 378 VAL C C N N 379 VAL O O N N 380 VAL CB C N N 381 VAL CG1 C N N 382 VAL CG2 C N N 383 VAL OXT O N N 384 VAL H H N N 385 VAL H2 H N N 386 VAL HA H N N 387 VAL HB H N N 388 VAL HG11 H N N 389 VAL HG12 H N N 390 VAL HG13 H N N 391 VAL HG21 H N N 392 VAL HG22 H N N 393 VAL HG23 H N N 394 VAL HXT H N N 395 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 SO4 S O1 doub N N 290 SO4 S O2 doub N N 291 SO4 S O3 sing N N 292 SO4 S O4 sing N N 293 THR N CA sing N N 294 THR N H sing N N 295 THR N H2 sing N N 296 THR CA C sing N N 297 THR CA CB sing N N 298 THR CA HA sing N N 299 THR C O doub N N 300 THR C OXT sing N N 301 THR CB OG1 sing N N 302 THR CB CG2 sing N N 303 THR CB HB sing N N 304 THR OG1 HG1 sing N N 305 THR CG2 HG21 sing N N 306 THR CG2 HG22 sing N N 307 THR CG2 HG23 sing N N 308 THR OXT HXT sing N N 309 TRP N CA sing N N 310 TRP N H sing N N 311 TRP N H2 sing N N 312 TRP CA C sing N N 313 TRP CA CB sing N N 314 TRP CA HA sing N N 315 TRP C O doub N N 316 TRP C OXT sing N N 317 TRP CB CG sing N N 318 TRP CB HB2 sing N N 319 TRP CB HB3 sing N N 320 TRP CG CD1 doub Y N 321 TRP CG CD2 sing Y N 322 TRP CD1 NE1 sing Y N 323 TRP CD1 HD1 sing N N 324 TRP CD2 CE2 doub Y N 325 TRP CD2 CE3 sing Y N 326 TRP NE1 CE2 sing Y N 327 TRP NE1 HE1 sing N N 328 TRP CE2 CZ2 sing Y N 329 TRP CE3 CZ3 doub Y N 330 TRP CE3 HE3 sing N N 331 TRP CZ2 CH2 doub Y N 332 TRP CZ2 HZ2 sing N N 333 TRP CZ3 CH2 sing Y N 334 TRP CZ3 HZ3 sing N N 335 TRP CH2 HH2 sing N N 336 TRP OXT HXT sing N N 337 TYR N CA sing N N 338 TYR N H sing N N 339 TYR N H2 sing N N 340 TYR CA C sing N N 341 TYR CA CB sing N N 342 TYR CA HA sing N N 343 TYR C O doub N N 344 TYR C OXT sing N N 345 TYR CB CG sing N N 346 TYR CB HB2 sing N N 347 TYR CB HB3 sing N N 348 TYR CG CD1 doub Y N 349 TYR CG CD2 sing Y N 350 TYR CD1 CE1 sing Y N 351 TYR CD1 HD1 sing N N 352 TYR CD2 CE2 doub Y N 353 TYR CD2 HD2 sing N N 354 TYR CE1 CZ doub Y N 355 TYR CE1 HE1 sing N N 356 TYR CE2 CZ sing Y N 357 TYR CE2 HE2 sing N N 358 TYR CZ OH sing N N 359 TYR OH HH sing N N 360 TYR OXT HXT sing N N 361 VAL N CA sing N N 362 VAL N H sing N N 363 VAL N H2 sing N N 364 VAL CA C sing N N 365 VAL CA CB sing N N 366 VAL CA HA sing N N 367 VAL C O doub N N 368 VAL C OXT sing N N 369 VAL CB CG1 sing N N 370 VAL CB CG2 sing N N 371 VAL CB HB sing N N 372 VAL CG1 HG11 sing N N 373 VAL CG1 HG12 sing N N 374 VAL CG1 HG13 sing N N 375 VAL CG2 HG21 sing N N 376 VAL CG2 HG22 sing N N 377 VAL CG2 HG23 sing N N 378 VAL OXT HXT sing N N 379 # _pdbx_audit_support.funding_organization 'Danish Council for Independent Research' _pdbx_audit_support.country Denmark _pdbx_audit_support.grant_number 4002-00107 _pdbx_audit_support.ordinal 1 # loop_ _pdbx_initial_refinement_model.id _pdbx_initial_refinement_model.entity_id_list _pdbx_initial_refinement_model.type _pdbx_initial_refinement_model.source_name _pdbx_initial_refinement_model.accession_code _pdbx_initial_refinement_model.details 1 ? 'experimental model' PDB 5A7L '5A7L + MOR NMR structure (just deposited 6TO6)' 2 ? 'experimental model' PDB 6TO6 '5A7L + MOR NMR structure (just deposited 6TO6)' # _atom_sites.entry_id 6TRI _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.010593 _atom_sites.fract_transf_matrix[1][2] 0.006116 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.012231 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.032725 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_