data_6TRM # _entry.id 6TRM # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6TRM pdb_00006trm 10.2210/pdb6trm/pdb WWPDB D_1292105695 ? ? BMRB 34468 ? ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Solution structure of the antifungal protein PAFC' _pdbx_database_related.db_id 34468 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 6TRM _pdbx_database_status.recvd_initial_deposition_date 2019-12-19 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Czajlik, A.' 1 0000-0002-6812-5454 'Holzknecht, J.' 2 ? 'Marx, F.' 3 ? 'Batta, G.' 4 0000-0002-0442-1828 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country CH _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Int J Mol Sci' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1422-0067 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 22 _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Solution Structure, Dynamics, and New Antifungal Aspects of the Cysteine-Rich Miniprotein PAFC.' _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.3390/ijms22031183 _citation.pdbx_database_id_PubMed 33504082 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Czajlik, A.' 1 ? primary 'Holzknecht, J.' 2 ? primary 'Galgoczy, L.' 3 0000-0002-6976-8910 primary 'Toth, L.' 4 ? primary 'Poor, P.' 5 0000-0002-4539-6358 primary 'Ordog, A.' 6 0000-0002-1867-8237 primary 'Varadi, G.' 7 ? primary 'Kuhbacher, A.' 8 ? primary 'Borics, A.' 9 0000-0002-6331-3536 primary 'Toth, G.K.' 10 ? primary 'Marx, F.' 11 0000-0002-8408-1842 primary 'Batta, G.' 12 0000-0002-0442-1828 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Pc21g12970 protein' _entity.formula_weight 6639.278 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code DTCGGGYGVDQRRTNSPCQASNGDRHFCGCDRTGIVECKGGKWTEIQDCGGASCRGVSQGGARC _entity_poly.pdbx_seq_one_letter_code_can DTCGGGYGVDQRRTNSPCQASNGDRHFCGCDRTGIVECKGGKWTEIQDCGGASCRGVSQGGARC _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ASP n 1 2 THR n 1 3 CYS n 1 4 GLY n 1 5 GLY n 1 6 GLY n 1 7 TYR n 1 8 GLY n 1 9 VAL n 1 10 ASP n 1 11 GLN n 1 12 ARG n 1 13 ARG n 1 14 THR n 1 15 ASN n 1 16 SER n 1 17 PRO n 1 18 CYS n 1 19 GLN n 1 20 ALA n 1 21 SER n 1 22 ASN n 1 23 GLY n 1 24 ASP n 1 25 ARG n 1 26 HIS n 1 27 PHE n 1 28 CYS n 1 29 GLY n 1 30 CYS n 1 31 ASP n 1 32 ARG n 1 33 THR n 1 34 GLY n 1 35 ILE n 1 36 VAL n 1 37 GLU n 1 38 CYS n 1 39 LYS n 1 40 GLY n 1 41 GLY n 1 42 LYS n 1 43 TRP n 1 44 THR n 1 45 GLU n 1 46 ILE n 1 47 GLN n 1 48 ASP n 1 49 CYS n 1 50 GLY n 1 51 GLY n 1 52 ALA n 1 53 SER n 1 54 CYS n 1 55 ARG n 1 56 GLY n 1 57 VAL n 1 58 SER n 1 59 GLN n 1 60 GLY n 1 61 GLY n 1 62 ALA n 1 63 ARG n 1 64 CYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 64 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'Pc21g12970, PCH_Pc21g12970' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Penicillium rubens Wisconsin 54-1255' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 500485 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc 10002 _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Penicillium rubens Wisconsin 54-1255' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 500485 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc 10002 _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pSK275pafC _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code B6HMF2_PENRW _struct_ref.pdbx_db_accession B6HMF2 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code DTCGGGYGVDQRRTNSPCQASNGDRHFCGCDRTGIVECKGGKWTEIQDCGGASCRGVSQGGARC _struct_ref.pdbx_align_begin 25 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6TRM _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 64 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession B6HMF2 _struct_ref_seq.db_align_beg 25 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 88 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 64 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 2 2 '2D 1H-15N HSQC' 1 isotropic 2 2 2 '2D 1H-13C HSQC' 1 isotropic 3 1 1 '2D 1H-1H NOESY' 1 isotropic 4 1 1 '2D 1H-1H TOCSY' 1 isotropic 5 2 2 '3D 1H-15N NOESY' 1 isotropic 11 2 2 '3D 1H-15N TOCSY' 1 isotropic 10 2 2 '3D HNHA' 1 isotropic 9 2 2 '3D HNCA' 1 isotropic 8 2 2 '3D HN(CO)CA' 1 isotropic 7 2 2 '3D HNCACB' 1 isotropic 6 2 2 '3D HN(COCA)CB' 1 isotropic 13 2 2 '3D HNCO' 1 isotropic 12 2 2 '3D HN(CA)CO' 1 isotropic 14 2 2 '3D HCCH-TOCSY' 1 isotropic 15 2 2 '3D 1H-13C NOESY aliphatic' 1 isotropic # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.details _pdbx_nmr_exptl_sample_conditions.ionic_strength_err _pdbx_nmr_exptl_sample_conditions.ionic_strength_units _pdbx_nmr_exptl_sample_conditions.label _pdbx_nmr_exptl_sample_conditions.pH_err _pdbx_nmr_exptl_sample_conditions.pH_units _pdbx_nmr_exptl_sample_conditions.pressure_err _pdbx_nmr_exptl_sample_conditions.temperature_err _pdbx_nmr_exptl_sample_conditions.temperature_units 1 298 atm 1 4.5 0.007 ? 0.0007 M 1 0.05 pH 0.01 1 K 2 298 atm 1 4.5 0.007 ? 0.0007 M 2 0.05 pH 0.01 1 K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 '20 mM [U-100% 2H] acetic acid, 1.5 mM PAFC, 95 % H2O, 5 % [U-2H] D2O, 95% H2O/5% D2O' '95% H2O/5% D2O' unlabeled solution '5mm sample tube, 500 ul volume' 2 '20 mM [U-100% 2H] acetic acid, 650 uM [U-100% 13C; U-100% 15N] PAFC, 95 % H2O, 5 % [U-2H] D2O, 95% H2O/5% D2O' '95% H2O/5% D2O' 13C_15N solution '5mm sample tube, 440 ul volume' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AVANCE III' _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 700 _pdbx_nmr_spectrometer.details ? # _pdbx_nmr_refine.entry_id 6TRM _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 2 # _pdbx_nmr_ensemble.entry_id 6TRM _pdbx_nmr_ensemble.conformers_calculated_total_number 20 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'all calculated structures submitted' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 6TRM _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 refinement TALOS N 'Cornilescu, Delaglio and Bax' 2 'structure calculation' CYANA 2.1 'Guntert, Mumenthaler and Wuthrich' 3 'chemical shift assignment' 'CcpNmr Analysis' 2.4.2 CCPN 4 'peak picking' 'CcpNmr Analysis' 2.4.2 CCPN 5 processing TopSpin 3.1 'Bruker Biospin' # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6TRM _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 6TRM _struct.title 'Solution structure of the antifungal protein PAFC' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6TRM _struct_keywords.text 'SOLUTION STRUCTURE, DISULPHIDE PROTEIN, PAFC, STRUCTURE FROM CYANA 2.1, ANTIMICROBIAL PROTEIN' _struct_keywords.pdbx_keywords 'ANTIMICROBIAL PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id ALA _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 20 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ASP _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 24 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ALA _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 20 _struct_conf.end_auth_comp_id ASP _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 24 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 3 SG ? ? ? 1_555 A CYS 30 SG ? ? A CYS 3 A CYS 30 1_555 ? ? ? ? ? ? ? 1.872 ? ? disulf2 disulf ? ? A CYS 18 SG ? ? ? 1_555 A CYS 38 SG ? ? A CYS 18 A CYS 38 1_555 ? ? ? ? ? ? ? 1.991 ? ? disulf3 disulf ? ? A CYS 28 SG ? ? ? 1_555 A CYS 54 SG ? ? A CYS 28 A CYS 54 1_555 ? ? ? ? ? ? ? 1.850 ? ? disulf4 disulf ? ? A CYS 49 SG ? ? ? 1_555 A CYS 64 SG ? ? A CYS 49 A CYS 64 1_555 ? ? ? ? ? ? ? 1.979 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 3 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 HIS A 26 ? CYS A 28 ? HIS A 26 CYS A 28 AA1 2 GLY A 34 ? LYS A 39 ? GLY A 34 LYS A 39 AA1 3 LYS A 42 ? ASP A 48 ? LYS A 42 ASP A 48 AA2 1 ARG A 55 ? VAL A 57 ? ARG A 55 VAL A 57 AA2 2 GLY A 60 ? ARG A 63 ? GLY A 60 ARG A 63 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N PHE A 27 ? N PHE A 27 O VAL A 36 ? O VAL A 36 AA1 2 3 N GLU A 37 ? N GLU A 37 O THR A 44 ? O THR A 44 AA2 1 2 N VAL A 57 ? N VAL A 57 O GLY A 60 ? O GLY A 60 # _atom_sites.entry_id 6TRM _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ASP 1 1 1 ASP ASP A . n A 1 2 THR 2 2 2 THR THR A . n A 1 3 CYS 3 3 3 CYS CYS A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 GLY 5 5 5 GLY GLY A . n A 1 6 GLY 6 6 6 GLY GLY A . n A 1 7 TYR 7 7 7 TYR TYR A . n A 1 8 GLY 8 8 8 GLY GLY A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 GLN 11 11 11 GLN GLN A . n A 1 12 ARG 12 12 12 ARG ARG A . n A 1 13 ARG 13 13 13 ARG ARG A . n A 1 14 THR 14 14 14 THR THR A . n A 1 15 ASN 15 15 15 ASN ASN A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 PRO 17 17 17 PRO PRO A . n A 1 18 CYS 18 18 18 CYS CYS A . n A 1 19 GLN 19 19 19 GLN GLN A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 ASN 22 22 22 ASN ASN A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 ASP 24 24 24 ASP ASP A . n A 1 25 ARG 25 25 25 ARG ARG A . n A 1 26 HIS 26 26 26 HIS HIS A . n A 1 27 PHE 27 27 27 PHE PHE A . n A 1 28 CYS 28 28 28 CYS CYS A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 CYS 30 30 30 CYS CYS A . n A 1 31 ASP 31 31 31 ASP ASP A . n A 1 32 ARG 32 32 32 ARG ARG A . n A 1 33 THR 33 33 33 THR THR A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 ILE 35 35 35 ILE ILE A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 CYS 38 38 38 CYS CYS A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 LYS 42 42 42 LYS LYS A . n A 1 43 TRP 43 43 43 TRP TRP A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 ILE 46 46 46 ILE ILE A . n A 1 47 GLN 47 47 47 GLN GLN A . n A 1 48 ASP 48 48 48 ASP ASP A . n A 1 49 CYS 49 49 49 CYS CYS A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 SER 53 53 53 SER SER A . n A 1 54 CYS 54 54 54 CYS CYS A . n A 1 55 ARG 55 55 55 ARG ARG A . n A 1 56 GLY 56 56 56 GLY GLY A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 SER 58 58 58 SER SER A . n A 1 59 GLN 59 59 59 GLN GLN A . n A 1 60 GLY 60 60 60 GLY GLY A . n A 1 61 GLY 61 61 61 GLY GLY A . n A 1 62 ALA 62 62 62 ALA ALA A . n A 1 63 ARG 63 63 63 ARG ARG A . n A 1 64 CYS 64 64 64 CYS CYS A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 3740 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-10-28 2 'Structure model' 1 1 2021-02-10 3 'Structure model' 1 2 2021-06-23 4 'Structure model' 1 3 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 4 'Structure model' 'Database references' 4 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' database_2 5 4 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.pdbx_database_id_DOI' 7 2 'Structure model' '_citation.pdbx_database_id_PubMed' 8 2 'Structure model' '_citation.title' 9 2 'Structure model' '_citation.year' 10 3 'Structure model' '_pdbx_nmr_spectrometer.field_strength' 11 4 'Structure model' '_database_2.pdbx_DOI' 12 4 'Structure model' '_database_2.pdbx_database_accession' 13 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 'acetic acid' 20 ? mM '[U-100% 2H]' 1 PAFC 1.5 ? mM 'natural abundance' 1 H2O 95 ? % 'natural abundance' 1 D2O 5 ? % '[U-2H]' 2 'acetic acid' 20 ? mM '[U-100% 2H]' 2 PAFC 650 ? uM '[U-100% 13C; U-100% 15N]' 2 H2O 95 ? % 'natural abundance' 2 D2O 5 ? % '[U-2H]' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 CYS A 3 ? ? -170.39 26.02 2 1 ARG A 32 ? ? 56.65 19.39 3 1 SER A 53 ? ? -145.24 10.85 4 2 CYS A 3 ? ? -168.80 25.67 5 2 ARG A 32 ? ? 57.93 18.76 6 3 CYS A 3 ? ? -169.97 25.77 7 3 ARG A 32 ? ? 56.84 19.10 8 3 SER A 53 ? ? -145.98 11.55 9 4 CYS A 3 ? ? -172.71 25.36 10 4 ARG A 32 ? ? 56.84 19.06 11 4 SER A 53 ? ? -146.02 12.08 12 5 CYS A 3 ? ? -169.06 25.50 13 5 ARG A 32 ? ? 56.82 19.01 14 5 SER A 53 ? ? -146.67 12.40 15 6 CYS A 3 ? ? -170.84 26.55 16 6 ARG A 32 ? ? 56.68 19.46 17 7 CYS A 3 ? ? -168.67 25.34 18 7 ARG A 32 ? ? 57.63 18.48 19 8 CYS A 3 ? ? -171.65 22.36 20 8 ARG A 32 ? ? 57.56 18.67 21 8 SER A 53 ? ? -147.26 13.05 22 9 CYS A 3 ? ? -169.38 25.93 23 9 ARG A 32 ? ? 58.04 18.44 24 10 CYS A 3 ? ? -168.54 25.29 25 10 ARG A 32 ? ? 57.56 18.93 26 11 CYS A 3 ? ? -167.05 24.80 27 11 ARG A 32 ? ? 57.25 19.06 28 11 SER A 53 ? ? -146.54 12.37 29 12 CYS A 3 ? ? -167.72 25.02 30 12 ARG A 32 ? ? 59.66 15.60 31 12 ALA A 52 ? ? -69.04 79.74 32 12 SER A 53 ? ? -150.32 8.68 33 13 CYS A 3 ? ? -171.67 24.97 34 13 ARG A 32 ? ? 57.91 18.18 35 13 CYS A 38 ? ? -67.26 99.95 36 14 CYS A 3 ? ? -172.71 24.97 37 14 ARG A 32 ? ? 56.94 19.02 38 15 CYS A 3 ? ? -169.36 25.73 39 15 ARG A 32 ? ? 56.31 19.85 40 16 CYS A 3 ? ? -169.99 25.75 41 16 ARG A 32 ? ? 57.00 19.46 42 17 CYS A 3 ? ? -174.17 21.16 43 17 ARG A 32 ? ? 59.36 17.81 44 18 CYS A 3 ? ? -172.97 20.71 45 18 ARG A 32 ? ? 59.20 17.73 46 19 CYS A 3 ? ? -173.77 21.87 47 19 ARG A 32 ? ? 57.61 18.26 48 19 SER A 53 ? ? -146.23 12.27 49 20 CYS A 3 ? ? -174.32 20.82 50 20 ARG A 32 ? ? 57.28 18.83 51 20 SER A 53 ? ? -144.41 10.46 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'European Regional Development Fund' Hungary GINOP-2.3.2-15-2016-00008 1 'European Regional Development Fund' Hungary GINOP-2.3.3-15-2016-00004 2 'Austrian Science Fund' Austria 'FWF I3132-B21' 3 # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #