data_6TVU # _entry.id 6TVU # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.381 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6TVU pdb_00006tvu 10.2210/pdb6tvu/pdb WWPDB D_1292106162 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6TVU _pdbx_database_status.recvd_initial_deposition_date 2020-01-10 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible N # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Huhmann, S.' 1 ? 'Nyakatura, E.K.' 2 ? 'Rohrhofer, A.' 3 ? 'Schmidt, B.' 4 ? 'Eichler, J.' 5 ? 'Moschner, J.' 6 ? 'Roth, C.' 7 ? 'Koksch, B.' 8 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country GE _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Chembiochem _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1439-7633 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 22 _citation.language ? _citation.page_first 3443 _citation.page_last 3451 _citation.title 'Systematic Evaluation of Fluorination as Modification for Peptide-Based Fusion Inhibitors against HIV-1 Infection.' _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1002/cbic.202100417 _citation.pdbx_database_id_PubMed 34605595 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Huhmann, S.' 1 0000-0001-5519-3426 primary 'Nyakatura, E.K.' 2 ? primary 'Rohrhofer, A.' 3 ? primary 'Moschner, J.' 4 ? primary 'Schmidt, B.' 5 0000-0003-0059-0349 primary 'Eichler, J.' 6 0000-0001-6683-9456 primary 'Roth, C.' 7 0000-0001-5806-0987 primary 'Koksch, B.' 8 0000-0002-9747-0740 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 6TVU _cell.details ? _cell.formula_units_Z ? _cell.length_a 44.963 _cell.length_a_esd ? _cell.length_b 44.963 _cell.length_b_esd ? _cell.length_c 209.010 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 18 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6TVU _symmetry.cell_setting ? _symmetry.Int_Tables_number 155 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'H 3 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer syn 'Env polyprotein (Fragment)' 4515.291 1 ? ? ? ? 2 polymer syn 'Transmembrane protein gp41' 3792.078 1 ? ? ? ? 3 water nat water 18.015 87 ? ? ? ? # _entity_name_com.entity_id 2 _entity_name_com.name 'TM,Glycoprotein 41,gp41' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no yes '(ACE)NNLLRAIEAQQHLLQLTVWGIKQLQARILAVERYLKDQ(NH2)' XNNLLRAIEAQQHLLQLTVWGIKQLQARILAVERYLKDQX AaA ? 2 'polypeptide(L)' no yes 'QIWNNMTWMEWDRE(OBF)NNYTSLIHSLIEESQ' QIWNNMTWMEWDREXNNYTSLIHSLIEESQ BBB ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ACE n 1 2 ASN n 1 3 ASN n 1 4 LEU n 1 5 LEU n 1 6 ARG n 1 7 ALA n 1 8 ILE n 1 9 GLU n 1 10 ALA n 1 11 GLN n 1 12 GLN n 1 13 HIS n 1 14 LEU n 1 15 LEU n 1 16 GLN n 1 17 LEU n 1 18 THR n 1 19 VAL n 1 20 TRP n 1 21 GLY n 1 22 ILE n 1 23 LYS n 1 24 GLN n 1 25 LEU n 1 26 GLN n 1 27 ALA n 1 28 ARG n 1 29 ILE n 1 30 LEU n 1 31 ALA n 1 32 VAL n 1 33 GLU n 1 34 ARG n 1 35 TYR n 1 36 LEU n 1 37 LYS n 1 38 ASP n 1 39 GLN n 1 40 NH2 n 2 1 GLN n 2 2 ILE n 2 3 TRP n 2 4 ASN n 2 5 ASN n 2 6 MET n 2 7 THR n 2 8 TRP n 2 9 MET n 2 10 GLU n 2 11 TRP n 2 12 ASP n 2 13 ARG n 2 14 GLU n 2 15 OBF n 2 16 ASN n 2 17 ASN n 2 18 TYR n 2 19 THR n 2 20 SER n 2 21 LEU n 2 22 ILE n 2 23 HIS n 2 24 SER n 2 25 LEU n 2 26 ILE n 2 27 GLU n 2 28 GLU n 2 29 SER n 2 30 GLN n # loop_ _pdbx_entity_src_syn.entity_id _pdbx_entity_src_syn.pdbx_src_id _pdbx_entity_src_syn.pdbx_alt_source_flag _pdbx_entity_src_syn.pdbx_beg_seq_num _pdbx_entity_src_syn.pdbx_end_seq_num _pdbx_entity_src_syn.organism_scientific _pdbx_entity_src_syn.organism_common_name _pdbx_entity_src_syn.ncbi_taxonomy_id _pdbx_entity_src_syn.details 1 1 sample 1 40 'Human immunodeficiency virus 1' ? 11676 ? 2 1 sample 1 30 'Human immunodeficiency virus 1' ? 11676 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP C7F3P9_9HIV1 C7F3P9 ? 1 NNLLRAIEAQQHLLQLTVWGIKQLQARILAVERYLKDQ 9 2 UNP ENV_HV1B8 P04582 ? 2 QIWNNMTWMEWDREINNYTSLIHSLIEESQ 616 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 6TVU AaA 2 ? 39 ? C7F3P9 9 ? 46 ? 602 639 2 2 6TVU BBB 1 ? 30 ? P04582 616 ? 645 ? 621 650 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6TVU ACE AaA 1 ? UNP C7F3P9 ? ? acetylation 601 1 1 6TVU NH2 AaA 40 ? UNP C7F3P9 ? ? amidation 640 2 2 6TVU OBF BBB 15 ? UNP P04582 ILE 630 conflict 635 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ACE non-polymer . 'ACETYL GROUP' ? 'C2 H4 O' 44.053 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NH2 non-polymer . 'AMINO GROUP' ? 'H2 N' 16.023 OBF 'L-peptide linking' . '(2S)-2-amino-4,4-difluorobutanoic acid' ? 'C4 H7 F2 N O2' 139.101 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6TVU _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.49 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 50.51 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 5.6 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'PEG 4000, 2-Propanol, Citrate' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 S 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2019-11-06 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.918400 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'BESSY BEAMLINE 14.1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.918400 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 14.1 _diffrn_source.pdbx_synchrotron_site BESSY # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6TVU _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.25 _reflns.d_resolution_low 38.3 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 23184 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 14.5 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 7.5 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all 0.083 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.997 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.25 _reflns_shell.d_res_low 1.27 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1119 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.396 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] 0.862 _refine.aniso_B[1][2] 0.431 _refine.aniso_B[1][3] 0.000 _refine.aniso_B[2][2] 0.862 _refine.aniso_B[2][3] 0.000 _refine.aniso_B[3][3] -2.795 _refine.B_iso_max ? _refine.B_iso_mean 21.651 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.972 _refine.correlation_coeff_Fo_to_Fc_free 0.954 _refine.details 'Hydrogens have been added in their riding positions' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6TVU _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.250 _refine.ls_d_res_low 38.28 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 23183 _refine.ls_number_reflns_R_free 1114 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.970 _refine.ls_percent_reflns_R_free 4.805 _refine.ls_R_factor_all 0.164 _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_free 0.2104 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1620 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'AB INITIO PHASING' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.044 _refine.pdbx_overall_ESU_R_Free 0.048 _refine.pdbx_solvent_vdw_probe_radii 1.200 _refine.pdbx_solvent_ion_probe_radii 0.800 _refine.pdbx_solvent_shrinkage_radii 0.800 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 2.238 _refine.overall_SU_ML 0.040 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 564 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 12 _refine_hist.number_atoms_solvent 87 _refine_hist.number_atoms_total 663 _refine_hist.d_res_high 1.250 _refine_hist.d_res_low 38.28 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.012 0.013 638 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.017 582 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.732 1.630 870 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.589 1.577 1354 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 3.740 5.000 75 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 39.079 22.258 31 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 13.675 15.000 106 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 19.075 15.000 4 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.092 0.200 83 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.009 0.020 720 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.003 0.020 133 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? 0.332 0.200 175 ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.240 0.200 498 ? r_symmetry_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.175 0.200 311 ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? 0.081 0.200 258 ? r_symmetry_nbtor_other ? ? 'X-RAY DIFFRACTION' ? 0.214 0.200 47 ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.192 0.200 17 ? r_symmetry_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.194 0.200 62 ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.118 0.200 16 ? r_symmetry_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 2.548 1.877 294 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 2.547 1.889 295 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 3.313 2.778 371 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 3.339 2.794 372 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 4.315 2.434 344 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 4.312 2.446 345 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? 5.360 3.453 499 ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 5.355 3.465 500 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 5.646 25.031 812 ? r_lrange_it ? ? 'X-RAY DIFFRACTION' ? 5.359 24.357 787 ? r_lrange_other ? ? 'X-RAY DIFFRACTION' ? 5.353 3.000 1218 ? r_rigid_bond_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.250 1.282 . . 79 1607 99.9407 . . . 0.323 . 0.325 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.282 1.318 . . 92 1544 100.0000 . . . 0.272 . 0.302 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.318 1.356 . . 74 1511 100.0000 . . . 0.296 . 0.267 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.356 1.397 . . 66 1507 100.0000 . . . 0.289 . 0.239 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.397 1.443 . . 76 1420 100.0000 . . . 0.249 . 0.233 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.443 1.494 . . 79 1393 100.0000 . . . 0.218 . 0.177 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.494 1.550 . . 60 1359 100.0000 . . . 0.225 . 0.136 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.550 1.614 . . 74 1269 100.0000 . . . 0.153 . 0.120 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.614 1.685 . . 75 1233 100.0000 . . . 0.162 . 0.114 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.685 1.767 . . 53 1207 100.0000 . . . 0.189 . 0.121 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.767 1.863 . . 58 1144 100.0000 . . . 0.207 . 0.128 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.863 1.976 . . 49 1073 99.9109 . . . 0.208 . 0.136 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.976 2.112 . . 50 1019 100.0000 . . . 0.200 . 0.128 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.112 2.281 . . 44 957 100.0000 . . . 0.162 . 0.116 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.281 2.499 . . 44 893 99.8934 . . . 0.150 . 0.115 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.499 2.793 . . 36 803 100.0000 . . . 0.175 . 0.132 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.793 3.225 . . 31 726 100.0000 . . . 0.193 . 0.148 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.225 3.947 . . 33 609 100.0000 . . . 0.186 . 0.163 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.947 5.573 . . 28 493 100.0000 . . . 0.265 . 0.162 . . . . . . . . . . . 'X-RAY DIFFRACTION' 5.573 38.2 . . 13 302 99.6835 . . . 0.318 . 0.279 . . . . . . . . . . . # _struct.entry_id 6TVU _struct.title 'Structure of native gp41 derived peptide fusion inhibitor' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6TVU _struct_keywords.text 'Inhibitor, helix bundle, HIV, viral protein' _struct_keywords.pdbx_keywords 'VIRAL PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASN A 2 ? GLN A 39 ? ASN AaA 602 GLN AaA 639 1 ? 38 HELX_P HELX_P2 AA2 ASN B 4 ? SER B 29 ? ASN BBB 624 SER BBB 649 1 ? 26 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A ACE 1 C ? ? ? 1_555 A ASN 2 N ? ? AaA ACE 601 AaA ASN 602 1_555 ? ? ? ? ? ? ? 1.356 ? ? covale2 covale both ? A GLN 39 C ? ? ? 1_555 A NH2 40 N ? ? AaA GLN 639 AaA NH2 640 1_555 ? ? ? ? ? ? ? 1.395 ? ? covale3 covale both ? B GLU 14 C ? ? ? 1_555 B OBF 15 N ? ? BBB GLU 634 BBB OBF 635 1_555 ? ? ? ? ? ? ? 1.452 ? ? covale4 covale both ? B OBF 15 C ? ? ? 1_555 B ASN 16 N ? ? BBB OBF 635 BBB ASN 636 1_555 ? ? ? ? ? ? ? 1.435 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _atom_sites.entry_id 6TVU _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.022241 _atom_sites.fract_transf_matrix[1][2] 0.012841 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.025681 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.004784 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.pdbx_scat_Z _atom_type.pdbx_N_electrons _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c C 6 6 2.310 20.844 1.020 10.208 1.589 0.569 0.865 51.651 0.216 F 9 9 3.539 10.282 2.641 4.294 1.517 0.262 1.024 26.148 0.300 H 1 1 0.493 10.511 0.323 26.126 0.140 3.142 0.041 57.800 0.003 N 7 7 12.222 0.006 3.135 9.893 2.014 28.997 1.167 0.583 -11.538 N+1 7 7 12.222 0.006 3.135 9.893 2.014 28.997 1.167 0.583 -11.538 O 8 8 3.049 13.277 2.287 5.701 1.546 0.324 0.867 32.909 0.251 S 16 16 6.905 1.468 5.203 22.215 1.438 0.254 1.586 56.172 1.032 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ACE 1 601 552 ACE ACT AaA . n A 1 2 ASN 2 602 553 ASN ASN AaA . n A 1 3 ASN 3 603 554 ASN ASN AaA . n A 1 4 LEU 4 604 555 LEU LEU AaA . n A 1 5 LEU 5 605 556 LEU LEU AaA . n A 1 6 ARG 6 606 557 ARG ARG AaA . n A 1 7 ALA 7 607 558 ALA ALA AaA . n A 1 8 ILE 8 608 559 ILE ILE AaA . n A 1 9 GLU 9 609 560 GLU GLU AaA . n A 1 10 ALA 10 610 561 ALA ALA AaA . n A 1 11 GLN 11 611 562 GLN GLN AaA . n A 1 12 GLN 12 612 563 GLN GLN AaA . n A 1 13 HIS 13 613 564 HIS HIS AaA . n A 1 14 LEU 14 614 565 LEU LEU AaA . n A 1 15 LEU 15 615 566 LEU LEU AaA . n A 1 16 GLN 16 616 567 GLN GLN AaA . n A 1 17 LEU 17 617 568 LEU LEU AaA . n A 1 18 THR 18 618 569 THR THR AaA . n A 1 19 VAL 19 619 570 VAL VAL AaA . n A 1 20 TRP 20 620 571 TRP TRP AaA . n A 1 21 GLY 21 621 572 GLY GLY AaA . n A 1 22 ILE 22 622 573 ILE ILE AaA . n A 1 23 LYS 23 623 574 LYS LYS AaA . n A 1 24 GLN 24 624 575 GLN GLN AaA . n A 1 25 LEU 25 625 576 LEU LEU AaA . n A 1 26 GLN 26 626 577 GLN GLN AaA . n A 1 27 ALA 27 627 578 ALA ALA AaA . n A 1 28 ARG 28 628 579 ARG ARG AaA . n A 1 29 ILE 29 629 580 ILE ILE AaA . n A 1 30 LEU 30 630 581 LEU LEU AaA . n A 1 31 ALA 31 631 582 ALA ALA AaA . n A 1 32 VAL 32 632 583 VAL VAL AaA . n A 1 33 GLU 33 633 584 GLU GLU AaA . n A 1 34 ARG 34 634 585 ARG ARG AaA . n A 1 35 TYR 35 635 586 TYR TYR AaA . n A 1 36 LEU 36 636 587 LEU LEU AaA . n A 1 37 LYS 37 637 588 LYS LYS AaA . n A 1 38 ASP 38 638 589 ASP ASP AaA . n A 1 39 GLN 39 639 590 GLN GLN AaA . n A 1 40 NH2 40 640 591 NH2 NH2 AaA . n B 2 1 GLN 1 621 621 GLN GLN BBB . n B 2 2 ILE 2 622 622 ILE ILE BBB . n B 2 3 TRP 3 623 623 TRP TRP BBB . n B 2 4 ASN 4 624 624 ASN ASN BBB . n B 2 5 ASN 5 625 625 ASN ASN BBB . n B 2 6 MET 6 626 626 MET MET BBB . n B 2 7 THR 7 627 627 THR THR BBB . n B 2 8 TRP 8 628 628 TRP TRP BBB . n B 2 9 MET 9 629 629 MET MET BBB . n B 2 10 GLU 10 630 630 GLU GLU BBB . n B 2 11 TRP 11 631 631 TRP TRP BBB . n B 2 12 ASP 12 632 632 ASP ASP BBB . n B 2 13 ARG 13 633 633 ARG ARG BBB . n B 2 14 GLU 14 634 634 GLU GLU BBB . n B 2 15 OBF 15 635 635 OBF DRG BBB . n B 2 16 ASN 16 636 636 ASN ASN BBB . n B 2 17 ASN 17 637 637 ASN ASN BBB . n B 2 18 TYR 18 638 638 TYR TYR BBB . n B 2 19 THR 19 639 639 THR THR BBB . n B 2 20 SER 20 640 640 SER SER BBB . n B 2 21 LEU 21 641 641 LEU LEU BBB . n B 2 22 ILE 22 642 642 ILE ILE BBB . n B 2 23 HIS 23 643 643 HIS HIS BBB . n B 2 24 SER 24 644 644 SER SER BBB . n B 2 25 LEU 25 645 645 LEU LEU BBB . n B 2 26 ILE 26 646 646 ILE ILE BBB . n B 2 27 GLU 27 647 647 GLU GLU BBB . n B 2 28 GLU 28 648 648 GLU GLU BBB . n B 2 29 SER 29 649 649 SER SER BBB . n B 2 30 GLN 30 650 ? ? ? BBB . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 HOH 1 701 43 HOH HOH AaA . C 3 HOH 2 702 37 HOH HOH AaA . C 3 HOH 3 703 64 HOH HOH AaA . C 3 HOH 4 704 20 HOH HOH AaA . C 3 HOH 5 705 36 HOH HOH AaA . C 3 HOH 6 706 2 HOH HOH AaA . C 3 HOH 7 707 16 HOH HOH AaA . C 3 HOH 8 708 9 HOH HOH AaA . C 3 HOH 9 709 7 HOH HOH AaA . C 3 HOH 10 710 32 HOH HOH AaA . C 3 HOH 11 711 13 HOH HOH AaA . C 3 HOH 12 712 23 HOH HOH AaA . C 3 HOH 13 713 19 HOH HOH AaA . C 3 HOH 14 714 4 HOH HOH AaA . C 3 HOH 15 715 22 HOH HOH AaA . C 3 HOH 16 716 1 HOH HOH AaA . C 3 HOH 17 717 5 HOH HOH AaA . C 3 HOH 18 718 86 HOH HOH AaA . C 3 HOH 19 719 3 HOH HOH AaA . C 3 HOH 20 720 46 HOH HOH AaA . C 3 HOH 21 721 49 HOH HOH AaA . C 3 HOH 22 722 56 HOH HOH AaA . C 3 HOH 23 723 45 HOH HOH AaA . C 3 HOH 24 724 27 HOH HOH AaA . C 3 HOH 25 725 88 HOH HOH AaA . C 3 HOH 26 726 10 HOH HOH AaA . C 3 HOH 27 727 89 HOH HOH AaA . C 3 HOH 28 728 31 HOH HOH AaA . C 3 HOH 29 729 76 HOH HOH AaA . C 3 HOH 30 730 30 HOH HOH AaA . C 3 HOH 31 731 14 HOH HOH AaA . C 3 HOH 32 732 47 HOH HOH AaA . C 3 HOH 33 733 8 HOH HOH AaA . C 3 HOH 34 734 94 HOH HOH AaA . C 3 HOH 35 735 6 HOH HOH AaA . C 3 HOH 36 736 95 HOH HOH AaA . C 3 HOH 37 737 77 HOH HOH AaA . C 3 HOH 38 738 11 HOH HOH AaA . C 3 HOH 39 739 42 HOH HOH AaA . C 3 HOH 40 740 73 HOH HOH AaA . C 3 HOH 41 741 35 HOH HOH AaA . C 3 HOH 42 742 18 HOH HOH AaA . C 3 HOH 43 743 12 HOH HOH AaA . C 3 HOH 44 744 81 HOH HOH AaA . C 3 HOH 45 745 39 HOH HOH AaA . C 3 HOH 46 746 15 HOH HOH AaA . C 3 HOH 47 747 78 HOH HOH AaA . C 3 HOH 48 748 69 HOH HOH AaA . C 3 HOH 49 749 50 HOH HOH AaA . C 3 HOH 50 750 63 HOH HOH AaA . C 3 HOH 51 751 26 HOH HOH AaA . C 3 HOH 52 752 28 HOH HOH AaA . C 3 HOH 53 753 24 HOH HOH AaA . C 3 HOH 54 754 80 HOH HOH AaA . C 3 HOH 55 755 58 HOH HOH AaA . C 3 HOH 56 756 52 HOH HOH AaA . C 3 HOH 57 757 82 HOH HOH AaA . D 3 HOH 1 701 60 HOH HOH BBB . D 3 HOH 2 702 92 HOH HOH BBB . D 3 HOH 3 703 59 HOH HOH BBB . D 3 HOH 4 704 55 HOH HOH BBB . D 3 HOH 5 705 25 HOH HOH BBB . D 3 HOH 6 706 44 HOH HOH BBB . D 3 HOH 7 707 72 HOH HOH BBB . D 3 HOH 8 708 93 HOH HOH BBB . D 3 HOH 9 709 71 HOH HOH BBB . D 3 HOH 10 710 38 HOH HOH BBB . D 3 HOH 11 711 85 HOH HOH BBB . D 3 HOH 12 712 74 HOH HOH BBB . D 3 HOH 13 713 75 HOH HOH BBB . D 3 HOH 14 714 87 HOH HOH BBB . D 3 HOH 15 715 21 HOH HOH BBB . D 3 HOH 16 716 51 HOH HOH BBB . D 3 HOH 17 717 17 HOH HOH BBB . D 3 HOH 18 718 90 HOH HOH BBB . D 3 HOH 19 719 48 HOH HOH BBB . D 3 HOH 20 720 53 HOH HOH BBB . D 3 HOH 21 721 70 HOH HOH BBB . D 3 HOH 22 722 61 HOH HOH BBB . D 3 HOH 23 723 66 HOH HOH BBB . D 3 HOH 24 724 29 HOH HOH BBB . D 3 HOH 25 725 68 HOH HOH BBB . D 3 HOH 26 726 57 HOH HOH BBB . D 3 HOH 27 727 79 HOH HOH BBB . D 3 HOH 28 728 40 HOH HOH BBB . D 3 HOH 29 729 41 HOH HOH BBB . D 3 HOH 30 730 83 HOH HOH BBB . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details nonameric _pdbx_struct_assembly.oligomeric_count 9 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B,C,D 1 2 A,B,C,D 1 3 A,B,C,D # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_455 -y-1,x-y,z -0.5000000000 -0.8660254038 0.0000000000 -44.9630000000 0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_445 -x+y-1,-x-1,z -0.5000000000 0.8660254038 0.0000000000 -22.4815000000 -0.8660254038 -0.5000000000 0.0000000000 -38.9391002304 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 AaA HOH 702 ? C HOH . 2 1 AaA HOH 710 ? C HOH . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-01-27 2 'Structure model' 1 1 2022-02-16 3 'Structure model' 2 0 2023-07-19 4 'Structure model' 3 0 2023-11-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' Advisory 3 3 'Structure model' 'Atomic model' 4 3 'Structure model' 'Data collection' 5 3 'Structure model' 'Database references' 6 3 'Structure model' 'Derived calculations' 7 3 'Structure model' 'Non-polymer description' 8 3 'Structure model' 'Polymer sequence' 9 3 'Structure model' 'Source and taxonomy' 10 3 'Structure model' 'Structure summary' 11 4 'Structure model' Advisory 12 4 'Structure model' 'Atomic model' 13 4 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 2 'Structure model' database_2 4 3 'Structure model' atom_site 5 3 'Structure model' atom_site_anisotrop 6 3 'Structure model' atom_type 7 3 'Structure model' chem_comp 8 3 'Structure model' entity 9 3 'Structure model' entity_name_com 10 3 'Structure model' entity_poly 11 3 'Structure model' entity_poly_seq 12 3 'Structure model' pdbx_distant_solvent_atoms 13 3 'Structure model' pdbx_entity_nonpoly 14 3 'Structure model' pdbx_entity_src_syn 15 3 'Structure model' pdbx_nonpoly_scheme 16 3 'Structure model' pdbx_poly_seq_scheme 17 3 'Structure model' pdbx_struct_assembly_gen 18 3 'Structure model' pdbx_struct_special_symmetry 19 3 'Structure model' pdbx_unobs_or_zero_occ_residues 20 3 'Structure model' pdbx_validate_close_contact 21 3 'Structure model' struct_asym 22 3 'Structure model' struct_conf 23 3 'Structure model' struct_conn 24 3 'Structure model' struct_ref 25 3 'Structure model' struct_ref_seq 26 3 'Structure model' struct_ref_seq_dif 27 4 'Structure model' atom_site 28 4 'Structure model' atom_site_anisotrop 29 4 'Structure model' chem_comp_atom 30 4 'Structure model' chem_comp_bond 31 4 'Structure model' pdbx_validate_close_contact # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.pdbx_database_id_PubMed' 10 2 'Structure model' '_citation.title' 11 2 'Structure model' '_citation.year' 12 2 'Structure model' '_citation_author.identifier_ORCID' 13 2 'Structure model' '_citation_author.name' 14 2 'Structure model' '_database_2.pdbx_DOI' 15 2 'Structure model' '_database_2.pdbx_database_accession' 16 3 'Structure model' '_atom_type.pdbx_N_electrons' 17 3 'Structure model' '_atom_type.pdbx_scat_Z' 18 3 'Structure model' '_chem_comp.formula' 19 3 'Structure model' '_chem_comp.formula_weight' 20 3 'Structure model' '_chem_comp.id' 21 3 'Structure model' '_chem_comp.name' 22 3 'Structure model' '_pdbx_distant_solvent_atoms.auth_seq_id' 23 3 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list' 24 3 'Structure model' '_pdbx_struct_special_symmetry.label_asym_id' 25 3 'Structure model' '_pdbx_unobs_or_zero_occ_residues.auth_asym_id' 26 3 'Structure model' '_pdbx_unobs_or_zero_occ_residues.label_asym_id' 27 3 'Structure model' '_pdbx_unobs_or_zero_occ_residues.label_seq_id' 28 3 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 29 3 'Structure model' '_struct_conn.ptnr1_auth_asym_id' 30 3 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 31 3 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 32 3 'Structure model' '_struct_conn.ptnr1_label_asym_id' 33 3 'Structure model' '_struct_conn.ptnr1_label_atom_id' 34 3 'Structure model' '_struct_conn.ptnr1_label_comp_id' 35 3 'Structure model' '_struct_conn.ptnr1_label_seq_id' 36 3 'Structure model' '_struct_conn.ptnr2_auth_asym_id' 37 3 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 38 3 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 39 3 'Structure model' '_struct_conn.ptnr2_label_asym_id' 40 3 'Structure model' '_struct_conn.ptnr2_label_atom_id' 41 3 'Structure model' '_struct_conn.ptnr2_label_comp_id' 42 3 'Structure model' '_struct_conn.ptnr2_label_seq_id' 43 4 'Structure model' '_atom_site.B_iso_or_equiv' 44 4 'Structure model' '_atom_site.Cartn_x' 45 4 'Structure model' '_atom_site.Cartn_y' 46 4 'Structure model' '_atom_site.Cartn_z' 47 4 'Structure model' '_atom_site.auth_atom_id' 48 4 'Structure model' '_atom_site.label_atom_id' 49 4 'Structure model' '_atom_site_anisotrop.U[1][1]' 50 4 'Structure model' '_atom_site_anisotrop.U[1][2]' 51 4 'Structure model' '_atom_site_anisotrop.U[1][3]' 52 4 'Structure model' '_atom_site_anisotrop.U[2][2]' 53 4 'Structure model' '_atom_site_anisotrop.U[2][3]' 54 4 'Structure model' '_atom_site_anisotrop.U[3][3]' 55 4 'Structure model' '_atom_site_anisotrop.id' 56 4 'Structure model' '_atom_site_anisotrop.pdbx_auth_atom_id' 57 4 'Structure model' '_atom_site_anisotrop.pdbx_label_atom_id' 58 4 'Structure model' '_pdbx_validate_close_contact.auth_atom_id_2' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0258 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? ACORN ? ? ? . 4 # _pdbx_entry_details.entry_id 6TVU _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 C BBB GLU 634 ? ? H BBB OBF 635 ? ? 1.02 2 1 C BBB GLU 634 ? ? H2 BBB OBF 635 ? ? 1.42 3 1 O BBB HOH 703 ? ? O BBB HOH 722 ? ? 2.12 # loop_ _pdbx_distant_solvent_atoms.id _pdbx_distant_solvent_atoms.PDB_model_num _pdbx_distant_solvent_atoms.auth_atom_id _pdbx_distant_solvent_atoms.label_alt_id _pdbx_distant_solvent_atoms.auth_asym_id _pdbx_distant_solvent_atoms.auth_comp_id _pdbx_distant_solvent_atoms.auth_seq_id _pdbx_distant_solvent_atoms.PDB_ins_code _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance _pdbx_distant_solvent_atoms.neighbor_ligand_distance 1 1 O ? AaA HOH 751 ? 5.83 . 2 1 O ? AaA HOH 752 ? 5.86 . 3 1 O ? AaA HOH 753 ? 6.01 . 4 1 O ? AaA HOH 754 ? 6.10 . 5 1 O ? AaA HOH 755 ? 7.04 . 6 1 O ? AaA HOH 756 ? 7.98 . 7 1 O ? AaA HOH 757 ? 8.62 . 8 1 O ? BBB HOH 730 ? 5.83 . # _pdbx_unobs_or_zero_occ_residues.id 1 _pdbx_unobs_or_zero_occ_residues.PDB_model_num 1 _pdbx_unobs_or_zero_occ_residues.polymer_flag Y _pdbx_unobs_or_zero_occ_residues.occupancy_flag 1 _pdbx_unobs_or_zero_occ_residues.auth_asym_id BBB _pdbx_unobs_or_zero_occ_residues.auth_comp_id GLN _pdbx_unobs_or_zero_occ_residues.auth_seq_id 650 _pdbx_unobs_or_zero_occ_residues.PDB_ins_code ? _pdbx_unobs_or_zero_occ_residues.label_asym_id B _pdbx_unobs_or_zero_occ_residues.label_comp_id GLN _pdbx_unobs_or_zero_occ_residues.label_seq_id 30 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ACE C C N N 1 ACE O O N N 2 ACE CH3 C N N 3 ACE H H N N 4 ACE H1 H N N 5 ACE H2 H N N 6 ACE H3 H N N 7 ALA N N N N 8 ALA CA C N S 9 ALA C C N N 10 ALA O O N N 11 ALA CB C N N 12 ALA OXT O N N 13 ALA H H N N 14 ALA H2 H N N 15 ALA HA H N N 16 ALA HB1 H N N 17 ALA HB2 H N N 18 ALA HB3 H N N 19 ALA HXT H N N 20 ARG N N N N 21 ARG CA C N S 22 ARG C C N N 23 ARG O O N N 24 ARG CB C N N 25 ARG CG C N N 26 ARG CD C N N 27 ARG NE N N N 28 ARG CZ C N N 29 ARG NH1 N N N 30 ARG NH2 N N N 31 ARG OXT O N N 32 ARG H H N N 33 ARG H2 H N N 34 ARG HA H N N 35 ARG HB2 H N N 36 ARG HB3 H N N 37 ARG HG2 H N N 38 ARG HG3 H N N 39 ARG HD2 H N N 40 ARG HD3 H N N 41 ARG HE H N N 42 ARG HH11 H N N 43 ARG HH12 H N N 44 ARG HH21 H N N 45 ARG HH22 H N N 46 ARG HXT H N N 47 ASN N N N N 48 ASN CA C N S 49 ASN C C N N 50 ASN O O N N 51 ASN CB C N N 52 ASN CG C N N 53 ASN OD1 O N N 54 ASN ND2 N N N 55 ASN OXT O N N 56 ASN H H N N 57 ASN H2 H N N 58 ASN HA H N N 59 ASN HB2 H N N 60 ASN HB3 H N N 61 ASN HD21 H N N 62 ASN HD22 H N N 63 ASN HXT H N N 64 ASP N N N N 65 ASP CA C N S 66 ASP C C N N 67 ASP O O N N 68 ASP CB C N N 69 ASP CG C N N 70 ASP OD1 O N N 71 ASP OD2 O N N 72 ASP OXT O N N 73 ASP H H N N 74 ASP H2 H N N 75 ASP HA H N N 76 ASP HB2 H N N 77 ASP HB3 H N N 78 ASP HD2 H N N 79 ASP HXT H N N 80 GLN N N N N 81 GLN CA C N S 82 GLN C C N N 83 GLN O O N N 84 GLN CB C N N 85 GLN CG C N N 86 GLN CD C N N 87 GLN OE1 O N N 88 GLN NE2 N N N 89 GLN OXT O N N 90 GLN H H N N 91 GLN H2 H N N 92 GLN HA H N N 93 GLN HB2 H N N 94 GLN HB3 H N N 95 GLN HG2 H N N 96 GLN HG3 H N N 97 GLN HE21 H N N 98 GLN HE22 H N N 99 GLN HXT H N N 100 GLU N N N N 101 GLU CA C N S 102 GLU C C N N 103 GLU O O N N 104 GLU CB C N N 105 GLU CG C N N 106 GLU CD C N N 107 GLU OE1 O N N 108 GLU OE2 O N N 109 GLU OXT O N N 110 GLU H H N N 111 GLU H2 H N N 112 GLU HA H N N 113 GLU HB2 H N N 114 GLU HB3 H N N 115 GLU HG2 H N N 116 GLU HG3 H N N 117 GLU HE2 H N N 118 GLU HXT H N N 119 GLY N N N N 120 GLY CA C N N 121 GLY C C N N 122 GLY O O N N 123 GLY OXT O N N 124 GLY H H N N 125 GLY H2 H N N 126 GLY HA2 H N N 127 GLY HA3 H N N 128 GLY HXT H N N 129 HIS N N N N 130 HIS CA C N S 131 HIS C C N N 132 HIS O O N N 133 HIS CB C N N 134 HIS CG C Y N 135 HIS ND1 N Y N 136 HIS CD2 C Y N 137 HIS CE1 C Y N 138 HIS NE2 N Y N 139 HIS OXT O N N 140 HIS H H N N 141 HIS H2 H N N 142 HIS HA H N N 143 HIS HB2 H N N 144 HIS HB3 H N N 145 HIS HD1 H N N 146 HIS HD2 H N N 147 HIS HE1 H N N 148 HIS HE2 H N N 149 HIS HXT H N N 150 HOH O O N N 151 HOH H1 H N N 152 HOH H2 H N N 153 ILE N N N N 154 ILE CA C N S 155 ILE C C N N 156 ILE O O N N 157 ILE CB C N S 158 ILE CG1 C N N 159 ILE CG2 C N N 160 ILE CD1 C N N 161 ILE OXT O N N 162 ILE H H N N 163 ILE H2 H N N 164 ILE HA H N N 165 ILE HB H N N 166 ILE HG12 H N N 167 ILE HG13 H N N 168 ILE HG21 H N N 169 ILE HG22 H N N 170 ILE HG23 H N N 171 ILE HD11 H N N 172 ILE HD12 H N N 173 ILE HD13 H N N 174 ILE HXT H N N 175 LEU N N N N 176 LEU CA C N S 177 LEU C C N N 178 LEU O O N N 179 LEU CB C N N 180 LEU CG C N N 181 LEU CD1 C N N 182 LEU CD2 C N N 183 LEU OXT O N N 184 LEU H H N N 185 LEU H2 H N N 186 LEU HA H N N 187 LEU HB2 H N N 188 LEU HB3 H N N 189 LEU HG H N N 190 LEU HD11 H N N 191 LEU HD12 H N N 192 LEU HD13 H N N 193 LEU HD21 H N N 194 LEU HD22 H N N 195 LEU HD23 H N N 196 LEU HXT H N N 197 LYS N N N N 198 LYS CA C N S 199 LYS C C N N 200 LYS O O N N 201 LYS CB C N N 202 LYS CG C N N 203 LYS CD C N N 204 LYS CE C N N 205 LYS NZ N N N 206 LYS OXT O N N 207 LYS H H N N 208 LYS H2 H N N 209 LYS HA H N N 210 LYS HB2 H N N 211 LYS HB3 H N N 212 LYS HG2 H N N 213 LYS HG3 H N N 214 LYS HD2 H N N 215 LYS HD3 H N N 216 LYS HE2 H N N 217 LYS HE3 H N N 218 LYS HZ1 H N N 219 LYS HZ2 H N N 220 LYS HZ3 H N N 221 LYS HXT H N N 222 MET N N N N 223 MET CA C N S 224 MET C C N N 225 MET O O N N 226 MET CB C N N 227 MET CG C N N 228 MET SD S N N 229 MET CE C N N 230 MET OXT O N N 231 MET H H N N 232 MET H2 H N N 233 MET HA H N N 234 MET HB2 H N N 235 MET HB3 H N N 236 MET HG2 H N N 237 MET HG3 H N N 238 MET HE1 H N N 239 MET HE2 H N N 240 MET HE3 H N N 241 MET HXT H N N 242 NH2 N N N N 243 NH2 HN1 H N N 244 NH2 HN2 H N N 245 OBF N N N N 246 OBF CA C N S 247 OBF CB C N N 248 OBF CG C N N 249 OBF FG1 F N N 250 OBF FG2 F N N 251 OBF C C N N 252 OBF O O N N 253 OBF H H N N 254 OBF HA H N N 255 OBF H1B H N N 256 OBF H2B H N N 257 OBF HG H N N 258 OBF H2 H N N 259 OBF OXT O N N 260 OBF HXT H N N 261 SER N N N N 262 SER CA C N S 263 SER C C N N 264 SER O O N N 265 SER CB C N N 266 SER OG O N N 267 SER OXT O N N 268 SER H H N N 269 SER H2 H N N 270 SER HA H N N 271 SER HB2 H N N 272 SER HB3 H N N 273 SER HG H N N 274 SER HXT H N N 275 THR N N N N 276 THR CA C N S 277 THR C C N N 278 THR O O N N 279 THR CB C N R 280 THR OG1 O N N 281 THR CG2 C N N 282 THR OXT O N N 283 THR H H N N 284 THR H2 H N N 285 THR HA H N N 286 THR HB H N N 287 THR HG1 H N N 288 THR HG21 H N N 289 THR HG22 H N N 290 THR HG23 H N N 291 THR HXT H N N 292 TRP N N N N 293 TRP CA C N S 294 TRP C C N N 295 TRP O O N N 296 TRP CB C N N 297 TRP CG C Y N 298 TRP CD1 C Y N 299 TRP CD2 C Y N 300 TRP NE1 N Y N 301 TRP CE2 C Y N 302 TRP CE3 C Y N 303 TRP CZ2 C Y N 304 TRP CZ3 C Y N 305 TRP CH2 C Y N 306 TRP OXT O N N 307 TRP H H N N 308 TRP H2 H N N 309 TRP HA H N N 310 TRP HB2 H N N 311 TRP HB3 H N N 312 TRP HD1 H N N 313 TRP HE1 H N N 314 TRP HE3 H N N 315 TRP HZ2 H N N 316 TRP HZ3 H N N 317 TRP HH2 H N N 318 TRP HXT H N N 319 TYR N N N N 320 TYR CA C N S 321 TYR C C N N 322 TYR O O N N 323 TYR CB C N N 324 TYR CG C Y N 325 TYR CD1 C Y N 326 TYR CD2 C Y N 327 TYR CE1 C Y N 328 TYR CE2 C Y N 329 TYR CZ C Y N 330 TYR OH O N N 331 TYR OXT O N N 332 TYR H H N N 333 TYR H2 H N N 334 TYR HA H N N 335 TYR HB2 H N N 336 TYR HB3 H N N 337 TYR HD1 H N N 338 TYR HD2 H N N 339 TYR HE1 H N N 340 TYR HE2 H N N 341 TYR HH H N N 342 TYR HXT H N N 343 VAL N N N N 344 VAL CA C N S 345 VAL C C N N 346 VAL O O N N 347 VAL CB C N N 348 VAL CG1 C N N 349 VAL CG2 C N N 350 VAL OXT O N N 351 VAL H H N N 352 VAL H2 H N N 353 VAL HA H N N 354 VAL HB H N N 355 VAL HG11 H N N 356 VAL HG12 H N N 357 VAL HG13 H N N 358 VAL HG21 H N N 359 VAL HG22 H N N 360 VAL HG23 H N N 361 VAL HXT H N N 362 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ACE C O doub N N 1 ACE C CH3 sing N N 2 ACE C H sing N N 3 ACE CH3 H1 sing N N 4 ACE CH3 H2 sing N N 5 ACE CH3 H3 sing N N 6 ALA N CA sing N N 7 ALA N H sing N N 8 ALA N H2 sing N N 9 ALA CA C sing N N 10 ALA CA CB sing N N 11 ALA CA HA sing N N 12 ALA C O doub N N 13 ALA C OXT sing N N 14 ALA CB HB1 sing N N 15 ALA CB HB2 sing N N 16 ALA CB HB3 sing N N 17 ALA OXT HXT sing N N 18 ARG N CA sing N N 19 ARG N H sing N N 20 ARG N H2 sing N N 21 ARG CA C sing N N 22 ARG CA CB sing N N 23 ARG CA HA sing N N 24 ARG C O doub N N 25 ARG C OXT sing N N 26 ARG CB CG sing N N 27 ARG CB HB2 sing N N 28 ARG CB HB3 sing N N 29 ARG CG CD sing N N 30 ARG CG HG2 sing N N 31 ARG CG HG3 sing N N 32 ARG CD NE sing N N 33 ARG CD HD2 sing N N 34 ARG CD HD3 sing N N 35 ARG NE CZ sing N N 36 ARG NE HE sing N N 37 ARG CZ NH1 sing N N 38 ARG CZ NH2 doub N N 39 ARG NH1 HH11 sing N N 40 ARG NH1 HH12 sing N N 41 ARG NH2 HH21 sing N N 42 ARG NH2 HH22 sing N N 43 ARG OXT HXT sing N N 44 ASN N CA sing N N 45 ASN N H sing N N 46 ASN N H2 sing N N 47 ASN CA C sing N N 48 ASN CA CB sing N N 49 ASN CA HA sing N N 50 ASN C O doub N N 51 ASN C OXT sing N N 52 ASN CB CG sing N N 53 ASN CB HB2 sing N N 54 ASN CB HB3 sing N N 55 ASN CG OD1 doub N N 56 ASN CG ND2 sing N N 57 ASN ND2 HD21 sing N N 58 ASN ND2 HD22 sing N N 59 ASN OXT HXT sing N N 60 ASP N CA sing N N 61 ASP N H sing N N 62 ASP N H2 sing N N 63 ASP CA C sing N N 64 ASP CA CB sing N N 65 ASP CA HA sing N N 66 ASP C O doub N N 67 ASP C OXT sing N N 68 ASP CB CG sing N N 69 ASP CB HB2 sing N N 70 ASP CB HB3 sing N N 71 ASP CG OD1 doub N N 72 ASP CG OD2 sing N N 73 ASP OD2 HD2 sing N N 74 ASP OXT HXT sing N N 75 GLN N CA sing N N 76 GLN N H sing N N 77 GLN N H2 sing N N 78 GLN CA C sing N N 79 GLN CA CB sing N N 80 GLN CA HA sing N N 81 GLN C O doub N N 82 GLN C OXT sing N N 83 GLN CB CG sing N N 84 GLN CB HB2 sing N N 85 GLN CB HB3 sing N N 86 GLN CG CD sing N N 87 GLN CG HG2 sing N N 88 GLN CG HG3 sing N N 89 GLN CD OE1 doub N N 90 GLN CD NE2 sing N N 91 GLN NE2 HE21 sing N N 92 GLN NE2 HE22 sing N N 93 GLN OXT HXT sing N N 94 GLU N CA sing N N 95 GLU N H sing N N 96 GLU N H2 sing N N 97 GLU CA C sing N N 98 GLU CA CB sing N N 99 GLU CA HA sing N N 100 GLU C O doub N N 101 GLU C OXT sing N N 102 GLU CB CG sing N N 103 GLU CB HB2 sing N N 104 GLU CB HB3 sing N N 105 GLU CG CD sing N N 106 GLU CG HG2 sing N N 107 GLU CG HG3 sing N N 108 GLU CD OE1 doub N N 109 GLU CD OE2 sing N N 110 GLU OE2 HE2 sing N N 111 GLU OXT HXT sing N N 112 GLY N CA sing N N 113 GLY N H sing N N 114 GLY N H2 sing N N 115 GLY CA C sing N N 116 GLY CA HA2 sing N N 117 GLY CA HA3 sing N N 118 GLY C O doub N N 119 GLY C OXT sing N N 120 GLY OXT HXT sing N N 121 HIS N CA sing N N 122 HIS N H sing N N 123 HIS N H2 sing N N 124 HIS CA C sing N N 125 HIS CA CB sing N N 126 HIS CA HA sing N N 127 HIS C O doub N N 128 HIS C OXT sing N N 129 HIS CB CG sing N N 130 HIS CB HB2 sing N N 131 HIS CB HB3 sing N N 132 HIS CG ND1 sing Y N 133 HIS CG CD2 doub Y N 134 HIS ND1 CE1 doub Y N 135 HIS ND1 HD1 sing N N 136 HIS CD2 NE2 sing Y N 137 HIS CD2 HD2 sing N N 138 HIS CE1 NE2 sing Y N 139 HIS CE1 HE1 sing N N 140 HIS NE2 HE2 sing N N 141 HIS OXT HXT sing N N 142 HOH O H1 sing N N 143 HOH O H2 sing N N 144 ILE N CA sing N N 145 ILE N H sing N N 146 ILE N H2 sing N N 147 ILE CA C sing N N 148 ILE CA CB sing N N 149 ILE CA HA sing N N 150 ILE C O doub N N 151 ILE C OXT sing N N 152 ILE CB CG1 sing N N 153 ILE CB CG2 sing N N 154 ILE CB HB sing N N 155 ILE CG1 CD1 sing N N 156 ILE CG1 HG12 sing N N 157 ILE CG1 HG13 sing N N 158 ILE CG2 HG21 sing N N 159 ILE CG2 HG22 sing N N 160 ILE CG2 HG23 sing N N 161 ILE CD1 HD11 sing N N 162 ILE CD1 HD12 sing N N 163 ILE CD1 HD13 sing N N 164 ILE OXT HXT sing N N 165 LEU N CA sing N N 166 LEU N H sing N N 167 LEU N H2 sing N N 168 LEU CA C sing N N 169 LEU CA CB sing N N 170 LEU CA HA sing N N 171 LEU C O doub N N 172 LEU C OXT sing N N 173 LEU CB CG sing N N 174 LEU CB HB2 sing N N 175 LEU CB HB3 sing N N 176 LEU CG CD1 sing N N 177 LEU CG CD2 sing N N 178 LEU CG HG sing N N 179 LEU CD1 HD11 sing N N 180 LEU CD1 HD12 sing N N 181 LEU CD1 HD13 sing N N 182 LEU CD2 HD21 sing N N 183 LEU CD2 HD22 sing N N 184 LEU CD2 HD23 sing N N 185 LEU OXT HXT sing N N 186 LYS N CA sing N N 187 LYS N H sing N N 188 LYS N H2 sing N N 189 LYS CA C sing N N 190 LYS CA CB sing N N 191 LYS CA HA sing N N 192 LYS C O doub N N 193 LYS C OXT sing N N 194 LYS CB CG sing N N 195 LYS CB HB2 sing N N 196 LYS CB HB3 sing N N 197 LYS CG CD sing N N 198 LYS CG HG2 sing N N 199 LYS CG HG3 sing N N 200 LYS CD CE sing N N 201 LYS CD HD2 sing N N 202 LYS CD HD3 sing N N 203 LYS CE NZ sing N N 204 LYS CE HE2 sing N N 205 LYS CE HE3 sing N N 206 LYS NZ HZ1 sing N N 207 LYS NZ HZ2 sing N N 208 LYS NZ HZ3 sing N N 209 LYS OXT HXT sing N N 210 MET N CA sing N N 211 MET N H sing N N 212 MET N H2 sing N N 213 MET CA C sing N N 214 MET CA CB sing N N 215 MET CA HA sing N N 216 MET C O doub N N 217 MET C OXT sing N N 218 MET CB CG sing N N 219 MET CB HB2 sing N N 220 MET CB HB3 sing N N 221 MET CG SD sing N N 222 MET CG HG2 sing N N 223 MET CG HG3 sing N N 224 MET SD CE sing N N 225 MET CE HE1 sing N N 226 MET CE HE2 sing N N 227 MET CE HE3 sing N N 228 MET OXT HXT sing N N 229 NH2 N HN1 sing N N 230 NH2 N HN2 sing N N 231 OBF N H2 sing N N 232 OBF CA N sing N N 233 OBF CA C sing N N 234 OBF CA HA sing N N 235 OBF CB CA sing N N 236 OBF CG CB sing N N 237 OBF CG HG sing N N 238 OBF FG1 CG sing N N 239 OBF FG2 CG sing N N 240 OBF C OXT sing N N 241 OBF O C doub N N 242 OBF H N sing N N 243 OBF H1B CB sing N N 244 OBF H2B CB sing N N 245 OBF OXT HXT sing N N 246 SER N CA sing N N 247 SER N H sing N N 248 SER N H2 sing N N 249 SER CA C sing N N 250 SER CA CB sing N N 251 SER CA HA sing N N 252 SER C O doub N N 253 SER C OXT sing N N 254 SER CB OG sing N N 255 SER CB HB2 sing N N 256 SER CB HB3 sing N N 257 SER OG HG sing N N 258 SER OXT HXT sing N N 259 THR N CA sing N N 260 THR N H sing N N 261 THR N H2 sing N N 262 THR CA C sing N N 263 THR CA CB sing N N 264 THR CA HA sing N N 265 THR C O doub N N 266 THR C OXT sing N N 267 THR CB OG1 sing N N 268 THR CB CG2 sing N N 269 THR CB HB sing N N 270 THR OG1 HG1 sing N N 271 THR CG2 HG21 sing N N 272 THR CG2 HG22 sing N N 273 THR CG2 HG23 sing N N 274 THR OXT HXT sing N N 275 TRP N CA sing N N 276 TRP N H sing N N 277 TRP N H2 sing N N 278 TRP CA C sing N N 279 TRP CA CB sing N N 280 TRP CA HA sing N N 281 TRP C O doub N N 282 TRP C OXT sing N N 283 TRP CB CG sing N N 284 TRP CB HB2 sing N N 285 TRP CB HB3 sing N N 286 TRP CG CD1 doub Y N 287 TRP CG CD2 sing Y N 288 TRP CD1 NE1 sing Y N 289 TRP CD1 HD1 sing N N 290 TRP CD2 CE2 doub Y N 291 TRP CD2 CE3 sing Y N 292 TRP NE1 CE2 sing Y N 293 TRP NE1 HE1 sing N N 294 TRP CE2 CZ2 sing Y N 295 TRP CE3 CZ3 doub Y N 296 TRP CE3 HE3 sing N N 297 TRP CZ2 CH2 doub Y N 298 TRP CZ2 HZ2 sing N N 299 TRP CZ3 CH2 sing Y N 300 TRP CZ3 HZ3 sing N N 301 TRP CH2 HH2 sing N N 302 TRP OXT HXT sing N N 303 TYR N CA sing N N 304 TYR N H sing N N 305 TYR N H2 sing N N 306 TYR CA C sing N N 307 TYR CA CB sing N N 308 TYR CA HA sing N N 309 TYR C O doub N N 310 TYR C OXT sing N N 311 TYR CB CG sing N N 312 TYR CB HB2 sing N N 313 TYR CB HB3 sing N N 314 TYR CG CD1 doub Y N 315 TYR CG CD2 sing Y N 316 TYR CD1 CE1 sing Y N 317 TYR CD1 HD1 sing N N 318 TYR CD2 CE2 doub Y N 319 TYR CD2 HD2 sing N N 320 TYR CE1 CZ doub Y N 321 TYR CE1 HE1 sing N N 322 TYR CE2 CZ sing Y N 323 TYR CE2 HE2 sing N N 324 TYR CZ OH sing N N 325 TYR OH HH sing N N 326 TYR OXT HXT sing N N 327 VAL N CA sing N N 328 VAL N H sing N N 329 VAL N H2 sing N N 330 VAL CA C sing N N 331 VAL CA CB sing N N 332 VAL CA HA sing N N 333 VAL C O doub N N 334 VAL C OXT sing N N 335 VAL CB CG1 sing N N 336 VAL CB CG2 sing N N 337 VAL CB HB sing N N 338 VAL CG1 HG11 sing N N 339 VAL CG1 HG12 sing N N 340 VAL CG1 HG13 sing N N 341 VAL CG2 HG21 sing N N 342 VAL CG2 HG22 sing N N 343 VAL CG2 HG23 sing N N 344 VAL OXT HXT sing N N 345 # _pdbx_audit_support.funding_organization 'German Research Foundation (DFG)' _pdbx_audit_support.country Germany _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id OBF _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id OBF _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_entity_nonpoly.entity_id 3 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'light scattering' _pdbx_struct_assembly_auth_evidence.details ? #