data_6TXJ # _entry.id 6TXJ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6TXJ pdb_00006txj 10.2210/pdb6txj/pdb WWPDB D_1292105921 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-07-28 2 'Structure model' 1 1 2022-02-09 3 'Structure model' 1 2 2024-01-24 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 2 'Structure model' database_2 4 3 'Structure model' chem_comp_atom 5 3 'Structure model' chem_comp_bond 6 3 'Structure model' citation 7 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_abbrev' 2 2 'Structure model' '_citation.journal_id_CSD' 3 2 'Structure model' '_citation.journal_id_ISSN' 4 2 'Structure model' '_citation.journal_volume' 5 2 'Structure model' '_citation.page_first' 6 2 'Structure model' '_citation.page_last' 7 2 'Structure model' '_citation.pdbx_database_id_DOI' 8 2 'Structure model' '_citation.pdbx_database_id_PubMed' 9 2 'Structure model' '_citation.title' 10 2 'Structure model' '_citation.year' 11 2 'Structure model' '_database_2.pdbx_DOI' 12 2 'Structure model' '_database_2.pdbx_database_accession' 13 3 'Structure model' '_citation.country' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6TXJ _pdbx_database_status.recvd_initial_deposition_date 2020-01-14 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Wilk, P.' 1 0000-0001-7217-4163 'Grudnik, P.' 2 0000-0002-7157-0014 'Kumar, M.' 3 ? 'Heddle, J.' 4 0000-0003-0994-9928 'Chakraborti, S.' 5 0000-0002-7384-690X 'Biela, A.P.' 6 0000-0001-6733-242X # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Nanoscale _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2040-3372 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 13 _citation.language ? _citation.page_first 11932 _citation.page_last 11942 _citation.title 'A single residue can modulate nanocage assembly in salt dependent ferritin.' _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1039/d1nr01632f _citation.pdbx_database_id_PubMed 34195748 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kumar, M.' 1 ? primary 'Markiewicz-Mizera, J.' 2 ? primary 'Janna Olmos, J.D.' 3 ? primary 'Wilk, P.' 4 ? primary 'Grudnik, P.' 5 ? primary 'Biela, A.P.' 6 ? primary 'Jemiola-Rzeminska, M.' 7 ? primary 'Gorecki, A.' 8 ? primary 'Chakraborti, S.' 9 ? primary 'Heddle, J.G.' 10 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Ferritin 19415.867 8 1.16.3.2 'A42V, E65D' ? ? 2 non-polymer syn 'SULFATE ION' 96.063 35 ? ? ? ? 3 non-polymer syn GLYCEROL 92.094 7 ? ? ? ? 4 non-polymer syn 'FE (III) ION' 55.845 8 ? ? ? ? 5 non-polymer syn EICOSANE 282.547 4 ? ? ? ? 6 water nat water 18.015 146 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MMVISEKVRKALNDQLNREIYSSYLYLSMATYFDAEGFKGFVHWMKKQAQEELTHAMKFYEYIYDRGGRVELEAIEKPPS NWNGIKDAFEAALKHEEFVTQSIYNILELASEEKDHATVSFLKWFVDEQVEEEDQVREILDLLEKANGQMSVIFQLDRYL GQRE ; _entity_poly.pdbx_seq_one_letter_code_can ;MMVISEKVRKALNDQLNREIYSSYLYLSMATYFDAEGFKGFVHWMKKQAQEELTHAMKFYEYIYDRGGRVELEAIEKPPS NWNGIKDAFEAALKHEEFVTQSIYNILELASEEKDHATVSFLKWFVDEQVEEEDQVREILDLLEKANGQMSVIFQLDRYL GQRE ; _entity_poly.pdbx_strand_id A,B,C,D,E,F,G,H _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SULFATE ION' SO4 3 GLYCEROL GOL 4 'FE (III) ION' FE 5 EICOSANE LFA 6 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 MET n 1 3 VAL n 1 4 ILE n 1 5 SER n 1 6 GLU n 1 7 LYS n 1 8 VAL n 1 9 ARG n 1 10 LYS n 1 11 ALA n 1 12 LEU n 1 13 ASN n 1 14 ASP n 1 15 GLN n 1 16 LEU n 1 17 ASN n 1 18 ARG n 1 19 GLU n 1 20 ILE n 1 21 TYR n 1 22 SER n 1 23 SER n 1 24 TYR n 1 25 LEU n 1 26 TYR n 1 27 LEU n 1 28 SER n 1 29 MET n 1 30 ALA n 1 31 THR n 1 32 TYR n 1 33 PHE n 1 34 ASP n 1 35 ALA n 1 36 GLU n 1 37 GLY n 1 38 PHE n 1 39 LYS n 1 40 GLY n 1 41 PHE n 1 42 VAL n 1 43 HIS n 1 44 TRP n 1 45 MET n 1 46 LYS n 1 47 LYS n 1 48 GLN n 1 49 ALA n 1 50 GLN n 1 51 GLU n 1 52 GLU n 1 53 LEU n 1 54 THR n 1 55 HIS n 1 56 ALA n 1 57 MET n 1 58 LYS n 1 59 PHE n 1 60 TYR n 1 61 GLU n 1 62 TYR n 1 63 ILE n 1 64 TYR n 1 65 ASP n 1 66 ARG n 1 67 GLY n 1 68 GLY n 1 69 ARG n 1 70 VAL n 1 71 GLU n 1 72 LEU n 1 73 GLU n 1 74 ALA n 1 75 ILE n 1 76 GLU n 1 77 LYS n 1 78 PRO n 1 79 PRO n 1 80 SER n 1 81 ASN n 1 82 TRP n 1 83 ASN n 1 84 GLY n 1 85 ILE n 1 86 LYS n 1 87 ASP n 1 88 ALA n 1 89 PHE n 1 90 GLU n 1 91 ALA n 1 92 ALA n 1 93 LEU n 1 94 LYS n 1 95 HIS n 1 96 GLU n 1 97 GLU n 1 98 PHE n 1 99 VAL n 1 100 THR n 1 101 GLN n 1 102 SER n 1 103 ILE n 1 104 TYR n 1 105 ASN n 1 106 ILE n 1 107 LEU n 1 108 GLU n 1 109 LEU n 1 110 ALA n 1 111 SER n 1 112 GLU n 1 113 GLU n 1 114 LYS n 1 115 ASP n 1 116 HIS n 1 117 ALA n 1 118 THR n 1 119 VAL n 1 120 SER n 1 121 PHE n 1 122 LEU n 1 123 LYS n 1 124 TRP n 1 125 PHE n 1 126 VAL n 1 127 ASP n 1 128 GLU n 1 129 GLN n 1 130 VAL n 1 131 GLU n 1 132 GLU n 1 133 GLU n 1 134 ASP n 1 135 GLN n 1 136 VAL n 1 137 ARG n 1 138 GLU n 1 139 ILE n 1 140 LEU n 1 141 ASP n 1 142 LEU n 1 143 LEU n 1 144 GLU n 1 145 LYS n 1 146 ALA n 1 147 ASN n 1 148 GLY n 1 149 GLN n 1 150 MET n 1 151 SER n 1 152 VAL n 1 153 ILE n 1 154 PHE n 1 155 GLN n 1 156 LEU n 1 157 ASP n 1 158 ARG n 1 159 TYR n 1 160 LEU n 1 161 GLY n 1 162 GLN n 1 163 ARG n 1 164 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 164 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene TM_1128 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC 43589 / MSB8 / DSM 3109 / JCM 10099' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 243274 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 FE non-polymer . 'FE (III) ION' ? 'Fe 3' 55.845 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LFA non-polymer . EICOSANE 'LIPID FRAGMENT' 'C20 H42' 282.547 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 MET 2 2 2 MET MET A . n A 1 3 VAL 3 3 3 VAL VAL A . n A 1 4 ILE 4 4 4 ILE ILE A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 LYS 7 7 7 LYS LYS A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 ARG 9 9 9 ARG ARG A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 ASN 13 13 13 ASN ASN A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 GLN 15 15 15 GLN GLN A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 ASN 17 17 17 ASN ASN A . n A 1 18 ARG 18 18 18 ARG ARG A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 TYR 21 21 21 TYR TYR A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 SER 23 23 23 SER SER A . n A 1 24 TYR 24 24 24 TYR TYR A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 TYR 26 26 26 TYR TYR A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 MET 29 29 29 MET MET A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 THR 31 31 31 THR THR A . n A 1 32 TYR 32 32 32 TYR TYR A . n A 1 33 PHE 33 33 33 PHE PHE A . n A 1 34 ASP 34 34 34 ASP ASP A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 PHE 38 38 38 PHE PHE A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 PHE 41 41 41 PHE PHE A . n A 1 42 VAL 42 42 42 VAL VAL A . n A 1 43 HIS 43 43 43 HIS HIS A . n A 1 44 TRP 44 44 44 TRP TRP A . n A 1 45 MET 45 45 45 MET MET A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 GLN 48 48 48 GLN GLN A . n A 1 49 ALA 49 49 49 ALA ALA A . n A 1 50 GLN 50 50 50 GLN GLN A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 THR 54 54 54 THR THR A . n A 1 55 HIS 55 55 55 HIS HIS A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 MET 57 57 57 MET MET A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 PHE 59 59 59 PHE PHE A . n A 1 60 TYR 60 60 60 TYR TYR A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 TYR 62 62 62 TYR TYR A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 TYR 64 64 64 TYR TYR A . n A 1 65 ASP 65 65 65 ASP ASP A . n A 1 66 ARG 66 66 66 ARG ARG A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 ARG 69 69 69 ARG ARG A . n A 1 70 VAL 70 70 70 VAL VAL A . n A 1 71 GLU 71 71 71 GLU GLU A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 GLU 73 73 73 GLU GLU A . n A 1 74 ALA 74 74 74 ALA ALA A . n A 1 75 ILE 75 75 75 ILE ILE A . n A 1 76 GLU 76 76 76 GLU GLU A . n A 1 77 LYS 77 77 77 LYS LYS A . n A 1 78 PRO 78 78 78 PRO PRO A . n A 1 79 PRO 79 79 79 PRO PRO A . n A 1 80 SER 80 80 80 SER SER A . n A 1 81 ASN 81 81 81 ASN ASN A . n A 1 82 TRP 82 82 82 TRP TRP A . n A 1 83 ASN 83 83 83 ASN ASN A . n A 1 84 GLY 84 84 84 GLY GLY A . n A 1 85 ILE 85 85 85 ILE ILE A . n A 1 86 LYS 86 86 86 LYS LYS A . n A 1 87 ASP 87 87 87 ASP ASP A . n A 1 88 ALA 88 88 88 ALA ALA A . n A 1 89 PHE 89 89 89 PHE PHE A . n A 1 90 GLU 90 90 90 GLU GLU A . n A 1 91 ALA 91 91 91 ALA ALA A . n A 1 92 ALA 92 92 92 ALA ALA A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 LYS 94 94 94 LYS LYS A . n A 1 95 HIS 95 95 95 HIS HIS A . n A 1 96 GLU 96 96 96 GLU GLU A . n A 1 97 GLU 97 97 97 GLU GLU A . n A 1 98 PHE 98 98 98 PHE PHE A . n A 1 99 VAL 99 99 99 VAL VAL A . n A 1 100 THR 100 100 100 THR THR A . n A 1 101 GLN 101 101 101 GLN GLN A . n A 1 102 SER 102 102 102 SER SER A . n A 1 103 ILE 103 103 103 ILE ILE A . n A 1 104 TYR 104 104 104 TYR TYR A . n A 1 105 ASN 105 105 105 ASN ASN A . n A 1 106 ILE 106 106 106 ILE ILE A . n A 1 107 LEU 107 107 107 LEU LEU A . n A 1 108 GLU 108 108 108 GLU GLU A . n A 1 109 LEU 109 109 109 LEU LEU A . n A 1 110 ALA 110 110 110 ALA ALA A . n A 1 111 SER 111 111 111 SER SER A . n A 1 112 GLU 112 112 112 GLU GLU A . n A 1 113 GLU 113 113 113 GLU GLU A . n A 1 114 LYS 114 114 114 LYS LYS A . n A 1 115 ASP 115 115 115 ASP ASP A . n A 1 116 HIS 116 116 116 HIS HIS A . n A 1 117 ALA 117 117 117 ALA ALA A . n A 1 118 THR 118 118 118 THR THR A . n A 1 119 VAL 119 119 119 VAL VAL A . n A 1 120 SER 120 120 120 SER SER A . n A 1 121 PHE 121 121 121 PHE PHE A . n A 1 122 LEU 122 122 122 LEU LEU A . n A 1 123 LYS 123 123 123 LYS LYS A . n A 1 124 TRP 124 124 124 TRP TRP A . n A 1 125 PHE 125 125 125 PHE PHE A . n A 1 126 VAL 126 126 126 VAL VAL A . n A 1 127 ASP 127 127 127 ASP ASP A . n A 1 128 GLU 128 128 128 GLU GLU A . n A 1 129 GLN 129 129 129 GLN GLN A . n A 1 130 VAL 130 130 130 VAL VAL A . n A 1 131 GLU 131 131 131 GLU GLU A . n A 1 132 GLU 132 132 132 GLU GLU A . n A 1 133 GLU 133 133 133 GLU GLU A . n A 1 134 ASP 134 134 134 ASP ASP A . n A 1 135 GLN 135 135 135 GLN GLN A . n A 1 136 VAL 136 136 136 VAL VAL A . n A 1 137 ARG 137 137 137 ARG ARG A . n A 1 138 GLU 138 138 138 GLU GLU A . n A 1 139 ILE 139 139 139 ILE ILE A . n A 1 140 LEU 140 140 140 LEU LEU A . n A 1 141 ASP 141 141 141 ASP ASP A . n A 1 142 LEU 142 142 142 LEU LEU A . n A 1 143 LEU 143 143 143 LEU LEU A . n A 1 144 GLU 144 144 144 GLU GLU A . n A 1 145 LYS 145 145 145 LYS LYS A . n A 1 146 ALA 146 146 146 ALA ALA A . n A 1 147 ASN 147 147 147 ASN ASN A . n A 1 148 GLY 148 148 148 GLY GLY A . n A 1 149 GLN 149 149 149 GLN GLN A . n A 1 150 MET 150 150 150 MET MET A . n A 1 151 SER 151 151 151 SER SER A . n A 1 152 VAL 152 152 152 VAL VAL A . n A 1 153 ILE 153 153 153 ILE ILE A . n A 1 154 PHE 154 154 154 PHE PHE A . n A 1 155 GLN 155 155 155 GLN GLN A . n A 1 156 LEU 156 156 156 LEU LEU A . n A 1 157 ASP 157 157 157 ASP ASP A . n A 1 158 ARG 158 158 158 ARG ARG A . n A 1 159 TYR 159 159 159 TYR TYR A . n A 1 160 LEU 160 160 160 LEU LEU A . n A 1 161 GLY 161 161 161 GLY GLY A . n A 1 162 GLN 162 162 162 GLN GLN A . n A 1 163 ARG 163 163 163 ARG ARG A . n A 1 164 GLU 164 164 164 GLU GLU A . n B 1 1 MET 1 1 1 MET MET B . n B 1 2 MET 2 2 2 MET MET B . n B 1 3 VAL 3 3 3 VAL VAL B . n B 1 4 ILE 4 4 4 ILE ILE B . n B 1 5 SER 5 5 5 SER SER B . n B 1 6 GLU 6 6 6 GLU GLU B . n B 1 7 LYS 7 7 7 LYS LYS B . n B 1 8 VAL 8 8 8 VAL VAL B . n B 1 9 ARG 9 9 9 ARG ARG B . n B 1 10 LYS 10 10 10 LYS LYS B . n B 1 11 ALA 11 11 11 ALA ALA B . n B 1 12 LEU 12 12 12 LEU LEU B . n B 1 13 ASN 13 13 13 ASN ASN B . n B 1 14 ASP 14 14 14 ASP ASP B . n B 1 15 GLN 15 15 15 GLN GLN B . n B 1 16 LEU 16 16 16 LEU LEU B . n B 1 17 ASN 17 17 17 ASN ASN B . n B 1 18 ARG 18 18 18 ARG ARG B . n B 1 19 GLU 19 19 19 GLU GLU B . n B 1 20 ILE 20 20 20 ILE ILE B . n B 1 21 TYR 21 21 21 TYR TYR B . n B 1 22 SER 22 22 22 SER SER B . n B 1 23 SER 23 23 23 SER SER B . n B 1 24 TYR 24 24 24 TYR TYR B . n B 1 25 LEU 25 25 25 LEU LEU B . n B 1 26 TYR 26 26 26 TYR TYR B . n B 1 27 LEU 27 27 27 LEU LEU B . n B 1 28 SER 28 28 28 SER SER B . n B 1 29 MET 29 29 29 MET MET B . n B 1 30 ALA 30 30 30 ALA ALA B . n B 1 31 THR 31 31 31 THR THR B . n B 1 32 TYR 32 32 32 TYR TYR B . n B 1 33 PHE 33 33 33 PHE PHE B . n B 1 34 ASP 34 34 34 ASP ASP B . n B 1 35 ALA 35 35 35 ALA ALA B . n B 1 36 GLU 36 36 36 GLU GLU B . n B 1 37 GLY 37 37 37 GLY GLY B . n B 1 38 PHE 38 38 38 PHE PHE B . n B 1 39 LYS 39 39 39 LYS LYS B . n B 1 40 GLY 40 40 40 GLY GLY B . n B 1 41 PHE 41 41 41 PHE PHE B . n B 1 42 VAL 42 42 42 VAL VAL B . n B 1 43 HIS 43 43 43 HIS HIS B . n B 1 44 TRP 44 44 44 TRP TRP B . n B 1 45 MET 45 45 45 MET MET B . n B 1 46 LYS 46 46 46 LYS LYS B . n B 1 47 LYS 47 47 47 LYS LYS B . n B 1 48 GLN 48 48 48 GLN GLN B . n B 1 49 ALA 49 49 49 ALA ALA B . n B 1 50 GLN 50 50 50 GLN GLN B . n B 1 51 GLU 51 51 51 GLU GLU B . n B 1 52 GLU 52 52 52 GLU GLU B . n B 1 53 LEU 53 53 53 LEU LEU B . n B 1 54 THR 54 54 54 THR THR B . n B 1 55 HIS 55 55 55 HIS HIS B . n B 1 56 ALA 56 56 56 ALA ALA B . n B 1 57 MET 57 57 57 MET MET B . n B 1 58 LYS 58 58 58 LYS LYS B . n B 1 59 PHE 59 59 59 PHE PHE B . n B 1 60 TYR 60 60 60 TYR TYR B . n B 1 61 GLU 61 61 61 GLU GLU B . n B 1 62 TYR 62 62 62 TYR TYR B . n B 1 63 ILE 63 63 63 ILE ILE B . n B 1 64 TYR 64 64 64 TYR TYR B . n B 1 65 ASP 65 65 65 ASP ASP B . n B 1 66 ARG 66 66 66 ARG ARG B . n B 1 67 GLY 67 67 67 GLY GLY B . n B 1 68 GLY 68 68 68 GLY GLY B . n B 1 69 ARG 69 69 69 ARG ARG B . n B 1 70 VAL 70 70 70 VAL VAL B . n B 1 71 GLU 71 71 71 GLU GLU B . n B 1 72 LEU 72 72 72 LEU LEU B . n B 1 73 GLU 73 73 73 GLU GLU B . n B 1 74 ALA 74 74 74 ALA ALA B . n B 1 75 ILE 75 75 75 ILE ILE B . n B 1 76 GLU 76 76 76 GLU GLU B . n B 1 77 LYS 77 77 77 LYS LYS B . n B 1 78 PRO 78 78 78 PRO PRO B . n B 1 79 PRO 79 79 79 PRO PRO B . n B 1 80 SER 80 80 80 SER SER B . n B 1 81 ASN 81 81 81 ASN ASN B . n B 1 82 TRP 82 82 82 TRP TRP B . n B 1 83 ASN 83 83 83 ASN ASN B . n B 1 84 GLY 84 84 84 GLY GLY B . n B 1 85 ILE 85 85 85 ILE ILE B . n B 1 86 LYS 86 86 86 LYS LYS B . n B 1 87 ASP 87 87 87 ASP ASP B . n B 1 88 ALA 88 88 88 ALA ALA B . n B 1 89 PHE 89 89 89 PHE PHE B . n B 1 90 GLU 90 90 90 GLU GLU B . n B 1 91 ALA 91 91 91 ALA ALA B . n B 1 92 ALA 92 92 92 ALA ALA B . n B 1 93 LEU 93 93 93 LEU LEU B . n B 1 94 LYS 94 94 94 LYS LYS B . n B 1 95 HIS 95 95 95 HIS HIS B . n B 1 96 GLU 96 96 96 GLU GLU B . n B 1 97 GLU 97 97 97 GLU GLU B . n B 1 98 PHE 98 98 98 PHE PHE B . n B 1 99 VAL 99 99 99 VAL VAL B . n B 1 100 THR 100 100 100 THR THR B . n B 1 101 GLN 101 101 101 GLN GLN B . n B 1 102 SER 102 102 102 SER SER B . n B 1 103 ILE 103 103 103 ILE ILE B . n B 1 104 TYR 104 104 104 TYR TYR B . n B 1 105 ASN 105 105 105 ASN ASN B . n B 1 106 ILE 106 106 106 ILE ILE B . n B 1 107 LEU 107 107 107 LEU LEU B . n B 1 108 GLU 108 108 108 GLU GLU B . n B 1 109 LEU 109 109 109 LEU LEU B . n B 1 110 ALA 110 110 110 ALA ALA B . n B 1 111 SER 111 111 111 SER SER B . n B 1 112 GLU 112 112 112 GLU GLU B . n B 1 113 GLU 113 113 113 GLU GLU B . n B 1 114 LYS 114 114 114 LYS LYS B . n B 1 115 ASP 115 115 115 ASP ASP B . n B 1 116 HIS 116 116 116 HIS HIS B . n B 1 117 ALA 117 117 117 ALA ALA B . n B 1 118 THR 118 118 118 THR THR B . n B 1 119 VAL 119 119 119 VAL VAL B . n B 1 120 SER 120 120 120 SER SER B . n B 1 121 PHE 121 121 121 PHE PHE B . n B 1 122 LEU 122 122 122 LEU LEU B . n B 1 123 LYS 123 123 123 LYS LYS B . n B 1 124 TRP 124 124 124 TRP TRP B . n B 1 125 PHE 125 125 125 PHE PHE B . n B 1 126 VAL 126 126 126 VAL VAL B . n B 1 127 ASP 127 127 127 ASP ASP B . n B 1 128 GLU 128 128 128 GLU GLU B . n B 1 129 GLN 129 129 129 GLN GLN B . n B 1 130 VAL 130 130 130 VAL VAL B . n B 1 131 GLU 131 131 131 GLU GLU B . n B 1 132 GLU 132 132 132 GLU GLU B . n B 1 133 GLU 133 133 133 GLU GLU B . n B 1 134 ASP 134 134 134 ASP ASP B . n B 1 135 GLN 135 135 135 GLN GLN B . n B 1 136 VAL 136 136 136 VAL VAL B . n B 1 137 ARG 137 137 137 ARG ARG B . n B 1 138 GLU 138 138 138 GLU GLU B . n B 1 139 ILE 139 139 139 ILE ILE B . n B 1 140 LEU 140 140 140 LEU LEU B . n B 1 141 ASP 141 141 141 ASP ASP B . n B 1 142 LEU 142 142 142 LEU LEU B . n B 1 143 LEU 143 143 143 LEU LEU B . n B 1 144 GLU 144 144 144 GLU GLU B . n B 1 145 LYS 145 145 145 LYS LYS B . n B 1 146 ALA 146 146 146 ALA ALA B . n B 1 147 ASN 147 147 147 ASN ASN B . n B 1 148 GLY 148 148 148 GLY GLY B . n B 1 149 GLN 149 149 149 GLN GLN B . n B 1 150 MET 150 150 150 MET MET B . n B 1 151 SER 151 151 151 SER SER B . n B 1 152 VAL 152 152 152 VAL VAL B . n B 1 153 ILE 153 153 153 ILE ILE B . n B 1 154 PHE 154 154 154 PHE PHE B . n B 1 155 GLN 155 155 155 GLN GLN B . n B 1 156 LEU 156 156 156 LEU LEU B . n B 1 157 ASP 157 157 157 ASP ASP B . n B 1 158 ARG 158 158 158 ARG ARG B . n B 1 159 TYR 159 159 159 TYR TYR B . n B 1 160 LEU 160 160 160 LEU LEU B . n B 1 161 GLY 161 161 161 GLY GLY B . n B 1 162 GLN 162 162 162 GLN GLN B . n B 1 163 ARG 163 163 163 ARG ARG B . n B 1 164 GLU 164 164 164 GLU GLU B . n C 1 1 MET 1 1 1 MET MET C . n C 1 2 MET 2 2 2 MET MET C . n C 1 3 VAL 3 3 3 VAL VAL C . n C 1 4 ILE 4 4 4 ILE ILE C . n C 1 5 SER 5 5 5 SER SER C . n C 1 6 GLU 6 6 6 GLU GLU C . n C 1 7 LYS 7 7 7 LYS LYS C . n C 1 8 VAL 8 8 8 VAL VAL C . n C 1 9 ARG 9 9 9 ARG ARG C . n C 1 10 LYS 10 10 10 LYS LYS C . n C 1 11 ALA 11 11 11 ALA ALA C . n C 1 12 LEU 12 12 12 LEU LEU C . n C 1 13 ASN 13 13 13 ASN ASN C . n C 1 14 ASP 14 14 14 ASP ASP C . n C 1 15 GLN 15 15 15 GLN GLN C . n C 1 16 LEU 16 16 16 LEU LEU C . n C 1 17 ASN 17 17 17 ASN ASN C . n C 1 18 ARG 18 18 18 ARG ARG C . n C 1 19 GLU 19 19 19 GLU GLU C . n C 1 20 ILE 20 20 20 ILE ILE C . n C 1 21 TYR 21 21 21 TYR TYR C . n C 1 22 SER 22 22 22 SER SER C . n C 1 23 SER 23 23 23 SER SER C . n C 1 24 TYR 24 24 24 TYR TYR C . n C 1 25 LEU 25 25 25 LEU LEU C . n C 1 26 TYR 26 26 26 TYR TYR C . n C 1 27 LEU 27 27 27 LEU LEU C . n C 1 28 SER 28 28 28 SER SER C . n C 1 29 MET 29 29 29 MET MET C . n C 1 30 ALA 30 30 30 ALA ALA C . n C 1 31 THR 31 31 31 THR THR C . n C 1 32 TYR 32 32 32 TYR TYR C . n C 1 33 PHE 33 33 33 PHE PHE C . n C 1 34 ASP 34 34 34 ASP ASP C . n C 1 35 ALA 35 35 35 ALA ALA C . n C 1 36 GLU 36 36 36 GLU GLU C . n C 1 37 GLY 37 37 37 GLY GLY C . n C 1 38 PHE 38 38 38 PHE PHE C . n C 1 39 LYS 39 39 39 LYS LYS C . n C 1 40 GLY 40 40 40 GLY GLY C . n C 1 41 PHE 41 41 41 PHE PHE C . n C 1 42 VAL 42 42 42 VAL VAL C . n C 1 43 HIS 43 43 43 HIS HIS C . n C 1 44 TRP 44 44 44 TRP TRP C . n C 1 45 MET 45 45 45 MET MET C . n C 1 46 LYS 46 46 46 LYS LYS C . n C 1 47 LYS 47 47 47 LYS LYS C . n C 1 48 GLN 48 48 48 GLN GLN C . n C 1 49 ALA 49 49 49 ALA ALA C . n C 1 50 GLN 50 50 50 GLN GLN C . n C 1 51 GLU 51 51 51 GLU GLU C . n C 1 52 GLU 52 52 52 GLU GLU C . n C 1 53 LEU 53 53 53 LEU LEU C . n C 1 54 THR 54 54 54 THR THR C . n C 1 55 HIS 55 55 55 HIS HIS C . n C 1 56 ALA 56 56 56 ALA ALA C . n C 1 57 MET 57 57 57 MET MET C . n C 1 58 LYS 58 58 58 LYS LYS C . n C 1 59 PHE 59 59 59 PHE PHE C . n C 1 60 TYR 60 60 60 TYR TYR C . n C 1 61 GLU 61 61 61 GLU GLU C . n C 1 62 TYR 62 62 62 TYR TYR C . n C 1 63 ILE 63 63 63 ILE ILE C . n C 1 64 TYR 64 64 64 TYR TYR C . n C 1 65 ASP 65 65 65 ASP ASP C . n C 1 66 ARG 66 66 66 ARG ARG C . n C 1 67 GLY 67 67 67 GLY GLY C . n C 1 68 GLY 68 68 68 GLY GLY C . n C 1 69 ARG 69 69 69 ARG ARG C . n C 1 70 VAL 70 70 70 VAL VAL C . n C 1 71 GLU 71 71 71 GLU GLU C . n C 1 72 LEU 72 72 72 LEU LEU C . n C 1 73 GLU 73 73 73 GLU GLU C . n C 1 74 ALA 74 74 74 ALA ALA C . n C 1 75 ILE 75 75 75 ILE ILE C . n C 1 76 GLU 76 76 76 GLU GLU C . n C 1 77 LYS 77 77 77 LYS LYS C . n C 1 78 PRO 78 78 78 PRO PRO C . n C 1 79 PRO 79 79 79 PRO PRO C . n C 1 80 SER 80 80 80 SER SER C . n C 1 81 ASN 81 81 81 ASN ASN C . n C 1 82 TRP 82 82 82 TRP TRP C . n C 1 83 ASN 83 83 83 ASN ASN C . n C 1 84 GLY 84 84 84 GLY GLY C . n C 1 85 ILE 85 85 85 ILE ILE C . n C 1 86 LYS 86 86 86 LYS LYS C . n C 1 87 ASP 87 87 87 ASP ASP C . n C 1 88 ALA 88 88 88 ALA ALA C . n C 1 89 PHE 89 89 89 PHE PHE C . n C 1 90 GLU 90 90 90 GLU GLU C . n C 1 91 ALA 91 91 91 ALA ALA C . n C 1 92 ALA 92 92 92 ALA ALA C . n C 1 93 LEU 93 93 93 LEU LEU C . n C 1 94 LYS 94 94 94 LYS LYS C . n C 1 95 HIS 95 95 95 HIS HIS C . n C 1 96 GLU 96 96 96 GLU GLU C . n C 1 97 GLU 97 97 97 GLU GLU C . n C 1 98 PHE 98 98 98 PHE PHE C . n C 1 99 VAL 99 99 99 VAL VAL C . n C 1 100 THR 100 100 100 THR THR C . n C 1 101 GLN 101 101 101 GLN GLN C . n C 1 102 SER 102 102 102 SER SER C . n C 1 103 ILE 103 103 103 ILE ILE C . n C 1 104 TYR 104 104 104 TYR TYR C . n C 1 105 ASN 105 105 105 ASN ASN C . n C 1 106 ILE 106 106 106 ILE ILE C . n C 1 107 LEU 107 107 107 LEU LEU C . n C 1 108 GLU 108 108 108 GLU GLU C . n C 1 109 LEU 109 109 109 LEU LEU C . n C 1 110 ALA 110 110 110 ALA ALA C . n C 1 111 SER 111 111 111 SER SER C . n C 1 112 GLU 112 112 112 GLU GLU C . n C 1 113 GLU 113 113 113 GLU GLU C . n C 1 114 LYS 114 114 114 LYS LYS C . n C 1 115 ASP 115 115 115 ASP ASP C . n C 1 116 HIS 116 116 116 HIS HIS C . n C 1 117 ALA 117 117 117 ALA ALA C . n C 1 118 THR 118 118 118 THR THR C . n C 1 119 VAL 119 119 119 VAL VAL C . n C 1 120 SER 120 120 120 SER SER C . n C 1 121 PHE 121 121 121 PHE PHE C . n C 1 122 LEU 122 122 122 LEU LEU C . n C 1 123 LYS 123 123 123 LYS LYS C . n C 1 124 TRP 124 124 124 TRP TRP C . n C 1 125 PHE 125 125 125 PHE PHE C . n C 1 126 VAL 126 126 126 VAL VAL C . n C 1 127 ASP 127 127 127 ASP ASP C . n C 1 128 GLU 128 128 128 GLU GLU C . n C 1 129 GLN 129 129 129 GLN GLN C . n C 1 130 VAL 130 130 130 VAL VAL C . n C 1 131 GLU 131 131 131 GLU GLU C . n C 1 132 GLU 132 132 132 GLU GLU C . n C 1 133 GLU 133 133 133 GLU GLU C . n C 1 134 ASP 134 134 134 ASP ASP C . n C 1 135 GLN 135 135 135 GLN GLN C . n C 1 136 VAL 136 136 136 VAL VAL C . n C 1 137 ARG 137 137 137 ARG ARG C . n C 1 138 GLU 138 138 138 GLU GLU C . n C 1 139 ILE 139 139 139 ILE ILE C . n C 1 140 LEU 140 140 140 LEU LEU C . n C 1 141 ASP 141 141 141 ASP ASP C . n C 1 142 LEU 142 142 142 LEU LEU C . n C 1 143 LEU 143 143 143 LEU LEU C . n C 1 144 GLU 144 144 144 GLU GLU C . n C 1 145 LYS 145 145 145 LYS LYS C . n C 1 146 ALA 146 146 146 ALA ALA C . n C 1 147 ASN 147 147 147 ASN ASN C . n C 1 148 GLY 148 148 148 GLY GLY C . n C 1 149 GLN 149 149 149 GLN GLN C . n C 1 150 MET 150 150 150 MET MET C . n C 1 151 SER 151 151 151 SER SER C . n C 1 152 VAL 152 152 152 VAL VAL C . n C 1 153 ILE 153 153 153 ILE ILE C . n C 1 154 PHE 154 154 154 PHE PHE C . n C 1 155 GLN 155 155 155 GLN GLN C . n C 1 156 LEU 156 156 156 LEU LEU C . n C 1 157 ASP 157 157 157 ASP ASP C . n C 1 158 ARG 158 158 158 ARG ARG C . n C 1 159 TYR 159 159 159 TYR TYR C . n C 1 160 LEU 160 160 160 LEU LEU C . n C 1 161 GLY 161 161 161 GLY GLY C . n C 1 162 GLN 162 162 162 GLN GLN C . n C 1 163 ARG 163 163 163 ARG ARG C . n C 1 164 GLU 164 164 164 GLU GLU C . n D 1 1 MET 1 1 ? ? ? D . n D 1 2 MET 2 2 2 MET MET D . n D 1 3 VAL 3 3 3 VAL VAL D . n D 1 4 ILE 4 4 4 ILE ILE D . n D 1 5 SER 5 5 5 SER SER D . n D 1 6 GLU 6 6 6 GLU GLU D . n D 1 7 LYS 7 7 7 LYS LYS D . n D 1 8 VAL 8 8 8 VAL VAL D . n D 1 9 ARG 9 9 9 ARG ARG D . n D 1 10 LYS 10 10 10 LYS LYS D . n D 1 11 ALA 11 11 11 ALA ALA D . n D 1 12 LEU 12 12 12 LEU LEU D . n D 1 13 ASN 13 13 13 ASN ASN D . n D 1 14 ASP 14 14 14 ASP ASP D . n D 1 15 GLN 15 15 15 GLN GLN D . n D 1 16 LEU 16 16 16 LEU LEU D . n D 1 17 ASN 17 17 17 ASN ASN D . n D 1 18 ARG 18 18 18 ARG ARG D . n D 1 19 GLU 19 19 19 GLU GLU D . n D 1 20 ILE 20 20 20 ILE ILE D . n D 1 21 TYR 21 21 21 TYR TYR D . n D 1 22 SER 22 22 22 SER SER D . n D 1 23 SER 23 23 23 SER SER D . n D 1 24 TYR 24 24 24 TYR TYR D . n D 1 25 LEU 25 25 25 LEU LEU D . n D 1 26 TYR 26 26 26 TYR TYR D . n D 1 27 LEU 27 27 27 LEU LEU D . n D 1 28 SER 28 28 28 SER SER D . n D 1 29 MET 29 29 29 MET MET D . n D 1 30 ALA 30 30 30 ALA ALA D . n D 1 31 THR 31 31 31 THR THR D . n D 1 32 TYR 32 32 32 TYR TYR D . n D 1 33 PHE 33 33 33 PHE PHE D . n D 1 34 ASP 34 34 34 ASP ASP D . n D 1 35 ALA 35 35 35 ALA ALA D . n D 1 36 GLU 36 36 36 GLU GLU D . n D 1 37 GLY 37 37 37 GLY GLY D . n D 1 38 PHE 38 38 38 PHE PHE D . n D 1 39 LYS 39 39 39 LYS LYS D . n D 1 40 GLY 40 40 40 GLY GLY D . n D 1 41 PHE 41 41 41 PHE PHE D . n D 1 42 VAL 42 42 42 VAL VAL D . n D 1 43 HIS 43 43 43 HIS HIS D . n D 1 44 TRP 44 44 44 TRP TRP D . n D 1 45 MET 45 45 45 MET MET D . n D 1 46 LYS 46 46 46 LYS LYS D . n D 1 47 LYS 47 47 47 LYS LYS D . n D 1 48 GLN 48 48 48 GLN GLN D . n D 1 49 ALA 49 49 49 ALA ALA D . n D 1 50 GLN 50 50 50 GLN GLN D . n D 1 51 GLU 51 51 51 GLU GLU D . n D 1 52 GLU 52 52 52 GLU GLU D . n D 1 53 LEU 53 53 53 LEU LEU D . n D 1 54 THR 54 54 54 THR THR D . n D 1 55 HIS 55 55 55 HIS HIS D . n D 1 56 ALA 56 56 56 ALA ALA D . n D 1 57 MET 57 57 57 MET MET D . n D 1 58 LYS 58 58 58 LYS LYS D . n D 1 59 PHE 59 59 59 PHE PHE D . n D 1 60 TYR 60 60 60 TYR TYR D . n D 1 61 GLU 61 61 61 GLU GLU D . n D 1 62 TYR 62 62 62 TYR TYR D . n D 1 63 ILE 63 63 63 ILE ILE D . n D 1 64 TYR 64 64 64 TYR TYR D . n D 1 65 ASP 65 65 65 ASP ASP D . n D 1 66 ARG 66 66 66 ARG ARG D . n D 1 67 GLY 67 67 67 GLY GLY D . n D 1 68 GLY 68 68 68 GLY GLY D . n D 1 69 ARG 69 69 69 ARG ARG D . n D 1 70 VAL 70 70 70 VAL VAL D . n D 1 71 GLU 71 71 71 GLU GLU D . n D 1 72 LEU 72 72 72 LEU LEU D . n D 1 73 GLU 73 73 73 GLU GLU D . n D 1 74 ALA 74 74 74 ALA ALA D . n D 1 75 ILE 75 75 75 ILE ILE D . n D 1 76 GLU 76 76 76 GLU GLU D . n D 1 77 LYS 77 77 77 LYS LYS D . n D 1 78 PRO 78 78 78 PRO PRO D . n D 1 79 PRO 79 79 79 PRO PRO D . n D 1 80 SER 80 80 80 SER SER D . n D 1 81 ASN 81 81 81 ASN ASN D . n D 1 82 TRP 82 82 82 TRP TRP D . n D 1 83 ASN 83 83 83 ASN ASN D . n D 1 84 GLY 84 84 84 GLY GLY D . n D 1 85 ILE 85 85 85 ILE ILE D . n D 1 86 LYS 86 86 86 LYS LYS D . n D 1 87 ASP 87 87 87 ASP ASP D . n D 1 88 ALA 88 88 88 ALA ALA D . n D 1 89 PHE 89 89 89 PHE PHE D . n D 1 90 GLU 90 90 90 GLU GLU D . n D 1 91 ALA 91 91 91 ALA ALA D . n D 1 92 ALA 92 92 92 ALA ALA D . n D 1 93 LEU 93 93 93 LEU LEU D . n D 1 94 LYS 94 94 94 LYS LYS D . n D 1 95 HIS 95 95 95 HIS HIS D . n D 1 96 GLU 96 96 96 GLU GLU D . n D 1 97 GLU 97 97 97 GLU GLU D . n D 1 98 PHE 98 98 98 PHE PHE D . n D 1 99 VAL 99 99 99 VAL VAL D . n D 1 100 THR 100 100 100 THR THR D . n D 1 101 GLN 101 101 101 GLN GLN D . n D 1 102 SER 102 102 102 SER SER D . n D 1 103 ILE 103 103 103 ILE ILE D . n D 1 104 TYR 104 104 104 TYR TYR D . n D 1 105 ASN 105 105 105 ASN ASN D . n D 1 106 ILE 106 106 106 ILE ILE D . n D 1 107 LEU 107 107 107 LEU LEU D . n D 1 108 GLU 108 108 108 GLU GLU D . n D 1 109 LEU 109 109 109 LEU LEU D . n D 1 110 ALA 110 110 110 ALA ALA D . n D 1 111 SER 111 111 111 SER SER D . n D 1 112 GLU 112 112 112 GLU GLU D . n D 1 113 GLU 113 113 113 GLU GLU D . n D 1 114 LYS 114 114 114 LYS LYS D . n D 1 115 ASP 115 115 115 ASP ASP D . n D 1 116 HIS 116 116 116 HIS HIS D . n D 1 117 ALA 117 117 117 ALA ALA D . n D 1 118 THR 118 118 118 THR THR D . n D 1 119 VAL 119 119 119 VAL VAL D . n D 1 120 SER 120 120 120 SER SER D . n D 1 121 PHE 121 121 121 PHE PHE D . n D 1 122 LEU 122 122 122 LEU LEU D . n D 1 123 LYS 123 123 123 LYS LYS D . n D 1 124 TRP 124 124 124 TRP TRP D . n D 1 125 PHE 125 125 125 PHE PHE D . n D 1 126 VAL 126 126 126 VAL VAL D . n D 1 127 ASP 127 127 127 ASP ASP D . n D 1 128 GLU 128 128 128 GLU GLU D . n D 1 129 GLN 129 129 129 GLN GLN D . n D 1 130 VAL 130 130 130 VAL VAL D . n D 1 131 GLU 131 131 131 GLU GLU D . n D 1 132 GLU 132 132 132 GLU GLU D . n D 1 133 GLU 133 133 133 GLU GLU D . n D 1 134 ASP 134 134 134 ASP ASP D . n D 1 135 GLN 135 135 135 GLN GLN D . n D 1 136 VAL 136 136 136 VAL VAL D . n D 1 137 ARG 137 137 137 ARG ARG D . n D 1 138 GLU 138 138 138 GLU GLU D . n D 1 139 ILE 139 139 139 ILE ILE D . n D 1 140 LEU 140 140 140 LEU LEU D . n D 1 141 ASP 141 141 141 ASP ASP D . n D 1 142 LEU 142 142 142 LEU LEU D . n D 1 143 LEU 143 143 143 LEU LEU D . n D 1 144 GLU 144 144 144 GLU GLU D . n D 1 145 LYS 145 145 145 LYS LYS D . n D 1 146 ALA 146 146 146 ALA ALA D . n D 1 147 ASN 147 147 147 ASN ASN D . n D 1 148 GLY 148 148 148 GLY GLY D . n D 1 149 GLN 149 149 149 GLN GLN D . n D 1 150 MET 150 150 150 MET MET D . n D 1 151 SER 151 151 151 SER SER D . n D 1 152 VAL 152 152 152 VAL VAL D . n D 1 153 ILE 153 153 153 ILE ILE D . n D 1 154 PHE 154 154 154 PHE PHE D . n D 1 155 GLN 155 155 155 GLN GLN D . n D 1 156 LEU 156 156 156 LEU LEU D . n D 1 157 ASP 157 157 157 ASP ASP D . n D 1 158 ARG 158 158 158 ARG ARG D . n D 1 159 TYR 159 159 159 TYR TYR D . n D 1 160 LEU 160 160 160 LEU LEU D . n D 1 161 GLY 161 161 161 GLY GLY D . n D 1 162 GLN 162 162 162 GLN GLN D . n D 1 163 ARG 163 163 163 ARG ARG D . n D 1 164 GLU 164 164 164 GLU GLU D . n E 1 1 MET 1 1 1 MET MET E . n E 1 2 MET 2 2 2 MET MET E . n E 1 3 VAL 3 3 3 VAL VAL E . n E 1 4 ILE 4 4 4 ILE ILE E . n E 1 5 SER 5 5 5 SER SER E . n E 1 6 GLU 6 6 6 GLU GLU E . n E 1 7 LYS 7 7 7 LYS LYS E . n E 1 8 VAL 8 8 8 VAL VAL E . n E 1 9 ARG 9 9 9 ARG ARG E . n E 1 10 LYS 10 10 10 LYS LYS E . n E 1 11 ALA 11 11 11 ALA ALA E . n E 1 12 LEU 12 12 12 LEU LEU E . n E 1 13 ASN 13 13 13 ASN ASN E . n E 1 14 ASP 14 14 14 ASP ASP E . n E 1 15 GLN 15 15 15 GLN GLN E . n E 1 16 LEU 16 16 16 LEU LEU E . n E 1 17 ASN 17 17 17 ASN ASN E . n E 1 18 ARG 18 18 18 ARG ARG E . n E 1 19 GLU 19 19 19 GLU GLU E . n E 1 20 ILE 20 20 20 ILE ILE E . n E 1 21 TYR 21 21 21 TYR TYR E . n E 1 22 SER 22 22 22 SER SER E . n E 1 23 SER 23 23 23 SER SER E . n E 1 24 TYR 24 24 24 TYR TYR E . n E 1 25 LEU 25 25 25 LEU LEU E . n E 1 26 TYR 26 26 26 TYR TYR E . n E 1 27 LEU 27 27 27 LEU LEU E . n E 1 28 SER 28 28 28 SER SER E . n E 1 29 MET 29 29 29 MET MET E . n E 1 30 ALA 30 30 30 ALA ALA E . n E 1 31 THR 31 31 31 THR THR E . n E 1 32 TYR 32 32 32 TYR TYR E . n E 1 33 PHE 33 33 33 PHE PHE E . n E 1 34 ASP 34 34 34 ASP ASP E . n E 1 35 ALA 35 35 35 ALA ALA E . n E 1 36 GLU 36 36 36 GLU GLU E . n E 1 37 GLY 37 37 37 GLY GLY E . n E 1 38 PHE 38 38 38 PHE PHE E . n E 1 39 LYS 39 39 39 LYS LYS E . n E 1 40 GLY 40 40 40 GLY GLY E . n E 1 41 PHE 41 41 41 PHE PHE E . n E 1 42 VAL 42 42 42 VAL VAL E . n E 1 43 HIS 43 43 43 HIS HIS E . n E 1 44 TRP 44 44 44 TRP TRP E . n E 1 45 MET 45 45 45 MET MET E . n E 1 46 LYS 46 46 46 LYS LYS E . n E 1 47 LYS 47 47 47 LYS LYS E . n E 1 48 GLN 48 48 48 GLN GLN E . n E 1 49 ALA 49 49 49 ALA ALA E . n E 1 50 GLN 50 50 50 GLN GLN E . n E 1 51 GLU 51 51 51 GLU GLU E . n E 1 52 GLU 52 52 52 GLU GLU E . n E 1 53 LEU 53 53 53 LEU LEU E . n E 1 54 THR 54 54 54 THR THR E . n E 1 55 HIS 55 55 55 HIS HIS E . n E 1 56 ALA 56 56 56 ALA ALA E . n E 1 57 MET 57 57 57 MET MET E . n E 1 58 LYS 58 58 58 LYS LYS E . n E 1 59 PHE 59 59 59 PHE PHE E . n E 1 60 TYR 60 60 60 TYR TYR E . n E 1 61 GLU 61 61 61 GLU GLU E . n E 1 62 TYR 62 62 62 TYR TYR E . n E 1 63 ILE 63 63 63 ILE ILE E . n E 1 64 TYR 64 64 64 TYR TYR E . n E 1 65 ASP 65 65 65 ASP ASP E . n E 1 66 ARG 66 66 66 ARG ARG E . n E 1 67 GLY 67 67 67 GLY GLY E . n E 1 68 GLY 68 68 68 GLY GLY E . n E 1 69 ARG 69 69 69 ARG ARG E . n E 1 70 VAL 70 70 70 VAL VAL E . n E 1 71 GLU 71 71 71 GLU GLU E . n E 1 72 LEU 72 72 72 LEU LEU E . n E 1 73 GLU 73 73 73 GLU GLU E . n E 1 74 ALA 74 74 74 ALA ALA E . n E 1 75 ILE 75 75 75 ILE ILE E . n E 1 76 GLU 76 76 76 GLU GLU E . n E 1 77 LYS 77 77 77 LYS LYS E . n E 1 78 PRO 78 78 78 PRO PRO E . n E 1 79 PRO 79 79 79 PRO PRO E . n E 1 80 SER 80 80 80 SER SER E . n E 1 81 ASN 81 81 81 ASN ASN E . n E 1 82 TRP 82 82 82 TRP TRP E . n E 1 83 ASN 83 83 83 ASN ASN E . n E 1 84 GLY 84 84 84 GLY GLY E . n E 1 85 ILE 85 85 85 ILE ILE E . n E 1 86 LYS 86 86 86 LYS LYS E . n E 1 87 ASP 87 87 87 ASP ASP E . n E 1 88 ALA 88 88 88 ALA ALA E . n E 1 89 PHE 89 89 89 PHE PHE E . n E 1 90 GLU 90 90 90 GLU GLU E . n E 1 91 ALA 91 91 91 ALA ALA E . n E 1 92 ALA 92 92 92 ALA ALA E . n E 1 93 LEU 93 93 93 LEU LEU E . n E 1 94 LYS 94 94 94 LYS LYS E . n E 1 95 HIS 95 95 95 HIS HIS E . n E 1 96 GLU 96 96 96 GLU GLU E . n E 1 97 GLU 97 97 97 GLU GLU E . n E 1 98 PHE 98 98 98 PHE PHE E . n E 1 99 VAL 99 99 99 VAL VAL E . n E 1 100 THR 100 100 100 THR THR E . n E 1 101 GLN 101 101 101 GLN GLN E . n E 1 102 SER 102 102 102 SER SER E . n E 1 103 ILE 103 103 103 ILE ILE E . n E 1 104 TYR 104 104 104 TYR TYR E . n E 1 105 ASN 105 105 105 ASN ASN E . n E 1 106 ILE 106 106 106 ILE ILE E . n E 1 107 LEU 107 107 107 LEU LEU E . n E 1 108 GLU 108 108 108 GLU GLU E . n E 1 109 LEU 109 109 109 LEU LEU E . n E 1 110 ALA 110 110 110 ALA ALA E . n E 1 111 SER 111 111 111 SER SER E . n E 1 112 GLU 112 112 112 GLU GLU E . n E 1 113 GLU 113 113 113 GLU GLU E . n E 1 114 LYS 114 114 114 LYS LYS E . n E 1 115 ASP 115 115 115 ASP ASP E . n E 1 116 HIS 116 116 116 HIS HIS E . n E 1 117 ALA 117 117 117 ALA ALA E . n E 1 118 THR 118 118 118 THR THR E . n E 1 119 VAL 119 119 119 VAL VAL E . n E 1 120 SER 120 120 120 SER SER E . n E 1 121 PHE 121 121 121 PHE PHE E . n E 1 122 LEU 122 122 122 LEU LEU E . n E 1 123 LYS 123 123 123 LYS LYS E . n E 1 124 TRP 124 124 124 TRP TRP E . n E 1 125 PHE 125 125 125 PHE PHE E . n E 1 126 VAL 126 126 126 VAL VAL E . n E 1 127 ASP 127 127 127 ASP ASP E . n E 1 128 GLU 128 128 128 GLU GLU E . n E 1 129 GLN 129 129 129 GLN GLN E . n E 1 130 VAL 130 130 130 VAL VAL E . n E 1 131 GLU 131 131 131 GLU GLU E . n E 1 132 GLU 132 132 132 GLU GLU E . n E 1 133 GLU 133 133 133 GLU GLU E . n E 1 134 ASP 134 134 134 ASP ASP E . n E 1 135 GLN 135 135 135 GLN GLN E . n E 1 136 VAL 136 136 136 VAL VAL E . n E 1 137 ARG 137 137 137 ARG ARG E . n E 1 138 GLU 138 138 138 GLU GLU E . n E 1 139 ILE 139 139 139 ILE ILE E . n E 1 140 LEU 140 140 140 LEU LEU E . n E 1 141 ASP 141 141 141 ASP ASP E . n E 1 142 LEU 142 142 142 LEU LEU E . n E 1 143 LEU 143 143 143 LEU LEU E . n E 1 144 GLU 144 144 144 GLU GLU E . n E 1 145 LYS 145 145 145 LYS LYS E . n E 1 146 ALA 146 146 146 ALA ALA E . n E 1 147 ASN 147 147 147 ASN ASN E . n E 1 148 GLY 148 148 148 GLY GLY E . n E 1 149 GLN 149 149 149 GLN GLN E . n E 1 150 MET 150 150 150 MET MET E . n E 1 151 SER 151 151 151 SER SER E . n E 1 152 VAL 152 152 152 VAL VAL E . n E 1 153 ILE 153 153 153 ILE ILE E . n E 1 154 PHE 154 154 154 PHE PHE E . n E 1 155 GLN 155 155 155 GLN GLN E . n E 1 156 LEU 156 156 156 LEU LEU E . n E 1 157 ASP 157 157 157 ASP ASP E . n E 1 158 ARG 158 158 158 ARG ARG E . n E 1 159 TYR 159 159 159 TYR TYR E . n E 1 160 LEU 160 160 160 LEU LEU E . n E 1 161 GLY 161 161 161 GLY GLY E . n E 1 162 GLN 162 162 162 GLN GLN E . n E 1 163 ARG 163 163 163 ARG ARG E . n E 1 164 GLU 164 164 164 GLU GLU E . n F 1 1 MET 1 1 1 MET MET F . n F 1 2 MET 2 2 2 MET MET F . n F 1 3 VAL 3 3 3 VAL VAL F . n F 1 4 ILE 4 4 4 ILE ILE F . n F 1 5 SER 5 5 5 SER SER F . n F 1 6 GLU 6 6 6 GLU GLU F . n F 1 7 LYS 7 7 7 LYS LYS F . n F 1 8 VAL 8 8 8 VAL VAL F . n F 1 9 ARG 9 9 9 ARG ARG F . n F 1 10 LYS 10 10 10 LYS LYS F . n F 1 11 ALA 11 11 11 ALA ALA F . n F 1 12 LEU 12 12 12 LEU LEU F . n F 1 13 ASN 13 13 13 ASN ASN F . n F 1 14 ASP 14 14 14 ASP ASP F . n F 1 15 GLN 15 15 15 GLN GLN F . n F 1 16 LEU 16 16 16 LEU LEU F . n F 1 17 ASN 17 17 17 ASN ASN F . n F 1 18 ARG 18 18 18 ARG ARG F . n F 1 19 GLU 19 19 19 GLU GLU F . n F 1 20 ILE 20 20 20 ILE ILE F . n F 1 21 TYR 21 21 21 TYR TYR F . n F 1 22 SER 22 22 22 SER SER F . n F 1 23 SER 23 23 23 SER SER F . n F 1 24 TYR 24 24 24 TYR TYR F . n F 1 25 LEU 25 25 25 LEU LEU F . n F 1 26 TYR 26 26 26 TYR TYR F . n F 1 27 LEU 27 27 27 LEU LEU F . n F 1 28 SER 28 28 28 SER SER F . n F 1 29 MET 29 29 29 MET MET F . n F 1 30 ALA 30 30 30 ALA ALA F . n F 1 31 THR 31 31 31 THR THR F . n F 1 32 TYR 32 32 32 TYR TYR F . n F 1 33 PHE 33 33 33 PHE PHE F . n F 1 34 ASP 34 34 34 ASP ASP F . n F 1 35 ALA 35 35 35 ALA ALA F . n F 1 36 GLU 36 36 36 GLU GLU F . n F 1 37 GLY 37 37 37 GLY GLY F . n F 1 38 PHE 38 38 38 PHE PHE F . n F 1 39 LYS 39 39 39 LYS LYS F . n F 1 40 GLY 40 40 40 GLY GLY F . n F 1 41 PHE 41 41 41 PHE PHE F . n F 1 42 VAL 42 42 42 VAL VAL F . n F 1 43 HIS 43 43 43 HIS HIS F . n F 1 44 TRP 44 44 44 TRP TRP F . n F 1 45 MET 45 45 45 MET MET F . n F 1 46 LYS 46 46 46 LYS LYS F . n F 1 47 LYS 47 47 47 LYS LYS F . n F 1 48 GLN 48 48 48 GLN GLN F . n F 1 49 ALA 49 49 49 ALA ALA F . n F 1 50 GLN 50 50 50 GLN GLN F . n F 1 51 GLU 51 51 51 GLU GLU F . n F 1 52 GLU 52 52 52 GLU GLU F . n F 1 53 LEU 53 53 53 LEU LEU F . n F 1 54 THR 54 54 54 THR THR F . n F 1 55 HIS 55 55 55 HIS HIS F . n F 1 56 ALA 56 56 56 ALA ALA F . n F 1 57 MET 57 57 57 MET MET F . n F 1 58 LYS 58 58 58 LYS LYS F . n F 1 59 PHE 59 59 59 PHE PHE F . n F 1 60 TYR 60 60 60 TYR TYR F . n F 1 61 GLU 61 61 61 GLU GLU F . n F 1 62 TYR 62 62 62 TYR TYR F . n F 1 63 ILE 63 63 63 ILE ILE F . n F 1 64 TYR 64 64 64 TYR TYR F . n F 1 65 ASP 65 65 65 ASP ASP F . n F 1 66 ARG 66 66 66 ARG ARG F . n F 1 67 GLY 67 67 67 GLY GLY F . n F 1 68 GLY 68 68 68 GLY GLY F . n F 1 69 ARG 69 69 69 ARG ARG F . n F 1 70 VAL 70 70 70 VAL VAL F . n F 1 71 GLU 71 71 71 GLU GLU F . n F 1 72 LEU 72 72 72 LEU LEU F . n F 1 73 GLU 73 73 73 GLU GLU F . n F 1 74 ALA 74 74 74 ALA ALA F . n F 1 75 ILE 75 75 75 ILE ILE F . n F 1 76 GLU 76 76 76 GLU GLU F . n F 1 77 LYS 77 77 77 LYS LYS F . n F 1 78 PRO 78 78 78 PRO PRO F . n F 1 79 PRO 79 79 79 PRO PRO F . n F 1 80 SER 80 80 80 SER SER F . n F 1 81 ASN 81 81 81 ASN ASN F . n F 1 82 TRP 82 82 82 TRP TRP F . n F 1 83 ASN 83 83 83 ASN ASN F . n F 1 84 GLY 84 84 84 GLY GLY F . n F 1 85 ILE 85 85 85 ILE ILE F . n F 1 86 LYS 86 86 86 LYS LYS F . n F 1 87 ASP 87 87 87 ASP ASP F . n F 1 88 ALA 88 88 88 ALA ALA F . n F 1 89 PHE 89 89 89 PHE PHE F . n F 1 90 GLU 90 90 90 GLU GLU F . n F 1 91 ALA 91 91 91 ALA ALA F . n F 1 92 ALA 92 92 92 ALA ALA F . n F 1 93 LEU 93 93 93 LEU LEU F . n F 1 94 LYS 94 94 94 LYS LYS F . n F 1 95 HIS 95 95 95 HIS HIS F . n F 1 96 GLU 96 96 96 GLU GLU F . n F 1 97 GLU 97 97 97 GLU GLU F . n F 1 98 PHE 98 98 98 PHE PHE F . n F 1 99 VAL 99 99 99 VAL VAL F . n F 1 100 THR 100 100 100 THR THR F . n F 1 101 GLN 101 101 101 GLN GLN F . n F 1 102 SER 102 102 102 SER SER F . n F 1 103 ILE 103 103 103 ILE ILE F . n F 1 104 TYR 104 104 104 TYR TYR F . n F 1 105 ASN 105 105 105 ASN ASN F . n F 1 106 ILE 106 106 106 ILE ILE F . n F 1 107 LEU 107 107 107 LEU LEU F . n F 1 108 GLU 108 108 108 GLU GLU F . n F 1 109 LEU 109 109 109 LEU LEU F . n F 1 110 ALA 110 110 110 ALA ALA F . n F 1 111 SER 111 111 111 SER SER F . n F 1 112 GLU 112 112 112 GLU GLU F . n F 1 113 GLU 113 113 113 GLU GLU F . n F 1 114 LYS 114 114 114 LYS LYS F . n F 1 115 ASP 115 115 115 ASP ASP F . n F 1 116 HIS 116 116 116 HIS HIS F . n F 1 117 ALA 117 117 117 ALA ALA F . n F 1 118 THR 118 118 118 THR THR F . n F 1 119 VAL 119 119 119 VAL VAL F . n F 1 120 SER 120 120 120 SER SER F . n F 1 121 PHE 121 121 121 PHE PHE F . n F 1 122 LEU 122 122 122 LEU LEU F . n F 1 123 LYS 123 123 123 LYS LYS F . n F 1 124 TRP 124 124 124 TRP TRP F . n F 1 125 PHE 125 125 125 PHE PHE F . n F 1 126 VAL 126 126 126 VAL VAL F . n F 1 127 ASP 127 127 127 ASP ASP F . n F 1 128 GLU 128 128 128 GLU GLU F . n F 1 129 GLN 129 129 129 GLN GLN F . n F 1 130 VAL 130 130 130 VAL VAL F . n F 1 131 GLU 131 131 131 GLU GLU F . n F 1 132 GLU 132 132 132 GLU GLU F . n F 1 133 GLU 133 133 133 GLU GLU F . n F 1 134 ASP 134 134 134 ASP ASP F . n F 1 135 GLN 135 135 135 GLN GLN F . n F 1 136 VAL 136 136 136 VAL VAL F . n F 1 137 ARG 137 137 137 ARG ARG F . n F 1 138 GLU 138 138 138 GLU GLU F . n F 1 139 ILE 139 139 139 ILE ILE F . n F 1 140 LEU 140 140 140 LEU LEU F . n F 1 141 ASP 141 141 141 ASP ASP F . n F 1 142 LEU 142 142 142 LEU LEU F . n F 1 143 LEU 143 143 143 LEU LEU F . n F 1 144 GLU 144 144 144 GLU GLU F . n F 1 145 LYS 145 145 145 LYS LYS F . n F 1 146 ALA 146 146 146 ALA ALA F . n F 1 147 ASN 147 147 147 ASN ASN F . n F 1 148 GLY 148 148 148 GLY GLY F . n F 1 149 GLN 149 149 149 GLN GLN F . n F 1 150 MET 150 150 150 MET MET F . n F 1 151 SER 151 151 151 SER SER F . n F 1 152 VAL 152 152 152 VAL VAL F . n F 1 153 ILE 153 153 153 ILE ILE F . n F 1 154 PHE 154 154 154 PHE PHE F . n F 1 155 GLN 155 155 155 GLN GLN F . n F 1 156 LEU 156 156 156 LEU LEU F . n F 1 157 ASP 157 157 157 ASP ASP F . n F 1 158 ARG 158 158 158 ARG ARG F . n F 1 159 TYR 159 159 159 TYR TYR F . n F 1 160 LEU 160 160 160 LEU LEU F . n F 1 161 GLY 161 161 161 GLY GLY F . n F 1 162 GLN 162 162 162 GLN GLN F . n F 1 163 ARG 163 163 163 ARG ARG F . n F 1 164 GLU 164 164 164 GLU GLU F . n G 1 1 MET 1 1 ? ? ? G . n G 1 2 MET 2 2 2 MET MET G . n G 1 3 VAL 3 3 3 VAL VAL G . n G 1 4 ILE 4 4 4 ILE ILE G . n G 1 5 SER 5 5 5 SER SER G . n G 1 6 GLU 6 6 6 GLU GLU G . n G 1 7 LYS 7 7 7 LYS LYS G . n G 1 8 VAL 8 8 8 VAL VAL G . n G 1 9 ARG 9 9 9 ARG ARG G . n G 1 10 LYS 10 10 10 LYS LYS G . n G 1 11 ALA 11 11 11 ALA ALA G . n G 1 12 LEU 12 12 12 LEU LEU G . n G 1 13 ASN 13 13 13 ASN ASN G . n G 1 14 ASP 14 14 14 ASP ASP G . n G 1 15 GLN 15 15 15 GLN GLN G . n G 1 16 LEU 16 16 16 LEU LEU G . n G 1 17 ASN 17 17 17 ASN ASN G . n G 1 18 ARG 18 18 18 ARG ARG G . n G 1 19 GLU 19 19 19 GLU GLU G . n G 1 20 ILE 20 20 20 ILE ILE G . n G 1 21 TYR 21 21 21 TYR TYR G . n G 1 22 SER 22 22 22 SER SER G . n G 1 23 SER 23 23 23 SER SER G . n G 1 24 TYR 24 24 24 TYR TYR G . n G 1 25 LEU 25 25 25 LEU LEU G . n G 1 26 TYR 26 26 26 TYR TYR G . n G 1 27 LEU 27 27 27 LEU LEU G . n G 1 28 SER 28 28 28 SER SER G . n G 1 29 MET 29 29 29 MET MET G . n G 1 30 ALA 30 30 30 ALA ALA G . n G 1 31 THR 31 31 31 THR THR G . n G 1 32 TYR 32 32 32 TYR TYR G . n G 1 33 PHE 33 33 33 PHE PHE G . n G 1 34 ASP 34 34 34 ASP ASP G . n G 1 35 ALA 35 35 35 ALA ALA G . n G 1 36 GLU 36 36 36 GLU GLU G . n G 1 37 GLY 37 37 37 GLY GLY G . n G 1 38 PHE 38 38 38 PHE PHE G . n G 1 39 LYS 39 39 39 LYS LYS G . n G 1 40 GLY 40 40 40 GLY GLY G . n G 1 41 PHE 41 41 41 PHE PHE G . n G 1 42 VAL 42 42 42 VAL VAL G . n G 1 43 HIS 43 43 43 HIS HIS G . n G 1 44 TRP 44 44 44 TRP TRP G . n G 1 45 MET 45 45 45 MET MET G . n G 1 46 LYS 46 46 46 LYS LYS G . n G 1 47 LYS 47 47 47 LYS LYS G . n G 1 48 GLN 48 48 48 GLN GLN G . n G 1 49 ALA 49 49 49 ALA ALA G . n G 1 50 GLN 50 50 50 GLN GLN G . n G 1 51 GLU 51 51 51 GLU GLU G . n G 1 52 GLU 52 52 52 GLU GLU G . n G 1 53 LEU 53 53 53 LEU LEU G . n G 1 54 THR 54 54 54 THR THR G . n G 1 55 HIS 55 55 55 HIS HIS G . n G 1 56 ALA 56 56 56 ALA ALA G . n G 1 57 MET 57 57 57 MET MET G . n G 1 58 LYS 58 58 58 LYS LYS G . n G 1 59 PHE 59 59 59 PHE PHE G . n G 1 60 TYR 60 60 60 TYR TYR G . n G 1 61 GLU 61 61 61 GLU GLU G . n G 1 62 TYR 62 62 62 TYR TYR G . n G 1 63 ILE 63 63 63 ILE ILE G . n G 1 64 TYR 64 64 64 TYR TYR G . n G 1 65 ASP 65 65 65 ASP ASP G . n G 1 66 ARG 66 66 66 ARG ARG G . n G 1 67 GLY 67 67 67 GLY GLY G . n G 1 68 GLY 68 68 68 GLY GLY G . n G 1 69 ARG 69 69 69 ARG ARG G . n G 1 70 VAL 70 70 70 VAL VAL G . n G 1 71 GLU 71 71 71 GLU GLU G . n G 1 72 LEU 72 72 72 LEU LEU G . n G 1 73 GLU 73 73 73 GLU GLU G . n G 1 74 ALA 74 74 74 ALA ALA G . n G 1 75 ILE 75 75 75 ILE ILE G . n G 1 76 GLU 76 76 76 GLU GLU G . n G 1 77 LYS 77 77 77 LYS LYS G . n G 1 78 PRO 78 78 78 PRO PRO G . n G 1 79 PRO 79 79 79 PRO PRO G . n G 1 80 SER 80 80 80 SER SER G . n G 1 81 ASN 81 81 81 ASN ASN G . n G 1 82 TRP 82 82 82 TRP TRP G . n G 1 83 ASN 83 83 83 ASN ASN G . n G 1 84 GLY 84 84 84 GLY GLY G . n G 1 85 ILE 85 85 85 ILE ILE G . n G 1 86 LYS 86 86 86 LYS LYS G . n G 1 87 ASP 87 87 87 ASP ASP G . n G 1 88 ALA 88 88 88 ALA ALA G . n G 1 89 PHE 89 89 89 PHE PHE G . n G 1 90 GLU 90 90 90 GLU GLU G . n G 1 91 ALA 91 91 91 ALA ALA G . n G 1 92 ALA 92 92 92 ALA ALA G . n G 1 93 LEU 93 93 93 LEU LEU G . n G 1 94 LYS 94 94 94 LYS LYS G . n G 1 95 HIS 95 95 95 HIS HIS G . n G 1 96 GLU 96 96 96 GLU GLU G . n G 1 97 GLU 97 97 97 GLU GLU G . n G 1 98 PHE 98 98 98 PHE PHE G . n G 1 99 VAL 99 99 99 VAL VAL G . n G 1 100 THR 100 100 100 THR THR G . n G 1 101 GLN 101 101 101 GLN GLN G . n G 1 102 SER 102 102 102 SER SER G . n G 1 103 ILE 103 103 103 ILE ILE G . n G 1 104 TYR 104 104 104 TYR TYR G . n G 1 105 ASN 105 105 105 ASN ASN G . n G 1 106 ILE 106 106 106 ILE ILE G . n G 1 107 LEU 107 107 107 LEU LEU G . n G 1 108 GLU 108 108 108 GLU GLU G . n G 1 109 LEU 109 109 109 LEU LEU G . n G 1 110 ALA 110 110 110 ALA ALA G . n G 1 111 SER 111 111 111 SER SER G . n G 1 112 GLU 112 112 112 GLU GLU G . n G 1 113 GLU 113 113 113 GLU GLU G . n G 1 114 LYS 114 114 114 LYS LYS G . n G 1 115 ASP 115 115 115 ASP ASP G . n G 1 116 HIS 116 116 116 HIS HIS G . n G 1 117 ALA 117 117 117 ALA ALA G . n G 1 118 THR 118 118 118 THR THR G . n G 1 119 VAL 119 119 119 VAL VAL G . n G 1 120 SER 120 120 120 SER SER G . n G 1 121 PHE 121 121 121 PHE PHE G . n G 1 122 LEU 122 122 122 LEU LEU G . n G 1 123 LYS 123 123 123 LYS LYS G . n G 1 124 TRP 124 124 124 TRP TRP G . n G 1 125 PHE 125 125 125 PHE PHE G . n G 1 126 VAL 126 126 126 VAL VAL G . n G 1 127 ASP 127 127 127 ASP ASP G . n G 1 128 GLU 128 128 128 GLU GLU G . n G 1 129 GLN 129 129 129 GLN GLN G . n G 1 130 VAL 130 130 130 VAL VAL G . n G 1 131 GLU 131 131 131 GLU GLU G . n G 1 132 GLU 132 132 132 GLU GLU G . n G 1 133 GLU 133 133 133 GLU GLU G . n G 1 134 ASP 134 134 134 ASP ASP G . n G 1 135 GLN 135 135 135 GLN GLN G . n G 1 136 VAL 136 136 136 VAL VAL G . n G 1 137 ARG 137 137 137 ARG ARG G . n G 1 138 GLU 138 138 138 GLU GLU G . n G 1 139 ILE 139 139 139 ILE ILE G . n G 1 140 LEU 140 140 140 LEU LEU G . n G 1 141 ASP 141 141 141 ASP ASP G . n G 1 142 LEU 142 142 142 LEU LEU G . n G 1 143 LEU 143 143 143 LEU LEU G . n G 1 144 GLU 144 144 144 GLU GLU G . n G 1 145 LYS 145 145 145 LYS LYS G . n G 1 146 ALA 146 146 146 ALA ALA G . n G 1 147 ASN 147 147 147 ASN ASN G . n G 1 148 GLY 148 148 148 GLY GLY G . n G 1 149 GLN 149 149 149 GLN GLN G . n G 1 150 MET 150 150 150 MET MET G . n G 1 151 SER 151 151 151 SER SER G . n G 1 152 VAL 152 152 152 VAL VAL G . n G 1 153 ILE 153 153 153 ILE ILE G . n G 1 154 PHE 154 154 154 PHE PHE G . n G 1 155 GLN 155 155 155 GLN GLN G . n G 1 156 LEU 156 156 156 LEU LEU G . n G 1 157 ASP 157 157 157 ASP ASP G . n G 1 158 ARG 158 158 158 ARG ARG G . n G 1 159 TYR 159 159 159 TYR TYR G . n G 1 160 LEU 160 160 160 LEU LEU G . n G 1 161 GLY 161 161 161 GLY GLY G . n G 1 162 GLN 162 162 162 GLN GLN G . n G 1 163 ARG 163 163 163 ARG ARG G . n G 1 164 GLU 164 164 164 GLU GLU G . n H 1 1 MET 1 1 1 MET MET H . n H 1 2 MET 2 2 2 MET MET H . n H 1 3 VAL 3 3 3 VAL VAL H . n H 1 4 ILE 4 4 4 ILE ILE H . n H 1 5 SER 5 5 5 SER SER H . n H 1 6 GLU 6 6 6 GLU GLU H . n H 1 7 LYS 7 7 7 LYS LYS H . n H 1 8 VAL 8 8 8 VAL VAL H . n H 1 9 ARG 9 9 9 ARG ARG H . n H 1 10 LYS 10 10 10 LYS LYS H . n H 1 11 ALA 11 11 11 ALA ALA H . n H 1 12 LEU 12 12 12 LEU LEU H . n H 1 13 ASN 13 13 13 ASN ASN H . n H 1 14 ASP 14 14 14 ASP ASP H . n H 1 15 GLN 15 15 15 GLN GLN H . n H 1 16 LEU 16 16 16 LEU LEU H . n H 1 17 ASN 17 17 17 ASN ASN H . n H 1 18 ARG 18 18 18 ARG ARG H . n H 1 19 GLU 19 19 19 GLU GLU H . n H 1 20 ILE 20 20 20 ILE ILE H . n H 1 21 TYR 21 21 21 TYR TYR H . n H 1 22 SER 22 22 22 SER SER H . n H 1 23 SER 23 23 23 SER SER H . n H 1 24 TYR 24 24 24 TYR TYR H . n H 1 25 LEU 25 25 25 LEU LEU H . n H 1 26 TYR 26 26 26 TYR TYR H . n H 1 27 LEU 27 27 27 LEU LEU H . n H 1 28 SER 28 28 28 SER SER H . n H 1 29 MET 29 29 29 MET MET H . n H 1 30 ALA 30 30 30 ALA ALA H . n H 1 31 THR 31 31 31 THR THR H . n H 1 32 TYR 32 32 32 TYR TYR H . n H 1 33 PHE 33 33 33 PHE PHE H . n H 1 34 ASP 34 34 34 ASP ASP H . n H 1 35 ALA 35 35 35 ALA ALA H . n H 1 36 GLU 36 36 36 GLU GLU H . n H 1 37 GLY 37 37 37 GLY GLY H . n H 1 38 PHE 38 38 38 PHE PHE H . n H 1 39 LYS 39 39 39 LYS LYS H . n H 1 40 GLY 40 40 40 GLY GLY H . n H 1 41 PHE 41 41 41 PHE PHE H . n H 1 42 VAL 42 42 42 VAL VAL H . n H 1 43 HIS 43 43 43 HIS HIS H . n H 1 44 TRP 44 44 44 TRP TRP H . n H 1 45 MET 45 45 45 MET MET H . n H 1 46 LYS 46 46 46 LYS LYS H . n H 1 47 LYS 47 47 47 LYS LYS H . n H 1 48 GLN 48 48 48 GLN GLN H . n H 1 49 ALA 49 49 49 ALA ALA H . n H 1 50 GLN 50 50 50 GLN GLN H . n H 1 51 GLU 51 51 51 GLU GLU H . n H 1 52 GLU 52 52 52 GLU GLU H . n H 1 53 LEU 53 53 53 LEU LEU H . n H 1 54 THR 54 54 54 THR THR H . n H 1 55 HIS 55 55 55 HIS HIS H . n H 1 56 ALA 56 56 56 ALA ALA H . n H 1 57 MET 57 57 57 MET MET H . n H 1 58 LYS 58 58 58 LYS LYS H . n H 1 59 PHE 59 59 59 PHE PHE H . n H 1 60 TYR 60 60 60 TYR TYR H . n H 1 61 GLU 61 61 61 GLU GLU H . n H 1 62 TYR 62 62 62 TYR TYR H . n H 1 63 ILE 63 63 63 ILE ILE H . n H 1 64 TYR 64 64 64 TYR TYR H . n H 1 65 ASP 65 65 65 ASP ASP H . n H 1 66 ARG 66 66 66 ARG ARG H . n H 1 67 GLY 67 67 67 GLY GLY H . n H 1 68 GLY 68 68 68 GLY GLY H . n H 1 69 ARG 69 69 69 ARG ARG H . n H 1 70 VAL 70 70 70 VAL VAL H . n H 1 71 GLU 71 71 71 GLU GLU H . n H 1 72 LEU 72 72 72 LEU LEU H . n H 1 73 GLU 73 73 73 GLU GLU H . n H 1 74 ALA 74 74 74 ALA ALA H . n H 1 75 ILE 75 75 75 ILE ILE H . n H 1 76 GLU 76 76 76 GLU GLU H . n H 1 77 LYS 77 77 77 LYS LYS H . n H 1 78 PRO 78 78 78 PRO PRO H . n H 1 79 PRO 79 79 79 PRO PRO H . n H 1 80 SER 80 80 80 SER SER H . n H 1 81 ASN 81 81 81 ASN ASN H . n H 1 82 TRP 82 82 82 TRP TRP H . n H 1 83 ASN 83 83 83 ASN ASN H . n H 1 84 GLY 84 84 84 GLY GLY H . n H 1 85 ILE 85 85 85 ILE ILE H . n H 1 86 LYS 86 86 86 LYS LYS H . n H 1 87 ASP 87 87 87 ASP ASP H . n H 1 88 ALA 88 88 88 ALA ALA H . n H 1 89 PHE 89 89 89 PHE PHE H . n H 1 90 GLU 90 90 90 GLU GLU H . n H 1 91 ALA 91 91 91 ALA ALA H . n H 1 92 ALA 92 92 92 ALA ALA H . n H 1 93 LEU 93 93 93 LEU LEU H . n H 1 94 LYS 94 94 94 LYS LYS H . n H 1 95 HIS 95 95 95 HIS HIS H . n H 1 96 GLU 96 96 96 GLU GLU H . n H 1 97 GLU 97 97 97 GLU GLU H . n H 1 98 PHE 98 98 98 PHE PHE H . n H 1 99 VAL 99 99 99 VAL VAL H . n H 1 100 THR 100 100 100 THR THR H . n H 1 101 GLN 101 101 101 GLN GLN H . n H 1 102 SER 102 102 102 SER SER H . n H 1 103 ILE 103 103 103 ILE ILE H . n H 1 104 TYR 104 104 104 TYR TYR H . n H 1 105 ASN 105 105 105 ASN ASN H . n H 1 106 ILE 106 106 106 ILE ILE H . n H 1 107 LEU 107 107 107 LEU LEU H . n H 1 108 GLU 108 108 108 GLU GLU H . n H 1 109 LEU 109 109 109 LEU LEU H . n H 1 110 ALA 110 110 110 ALA ALA H . n H 1 111 SER 111 111 111 SER SER H . n H 1 112 GLU 112 112 112 GLU GLU H . n H 1 113 GLU 113 113 113 GLU GLU H . n H 1 114 LYS 114 114 114 LYS LYS H . n H 1 115 ASP 115 115 115 ASP ASP H . n H 1 116 HIS 116 116 116 HIS HIS H . n H 1 117 ALA 117 117 117 ALA ALA H . n H 1 118 THR 118 118 118 THR THR H . n H 1 119 VAL 119 119 119 VAL VAL H . n H 1 120 SER 120 120 120 SER SER H . n H 1 121 PHE 121 121 121 PHE PHE H . n H 1 122 LEU 122 122 122 LEU LEU H . n H 1 123 LYS 123 123 123 LYS LYS H . n H 1 124 TRP 124 124 124 TRP TRP H . n H 1 125 PHE 125 125 125 PHE PHE H . n H 1 126 VAL 126 126 126 VAL VAL H . n H 1 127 ASP 127 127 127 ASP ASP H . n H 1 128 GLU 128 128 128 GLU GLU H . n H 1 129 GLN 129 129 129 GLN GLN H . n H 1 130 VAL 130 130 130 VAL VAL H . n H 1 131 GLU 131 131 131 GLU GLU H . n H 1 132 GLU 132 132 132 GLU GLU H . n H 1 133 GLU 133 133 133 GLU GLU H . n H 1 134 ASP 134 134 134 ASP ASP H . n H 1 135 GLN 135 135 135 GLN GLN H . n H 1 136 VAL 136 136 136 VAL VAL H . n H 1 137 ARG 137 137 137 ARG ARG H . n H 1 138 GLU 138 138 138 GLU GLU H . n H 1 139 ILE 139 139 139 ILE ILE H . n H 1 140 LEU 140 140 140 LEU LEU H . n H 1 141 ASP 141 141 141 ASP ASP H . n H 1 142 LEU 142 142 142 LEU LEU H . n H 1 143 LEU 143 143 143 LEU LEU H . n H 1 144 GLU 144 144 144 GLU GLU H . n H 1 145 LYS 145 145 145 LYS LYS H . n H 1 146 ALA 146 146 146 ALA ALA H . n H 1 147 ASN 147 147 147 ASN ASN H . n H 1 148 GLY 148 148 148 GLY GLY H . n H 1 149 GLN 149 149 149 GLN GLN H . n H 1 150 MET 150 150 150 MET MET H . n H 1 151 SER 151 151 151 SER SER H . n H 1 152 VAL 152 152 152 VAL VAL H . n H 1 153 ILE 153 153 153 ILE ILE H . n H 1 154 PHE 154 154 154 PHE PHE H . n H 1 155 GLN 155 155 155 GLN GLN H . n H 1 156 LEU 156 156 156 LEU LEU H . n H 1 157 ASP 157 157 157 ASP ASP H . n H 1 158 ARG 158 158 158 ARG ARG H . n H 1 159 TYR 159 159 159 TYR TYR H . n H 1 160 LEU 160 160 160 LEU LEU H . n H 1 161 GLY 161 161 161 GLY GLY H . n H 1 162 GLN 162 162 162 GLN GLN H . n H 1 163 ARG 163 163 163 ARG ARG H . n H 1 164 GLU 164 164 164 GLU GLU H . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code I 2 SO4 1 201 202 SO4 SO4 A . J 3 GOL 1 202 203 GOL GOL A . K 2 SO4 1 203 9 SO4 SO4 A . L 2 SO4 1 204 18 SO4 SO4 A . M 2 SO4 1 205 24 SO4 SO4 A . N 2 SO4 1 206 26 SO4 SO4 A . O 3 GOL 1 207 6 GOL GOL A . P 4 FE 1 208 204 FE FE A . Q 2 SO4 1 201 203 SO4 SO4 B . R 2 SO4 1 202 202 SO4 SO4 B . S 2 SO4 1 203 4 SO4 SO4 B . T 2 SO4 1 204 8 SO4 SO4 B . U 2 SO4 1 205 19 SO4 SO4 B . V 2 SO4 1 206 25 SO4 SO4 B . W 3 GOL 1 207 1 GOL GOL B . X 3 GOL 1 208 2 GOL GOL B . Y 3 GOL 1 209 3 GOL GOL B . Z 3 GOL 1 210 4 GOL GOL B . AA 5 LFA 1 211 3 LFA LFA B . BA 4 FE 1 212 201 FE FE B . CA 2 SO4 1 201 201 SO4 SO4 C . DA 2 SO4 1 202 3 SO4 SO4 C . EA 2 SO4 1 203 12 SO4 SO4 C . FA 5 LFA 1 204 4 LFA LFA C . GA 4 FE 1 205 202 FE FE C . HA 2 SO4 1 201 201 SO4 SO4 D . IA 2 SO4 1 202 10 SO4 SO4 D . JA 2 SO4 1 203 11 SO4 SO4 D . KA 2 SO4 1 204 20 SO4 SO4 D . LA 3 GOL 1 205 5 GOL GOL D . MA 4 FE 1 206 203 FE FE D . NA 2 SO4 1 201 203 SO4 SO4 E . OA 2 SO4 1 202 7 SO4 SO4 E . PA 2 SO4 1 203 13 SO4 SO4 E . QA 4 FE 1 204 200 FE FE E . RA 2 SO4 1 201 201 SO4 SO4 F . SA 2 SO4 1 202 5 SO4 SO4 F . TA 2 SO4 1 203 14 SO4 SO4 F . UA 2 SO4 1 204 21 SO4 SO4 F . VA 2 SO4 1 205 23 SO4 SO4 F . WA 5 LFA 1 206 2 LFA LFA F . XA 4 FE 1 207 205 FE FE F . YA 2 SO4 1 201 1 SO4 SO4 G . ZA 2 SO4 1 202 6 SO4 SO4 G . AB 2 SO4 1 203 15 SO4 SO4 G . BB 2 SO4 1 204 22 SO4 SO4 G . CB 2 SO4 1 205 28 SO4 SO4 G . DB 5 LFA 1 206 5 LFA LFA G . EB 4 FE 1 207 206 FE FE G . FB 2 SO4 1 201 2 SO4 SO4 H . GB 2 SO4 1 202 16 SO4 SO4 H . HB 2 SO4 1 203 17 SO4 SO4 H . IB 2 SO4 1 204 27 SO4 SO4 H . JB 4 FE 1 205 207 FE FE H . KB 6 HOH 1 301 14 HOH HOH A . KB 6 HOH 2 302 39 HOH HOH A . KB 6 HOH 3 303 291 HOH HOH A . KB 6 HOH 4 304 144 HOH HOH A . KB 6 HOH 5 305 97 HOH HOH A . KB 6 HOH 6 306 77 HOH HOH A . KB 6 HOH 7 307 16 HOH HOH A . KB 6 HOH 8 308 21 HOH HOH A . KB 6 HOH 9 309 132 HOH HOH A . KB 6 HOH 10 310 73 HOH HOH A . KB 6 HOH 11 311 20 HOH HOH A . KB 6 HOH 12 312 89 HOH HOH A . KB 6 HOH 13 313 25 HOH HOH A . KB 6 HOH 14 314 17 HOH HOH A . KB 6 HOH 15 315 41 HOH HOH A . KB 6 HOH 16 316 96 HOH HOH A . KB 6 HOH 17 317 18 HOH HOH A . KB 6 HOH 18 318 57 HOH HOH A . KB 6 HOH 19 319 24 HOH HOH A . KB 6 HOH 20 320 1 HOH HOH A . KB 6 HOH 21 321 32 HOH HOH A . KB 6 HOH 22 322 11 HOH HOH A . KB 6 HOH 23 323 88 HOH HOH A . KB 6 HOH 24 324 23 HOH HOH A . KB 6 HOH 25 325 118 HOH HOH A . KB 6 HOH 26 326 133 HOH HOH A . KB 6 HOH 27 327 111 HOH HOH A . KB 6 HOH 28 328 93 HOH HOH A . KB 6 HOH 29 329 38 HOH HOH A . KB 6 HOH 30 330 134 HOH HOH A . KB 6 HOH 31 331 394 HOH HOH A . LB 6 HOH 1 301 127 HOH HOH B . LB 6 HOH 2 302 22 HOH HOH B . LB 6 HOH 3 303 130 HOH HOH B . LB 6 HOH 4 304 40 HOH HOH B . LB 6 HOH 5 305 53 HOH HOH B . LB 6 HOH 6 306 140 HOH HOH B . LB 6 HOH 7 307 115 HOH HOH B . LB 6 HOH 8 308 65 HOH HOH B . LB 6 HOH 9 309 128 HOH HOH B . LB 6 HOH 10 310 2 HOH HOH B . LB 6 HOH 11 311 126 HOH HOH B . LB 6 HOH 12 312 139 HOH HOH B . LB 6 HOH 13 313 79 HOH HOH B . LB 6 HOH 14 314 27 HOH HOH B . LB 6 HOH 15 315 131 HOH HOH B . LB 6 HOH 16 316 8 HOH HOH B . LB 6 HOH 17 317 59 HOH HOH B . LB 6 HOH 18 318 90 HOH HOH B . LB 6 HOH 19 319 138 HOH HOH B . LB 6 HOH 20 320 100 HOH HOH B . LB 6 HOH 21 321 36 HOH HOH B . LB 6 HOH 22 322 62 HOH HOH B . LB 6 HOH 23 323 54 HOH HOH B . LB 6 HOH 24 324 10 HOH HOH B . LB 6 HOH 25 325 72 HOH HOH B . LB 6 HOH 26 326 26 HOH HOH B . LB 6 HOH 27 327 7 HOH HOH B . LB 6 HOH 28 328 124 HOH HOH B . LB 6 HOH 29 329 58 HOH HOH B . LB 6 HOH 30 330 85 HOH HOH B . LB 6 HOH 31 331 47 HOH HOH B . LB 6 HOH 32 332 103 HOH HOH B . LB 6 HOH 33 333 30 HOH HOH B . LB 6 HOH 34 334 29 HOH HOH B . LB 6 HOH 35 335 13 HOH HOH B . LB 6 HOH 36 336 52 HOH HOH B . LB 6 HOH 37 337 125 HOH HOH B . LB 6 HOH 38 338 6 HOH HOH B . LB 6 HOH 39 339 80 HOH HOH B . LB 6 HOH 40 340 75 HOH HOH B . LB 6 HOH 41 341 92 HOH HOH B . LB 6 HOH 42 342 42 HOH HOH B . LB 6 HOH 43 343 395 HOH HOH B . LB 6 HOH 44 344 94 HOH HOH B . LB 6 HOH 45 345 207 HOH HOH B . LB 6 HOH 46 346 27 HOH HOH B . MB 6 HOH 1 301 93 HOH HOH C . MB 6 HOH 2 302 141 HOH HOH C . MB 6 HOH 3 303 71 HOH HOH C . MB 6 HOH 4 304 45 HOH HOH C . MB 6 HOH 5 305 76 HOH HOH C . MB 6 HOH 6 306 78 HOH HOH C . MB 6 HOH 7 307 15 HOH HOH C . MB 6 HOH 8 308 99 HOH HOH C . MB 6 HOH 9 309 4 HOH HOH C . MB 6 HOH 10 310 19 HOH HOH C . MB 6 HOH 11 311 98 HOH HOH C . MB 6 HOH 12 312 70 HOH HOH C . NB 6 HOH 1 301 142 HOH HOH D . NB 6 HOH 2 302 102 HOH HOH D . NB 6 HOH 3 303 51 HOH HOH D . NB 6 HOH 4 304 63 HOH HOH D . NB 6 HOH 5 305 101 HOH HOH D . NB 6 HOH 6 306 31 HOH HOH D . NB 6 HOH 7 307 68 HOH HOH D . NB 6 HOH 8 308 117 HOH HOH D . NB 6 HOH 9 309 81 HOH HOH D . NB 6 HOH 10 310 135 HOH HOH D . NB 6 HOH 11 311 13 HOH HOH D . NB 6 HOH 12 312 114 HOH HOH D . OB 6 HOH 1 301 137 HOH HOH E . OB 6 HOH 2 302 33 HOH HOH E . OB 6 HOH 3 303 5 HOH HOH E . OB 6 HOH 4 304 46 HOH HOH E . OB 6 HOH 5 305 30 HOH HOH E . OB 6 HOH 6 306 83 HOH HOH E . OB 6 HOH 7 307 4 HOH HOH E . OB 6 HOH 8 308 136 HOH HOH E . OB 6 HOH 9 309 34 HOH HOH E . OB 6 HOH 10 310 76 HOH HOH E . OB 6 HOH 11 311 66 HOH HOH E . OB 6 HOH 12 312 109 HOH HOH E . OB 6 HOH 13 313 74 HOH HOH E . OB 6 HOH 14 314 28 HOH HOH E . OB 6 HOH 15 315 143 HOH HOH E . OB 6 HOH 16 316 16 HOH HOH E . OB 6 HOH 17 317 106 HOH HOH E . OB 6 HOH 18 318 87 HOH HOH E . OB 6 HOH 19 319 108 HOH HOH E . PB 6 HOH 1 301 50 HOH HOH F . PB 6 HOH 2 302 48 HOH HOH F . PB 6 HOH 3 303 39 HOH HOH F . PB 6 HOH 4 304 38 HOH HOH F . PB 6 HOH 5 305 104 HOH HOH F . PB 6 HOH 6 306 35 HOH HOH F . PB 6 HOH 7 307 112 HOH HOH F . PB 6 HOH 8 308 37 HOH HOH F . PB 6 HOH 9 309 110 HOH HOH F . PB 6 HOH 10 310 36 HOH HOH F . PB 6 HOH 11 311 113 HOH HOH F . QB 6 HOH 1 301 145 HOH HOH G . QB 6 HOH 2 302 31 HOH HOH G . QB 6 HOH 3 303 54 HOH HOH G . QB 6 HOH 4 304 120 HOH HOH G . QB 6 HOH 5 305 107 HOH HOH G . RB 6 HOH 1 301 146 HOH HOH H . RB 6 HOH 2 302 12 HOH HOH H . RB 6 HOH 3 303 129 HOH HOH H . RB 6 HOH 4 304 41 HOH HOH H . RB 6 HOH 5 305 79 HOH HOH H . RB 6 HOH 6 306 188 HOH HOH H . RB 6 HOH 7 307 105 HOH HOH H . RB 6 HOH 8 308 91 HOH HOH H . RB 6 HOH 9 309 49 HOH HOH H . RB 6 HOH 10 310 82 HOH HOH H . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.15.1-3469 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 2 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? 2.8.2 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25 4 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 6TXJ _cell.details ? _cell.formula_units_Z ? _cell.length_a 176.203 _cell.length_a_esd ? _cell.length_b 176.203 _cell.length_b_esd ? _cell.length_c 352.794 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 144 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6TXJ _symmetry.cell_setting ? _symmetry.Int_Tables_number 155 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'H 3 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6TXJ _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.39 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 63.76 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '2.4 M (NH4)2 SO4, 0.1M MES. pH 6.0' _exptl_crystal_grow.pdbx_pH_range 6.0 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 S 2M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2019-04-13 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'DCM Si111' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9184 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'BESSY BEAMLINE 14.2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9184 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 14.2 _diffrn_source.pdbx_synchrotron_site BESSY # _reflns.B_iso_Wilson_estimate 63.455 _reflns.entry_id 6TXJ _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.167 _reflns.d_resolution_low 24.863 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 111200 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.700 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 10.147 _reflns.pdbx_Rmerge_I_obs 0.129 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 12.990 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 1.298 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.136 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split 2.170 2.300 ? 0.530 ? 181741 17855 ? 17634 98.800 ? ? ? ? 4.047 ? ? ? ? ? ? ? ? 10.306 ? ? ? ? 4.258 ? ? 1 1 0.324 ? ? 2.300 2.460 ? 0.860 ? 168914 16812 ? 16802 99.900 ? ? ? ? 2.504 ? ? ? ? ? ? ? ? 10.053 ? ? ? ? 2.639 ? ? 2 1 0.539 ? ? 2.460 2.650 ? 1.540 ? 157554 15681 ? 15661 99.900 ? ? ? ? 1.435 ? ? ? ? ? ? ? ? 10.060 ? ? ? ? 1.512 ? ? 3 1 0.712 ? ? 2.650 2.900 ? 3.270 ? 155426 14480 ? 14450 99.800 ? ? ? ? 0.736 ? ? ? ? ? ? ? ? 10.756 ? ? ? ? 0.773 ? ? 4 1 0.915 ? ? 2.900 3.250 ? 7.730 ? 137306 13097 ? 13064 99.700 ? ? ? ? 0.315 ? ? ? ? ? ? ? ? 10.510 ? ? ? ? 0.331 ? ? 5 1 0.979 ? ? 3.250 3.740 ? 18.620 ? 108131 11591 ? 11568 99.800 ? ? ? ? 0.128 ? ? ? ? ? ? ? ? 9.347 ? ? ? ? 0.135 ? ? 6 1 0.995 ? ? 3.740 4.580 ? 38.030 ? 102517 9887 ? 9879 99.900 ? ? ? ? 0.061 ? ? ? ? ? ? ? ? 10.377 ? ? ? ? 0.065 ? ? 7 1 0.999 ? ? 4.580 6.450 ? 47.840 ? 75183 7692 ? 7687 99.900 ? ? ? ? 0.047 ? ? ? ? ? ? ? ? 9.781 ? ? ? ? 0.050 ? ? 8 1 0.999 ? ? 6.450 24.863 ? 64.940 ? 41608 4478 ? 4455 99.500 ? ? ? ? 0.028 ? ? ? ? ? ? ? ? 9.340 ? ? ? ? 0.029 ? ? 9 1 1.000 ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 171.160 _refine.B_iso_mean 85.1996 _refine.B_iso_min 45.380 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6TXJ _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.17 _refine.ls_d_res_low 24.8630 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 110960 _refine.ls_number_reflns_R_free 2097 _refine.ls_number_reflns_R_work 108863 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.5400 _refine.ls_percent_reflns_R_free 1.8900 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2105 _refine.ls_R_factor_R_free 0.2462 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2098 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.330 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1vlg _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 36.3200 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.4800 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.17 _refine_hist.d_res_low 24.8630 _refine_hist.number_atoms_solvent 146 _refine_hist.number_atoms_total 11371 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 1309 _refine_hist.pdbx_B_iso_mean_ligand 106.55 _refine_hist.pdbx_B_iso_mean_solvent 76.64 _refine_hist.pdbx_number_atoms_protein 10920 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 305 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr_ncs.pdbx_refine_id _refine_ls_restr_ncs.dom_id _refine_ls_restr_ncs.ncs_model_details _refine_ls_restr_ncs.rms_dev_B_iso _refine_ls_restr_ncs.rms_dev_position _refine_ls_restr_ncs.weight_B_iso _refine_ls_restr_ncs.weight_position _refine_ls_restr_ncs.pdbx_ordinal _refine_ls_restr_ncs.pdbx_type _refine_ls_restr_ncs.pdbx_asym_id _refine_ls_restr_ncs.pdbx_auth_asym_id _refine_ls_restr_ncs.pdbx_number _refine_ls_restr_ncs.pdbx_rms _refine_ls_restr_ncs.pdbx_weight _refine_ls_restr_ncs.pdbx_ens_id 'X-RAY DIFFRACTION' 1 ? ? ? ? ? 1 TORSIONAL ? A 3216 5.487 ? 1 'X-RAY DIFFRACTION' 2 ? ? ? ? ? 2 TORSIONAL ? B 3216 5.487 ? 1 'X-RAY DIFFRACTION' 3 ? ? ? ? ? 3 TORSIONAL ? C 3216 5.487 ? 1 'X-RAY DIFFRACTION' 4 ? ? ? ? ? 4 TORSIONAL ? D 3216 5.487 ? 1 'X-RAY DIFFRACTION' 5 ? ? ? ? ? 5 TORSIONAL ? E 3216 5.487 ? 1 'X-RAY DIFFRACTION' 6 ? ? ? ? ? 6 TORSIONAL ? F 3216 5.487 ? 1 'X-RAY DIFFRACTION' 7 ? ? ? ? ? 7 TORSIONAL ? G 3216 5.487 ? 1 'X-RAY DIFFRACTION' 8 ? ? ? ? ? 8 TORSIONAL ? H 3216 5.487 ? 1 # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.17 2.2169 . . 135 7005 97.0000 . . . 0.4039 0.0000 0.3989 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.2169 2.2723 . . 138 7183 100.0000 . . . 0.4022 0.0000 0.3773 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.2723 2.3337 . . 140 7253 100.0000 . . . 0.3739 0.0000 0.3614 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.3337 2.4023 . . 139 7216 100.0000 . . . 0.3604 0.0000 0.3445 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.4023 2.4798 . . 140 7223 99.0000 . . . 0.3319 0.0000 0.3419 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.4798 2.5683 . . 139 7189 100.0000 . . . 0.3939 0.0000 0.3432 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.5683 2.6710 . . 140 7283 100.0000 . . . 0.3780 0.0000 0.3275 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.6710 2.7924 . . 139 7215 100.0000 . . . 0.3535 0.0000 0.3131 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.7924 2.9394 . . 140 7281 100.0000 . . . 0.3119 0.0000 0.2892 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.9394 3.1233 . . 139 7244 100.0000 . . . 0.3351 0.0000 0.2791 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.1233 3.3639 . . 140 7268 100.0000 . . . 0.2747 0.0000 0.2467 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.3639 3.7014 . . 141 7295 100.0000 . . . 0.2446 0.0000 0.2120 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.7014 4.2348 . . 140 7314 100.0000 . . . 0.2166 0.0000 0.1787 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.2348 5.3267 . . 142 7383 100.0000 . . . 0.1837 0.0000 0.1525 . . . . . . . . . . . 'X-RAY DIFFRACTION' 5.3267 24.863 . . 145 7511 99.0000 . . . 0.2012 0.0000 0.1571 . . . . . . . . . . . # loop_ _struct_ncs_dom.pdbx_ens_id _struct_ncs_dom.id _struct_ncs_dom.details 1 1 ;(chain A and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; 1 2 ;(chain B and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; 1 3 ;(chain C and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; 1 4 ;(chain D and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; 1 5 ;(chain E and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; 1 6 ;(chain F and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; 1 7 ;(chain G and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; 1 8 ;(chain H and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; # loop_ _struct_ncs_dom_lim.pdbx_ens_id _struct_ncs_dom_lim.dom_id _struct_ncs_dom_lim.pdbx_component_id _struct_ncs_dom_lim.pdbx_refine_code _struct_ncs_dom_lim.beg_auth_asym_id _struct_ncs_dom_lim.beg_auth_seq_id _struct_ncs_dom_lim.end_auth_asym_id _struct_ncs_dom_lim.end_auth_seq_id _struct_ncs_dom_lim.selection_details _struct_ncs_dom_lim.beg_label_asym_id _struct_ncs_dom_lim.beg_label_comp_id _struct_ncs_dom_lim.beg_label_seq_id _struct_ncs_dom_lim.beg_label_alt_id _struct_ncs_dom_lim.end_label_asym_id _struct_ncs_dom_lim.end_label_comp_id _struct_ncs_dom_lim.end_label_seq_id _struct_ncs_dom_lim.end_label_alt_id _struct_ncs_dom_lim.beg_auth_comp_id _struct_ncs_dom_lim.end_auth_comp_id 1 1 1 ? A 2 A 38 ;(chain A and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 1 2 ? A 40 A 49 ;(chain A and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 1 3 ? A 51 A 57 ;(chain A and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 1 4 ? A 59 A 68 ;(chain A and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 1 5 ? A 86 A 111 ;(chain A and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 1 6 ? A 2 A 164 ;(chain A and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 1 7 ? A 132 A 134 ;(chain A and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 1 8 ? A 136 A 137 ;(chain A and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 1 9 ? A 139 A 1403 ;(chain A and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 1 10 ? A 145 A 13 ;(chain A and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 1 11 ? A 145 A 148 ;(chain A and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 1 12 ? A 150 A 154 ;(chain A and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 1 13 ? A 156 A 157 ;(chain A and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 1 14 ? A 159 A 164 ;(chain A and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 2 1 ? B 2 B 38 ;(chain B and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 2 2 ? B 40 B 49 ;(chain B and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 2 3 ? B 51 B 57 ;(chain B and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 2 4 ? B 59 B 68 ;(chain B and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 2 5 ? B 86 B 111 ;(chain B and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 2 6 ? B 1 B 164 ;(chain B and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 2 7 ? B 132 B 134 ;(chain B and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 2 8 ? B 136 B 137 ;(chain B and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 2 9 ? B 139 B 1403 ;(chain B and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 2 10 ? B 145 B 13 ;(chain B and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 2 11 ? B 145 B 148 ;(chain B and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 2 12 ? B 150 B 154 ;(chain B and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 2 13 ? B 156 B 157 ;(chain B and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 2 14 ? B 159 B 164 ;(chain B and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 3 1 ? C 2 C 38 ;(chain C and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 3 2 ? C 40 C 49 ;(chain C and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 3 3 ? C 1 C 164 ;(chain C and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 3 4 ? C 0 C 0 ;(chain C and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 3 5 ? C 86 C 3 ;(chain C and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 3 6 ? C 113 C 122 ;(chain C and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 3 7 ? C 12422 C 12422 ;(chain C and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 3 8 ? C 124 C 130 ;(chain C and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 3 9 ? C 132 C 134 ;(chain C and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 3 10 ? C 139 C 1403 ;(chain C and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 3 11 ? C 145 C 1 ;(chain C and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 3 12 ? C 145 C 13 ;(chain C and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 3 13 ? C 145 C 148 ;(chain C and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 3 14 ? C 150 C 154 ;(chain C and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 3 15 ? C 156 C 157 ;(chain C and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 3 16 ? C 159 C 164 ;(chain C and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 4 1 ? D 2 D 38 ;(chain D and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 4 2 ? D 40 D 49 ;(chain D and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 4 3 ? D 51 D 57 ;(chain D and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 4 4 ? D 86 D 111 ;(chain D and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 4 5 ? D 113 D 122 ;(chain D and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 4 6 ? D 2 D 164 ;(chain D and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 4 7 ? D 124 D 130 ;(chain D and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 4 8 ? D 132 D 134 ;(chain D and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 4 9 ? D 139 D 1403 ;(chain D and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 4 10 ? D 145 D 1 ;(chain D and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 4 11 ? D 145 D 13 ;(chain D and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 4 12 ? D 145 D 148 ;(chain D and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 4 13 ? D 150 D 154 ;(chain D and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 4 14 ? D 156 D 157 ;(chain D and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 4 15 ? D 159 D 164 ;(chain D and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 5 1 ? E 2 E 38 ;(chain E and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 5 2 ? E 40 E 49 ;(chain E and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 5 3 ? E 51 E 57 ;(chain E and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 5 4 ? E 86 E 111 ;(chain E and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 5 5 ? E 113 E 122 ;(chain E and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 5 6 ? E 1 E 164 ;(chain E and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 5 7 ? E 124 E 130 ;(chain E and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 5 8 ? E 132 E 134 ;(chain E and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 5 9 ? E 139 E 1403 ;(chain E and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 5 10 ? E 145 E 1 ;(chain E and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 5 11 ? E 145 E 13 ;(chain E and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 5 12 ? E 145 E 148 ;(chain E and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 5 13 ? E 150 E 154 ;(chain E and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 5 14 ? E 156 E 157 ;(chain E and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 5 15 ? E 159 E 164 ;(chain E and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 6 1 ? F 2 F 38 ;(chain F and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 6 2 ? F 40 F 49 ;(chain F and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 6 3 ? F 51 F 57 ;(chain F and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 6 4 ? F 86 F 111 ;(chain F and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 6 5 ? F 113 F 122 ;(chain F and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 6 6 ? F 1 F 164 ;(chain F and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 6 7 ? F 124 F 130 ;(chain F and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 6 8 ? F 132 F 134 ;(chain F and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 6 9 ? F 139 F 1403 ;(chain F and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 6 10 ? F 145 F 1 ;(chain F and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 6 11 ? F 145 F 13 ;(chain F and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 6 12 ? F 145 F 148 ;(chain F and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 6 13 ? F 150 F 154 ;(chain F and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 6 14 ? F 156 F 157 ;(chain F and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 6 15 ? F 159 F 164 ;(chain F and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 7 1 ? G 2 G 38 ;(chain G and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 7 2 ? G 40 G 49 ;(chain G and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 7 3 ? G 51 G 57 ;(chain G and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 7 4 ? G 59 G 68 ;(chain G and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 7 5 ? G 86 G 111 ;(chain G and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 7 6 ? G 2 G 164 ;(chain G and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 7 7 ? G 132 G 134 ;(chain G and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 7 8 ? G 136 G 137 ;(chain G and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 7 9 ? G 139 G 1403 ;(chain G and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 7 10 ? G 145 G 13 ;(chain G and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 7 11 ? G 145 G 148 ;(chain G and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 7 12 ? G 150 G 154 ;(chain G and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 7 13 ? G 156 G 157 ;(chain G and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 7 14 ? G 159 G 164 ;(chain G and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 8 1 ? H 2 H 38 ;(chain H and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 8 2 ? H 40 H 49 ;(chain H and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 8 3 ? H 51 H 57 ;(chain H and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 8 4 ? H 59 H 68 ;(chain H and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 8 5 ? H 86 H 111 ;(chain H and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 8 6 ? H 1 H 164 ;(chain H and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 8 7 ? H 132 H 134 ;(chain H and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 8 8 ? H 136 H 137 ;(chain H and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 8 9 ? H 139 H 1403 ;(chain H and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 8 10 ? H 145 H 13 ;(chain H and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 8 11 ? H 145 H 148 ;(chain H and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 8 12 ? H 150 H 154 ;(chain H and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 8 13 ? H 156 H 157 ;(chain H and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? 1 8 14 ? H 159 H 164 ;(chain H and (resid 2 through 38 or resid 40 through 49 or resid 51 through 57 or resid 59 through 68 or resid 70 through 84 or resid 86 through 111 or resid 113 through 122 or resid 124 through 130 or resid 132 through 134 or resid 136 through 137 or resid 139 through 140 or resid 142 through 143 or resid 145 through 148 or resid 150 through 154 or resid 156 through 157 or resid 159 through 164)) ; ? ? ? ? ? ? ? ? ? ? # _struct_ncs_ens.id 1 _struct_ncs_ens.details ? # _struct.entry_id 6TXJ _struct.title 'Crystal structure of thermotoga maritima A42V E65D Ferritin' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6TXJ _struct_keywords.text 'Metal binding, engineered protein, METAL BINDING PROTEIN' _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 1 ? D N N 1 ? E N N 1 ? F N N 1 ? G N N 1 ? H N N 1 ? I N N 2 ? J N N 3 ? K N N 2 ? L N N 2 ? M N N 2 ? N N N 2 ? O N N 3 ? P N N 4 ? Q N N 2 ? R N N 2 ? S N N 2 ? T N N 2 ? U N N 2 ? V N N 2 ? W N N 3 ? X N N 3 ? Y N N 3 ? Z N N 3 ? AA N N 5 ? BA N N 4 ? CA N N 2 ? DA N N 2 ? EA N N 2 ? FA N N 5 ? GA N N 4 ? HA N N 2 ? IA N N 2 ? JA N N 2 ? KA N N 2 ? LA N N 3 ? MA N N 4 ? NA N N 2 ? OA N N 2 ? PA N N 2 ? QA N N 4 ? RA N N 2 ? SA N N 2 ? TA N N 2 ? UA N N 2 ? VA N N 2 ? WA N N 5 ? XA N N 4 ? YA N N 2 ? ZA N N 2 ? AB N N 2 ? BB N N 2 ? CB N N 2 ? DB N N 5 ? EB N N 4 ? FB N N 2 ? GB N N 2 ? HB N N 2 ? IB N N 2 ? JB N N 4 ? KB N N 6 ? LB N N 6 ? MB N N 6 ? NB N N 6 ? OB N N 6 ? PB N N 6 ? QB N N 6 ? RB N N 6 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q9X0L2_THEMA _struct_ref.pdbx_db_accession Q9X0L2 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MMVISEKVRKALNDQLNREIYSSYLYLSMATYFDAEGFKGFAHWMKKQAQEELTHAMKFYEYIYERGGRVELEAIEKPPS NWNGIKDAFEAALKHEEFVTQSIYNILELASEEKDHATVSFLKWFVDEQVEEEDQVREILDLLEKANGQMSVIFQLDRYL GQRE ; _struct_ref.pdbx_align_begin 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 6TXJ A 1 ? 164 ? Q9X0L2 1 ? 164 ? 1 164 2 1 6TXJ B 1 ? 164 ? Q9X0L2 1 ? 164 ? 1 164 3 1 6TXJ C 1 ? 164 ? Q9X0L2 1 ? 164 ? 1 164 4 1 6TXJ D 1 ? 164 ? Q9X0L2 1 ? 164 ? 1 164 5 1 6TXJ E 1 ? 164 ? Q9X0L2 1 ? 164 ? 1 164 6 1 6TXJ F 1 ? 164 ? Q9X0L2 1 ? 164 ? 1 164 7 1 6TXJ G 1 ? 164 ? Q9X0L2 1 ? 164 ? 1 164 8 1 6TXJ H 1 ? 164 ? Q9X0L2 1 ? 164 ? 1 164 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6TXJ VAL A 42 ? UNP Q9X0L2 ALA 42 'engineered mutation' 42 1 1 6TXJ ASP A 65 ? UNP Q9X0L2 GLU 65 'engineered mutation' 65 2 2 6TXJ VAL B 42 ? UNP Q9X0L2 ALA 42 'engineered mutation' 42 3 2 6TXJ ASP B 65 ? UNP Q9X0L2 GLU 65 'engineered mutation' 65 4 3 6TXJ VAL C 42 ? UNP Q9X0L2 ALA 42 'engineered mutation' 42 5 3 6TXJ ASP C 65 ? UNP Q9X0L2 GLU 65 'engineered mutation' 65 6 4 6TXJ VAL D 42 ? UNP Q9X0L2 ALA 42 'engineered mutation' 42 7 4 6TXJ ASP D 65 ? UNP Q9X0L2 GLU 65 'engineered mutation' 65 8 5 6TXJ VAL E 42 ? UNP Q9X0L2 ALA 42 'engineered mutation' 42 9 5 6TXJ ASP E 65 ? UNP Q9X0L2 GLU 65 'engineered mutation' 65 10 6 6TXJ VAL F 42 ? UNP Q9X0L2 ALA 42 'engineered mutation' 42 11 6 6TXJ ASP F 65 ? UNP Q9X0L2 GLU 65 'engineered mutation' 65 12 7 6TXJ VAL G 42 ? UNP Q9X0L2 ALA 42 'engineered mutation' 42 13 7 6TXJ ASP G 65 ? UNP Q9X0L2 GLU 65 'engineered mutation' 65 14 8 6TXJ VAL H 42 ? UNP Q9X0L2 ALA 42 'engineered mutation' 42 15 8 6TXJ ASP H 65 ? UNP Q9X0L2 GLU 65 'engineered mutation' 65 16 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details 24-meric _pdbx_struct_assembly.oligomeric_count 24 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 90210 ? 1 MORE -602 ? 1 'SSA (A^2)' 144640 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3 _pdbx_struct_assembly_gen.asym_id_list ;A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U,V,W,X,Y,Z,AA,BA,CA,DA,EA,FA,GA,HA,IA,JA,KA,LA,MA,NA,OA,PA,QA,RA,SA,TA,UA,VA,WA,XA,YA,ZA,AB,BB,CB,DB,EB,FB,GB,HB,IB,JB,KB,LB,MB,NB,OB,PB,QB,RB ; # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details 'We confirm the cage structure by Native Page, AUC, MALS, DLS and gel filtration.' # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_665 -y+1,x-y+1,z -0.5000000000 -0.8660254038 0.0000000000 88.1015000000 0.8660254038 -0.5000000000 0.0000000000 152.5962742230 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_565 -x+y,-x+1,z -0.5000000000 0.8660254038 0.0000000000 -88.1015000000 -0.8660254038 -0.5000000000 0.0000000000 152.5962742230 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 5 ? GLY A 37 ? SER A 5 GLY A 37 1 ? 33 HELX_P HELX_P2 AA2 PHE A 38 ? ARG A 66 ? PHE A 38 ARG A 66 1 ? 29 HELX_P HELX_P3 AA3 GLY A 84 ? GLU A 113 ? GLY A 84 GLU A 113 1 ? 30 HELX_P HELX_P4 AA4 ASP A 115 ? ASN A 147 ? ASP A 115 ASN A 147 1 ? 33 HELX_P HELX_P5 AA5 GLN A 149 ? GLN A 162 ? GLN A 149 GLN A 162 1 ? 14 HELX_P HELX_P6 AA6 SER B 5 ? GLY B 37 ? SER B 5 GLY B 37 1 ? 33 HELX_P HELX_P7 AA7 PHE B 38 ? ARG B 66 ? PHE B 38 ARG B 66 1 ? 29 HELX_P HELX_P8 AA8 GLY B 84 ? GLU B 113 ? GLY B 84 GLU B 113 1 ? 30 HELX_P HELX_P9 AA9 ASP B 115 ? ASN B 147 ? ASP B 115 ASN B 147 1 ? 33 HELX_P HELX_P10 AB1 GLN B 149 ? GLY B 161 ? GLN B 149 GLY B 161 1 ? 13 HELX_P HELX_P11 AB2 SER C 5 ? GLY C 37 ? SER C 5 GLY C 37 1 ? 33 HELX_P HELX_P12 AB3 PHE C 38 ? ARG C 66 ? PHE C 38 ARG C 66 1 ? 29 HELX_P HELX_P13 AB4 GLY C 84 ? GLU C 113 ? GLY C 84 GLU C 113 1 ? 30 HELX_P HELX_P14 AB5 ASP C 115 ? ASN C 147 ? ASP C 115 ASN C 147 1 ? 33 HELX_P HELX_P15 AB6 GLN C 149 ? GLY C 161 ? GLN C 149 GLY C 161 1 ? 13 HELX_P HELX_P16 AB7 SER D 5 ? GLU D 36 ? SER D 5 GLU D 36 1 ? 32 HELX_P HELX_P17 AB8 PHE D 38 ? ARG D 66 ? PHE D 38 ARG D 66 1 ? 29 HELX_P HELX_P18 AB9 GLY D 84 ? GLU D 113 ? GLY D 84 GLU D 113 1 ? 30 HELX_P HELX_P19 AC1 ASP D 115 ? ASN D 147 ? ASP D 115 ASN D 147 1 ? 33 HELX_P HELX_P20 AC2 GLN D 149 ? GLN D 162 ? GLN D 149 GLN D 162 1 ? 14 HELX_P HELX_P21 AC3 SER E 5 ? GLY E 37 ? SER E 5 GLY E 37 1 ? 33 HELX_P HELX_P22 AC4 PHE E 38 ? ARG E 66 ? PHE E 38 ARG E 66 1 ? 29 HELX_P HELX_P23 AC5 GLY E 84 ? GLU E 113 ? GLY E 84 GLU E 113 1 ? 30 HELX_P HELX_P24 AC6 ASP E 115 ? ASN E 147 ? ASP E 115 ASN E 147 1 ? 33 HELX_P HELX_P25 AC7 GLN E 149 ? GLY E 161 ? GLN E 149 GLY E 161 1 ? 13 HELX_P HELX_P26 AC8 SER F 5 ? GLY F 37 ? SER F 5 GLY F 37 1 ? 33 HELX_P HELX_P27 AC9 PHE F 38 ? ARG F 66 ? PHE F 38 ARG F 66 1 ? 29 HELX_P HELX_P28 AD1 GLY F 84 ? GLU F 113 ? GLY F 84 GLU F 113 1 ? 30 HELX_P HELX_P29 AD2 ASP F 115 ? ASN F 147 ? ASP F 115 ASN F 147 1 ? 33 HELX_P HELX_P30 AD3 GLN F 149 ? GLY F 161 ? GLN F 149 GLY F 161 1 ? 13 HELX_P HELX_P31 AD4 SER G 5 ? GLY G 37 ? SER G 5 GLY G 37 1 ? 33 HELX_P HELX_P32 AD5 PHE G 38 ? ARG G 66 ? PHE G 38 ARG G 66 1 ? 29 HELX_P HELX_P33 AD6 GLY G 84 ? GLU G 113 ? GLY G 84 GLU G 113 1 ? 30 HELX_P HELX_P34 AD7 ASP G 115 ? ASN G 147 ? ASP G 115 ASN G 147 1 ? 33 HELX_P HELX_P35 AD8 GLN G 149 ? GLN G 162 ? GLN G 149 GLN G 162 1 ? 14 HELX_P HELX_P36 AD9 SER H 5 ? GLY H 37 ? SER H 5 GLY H 37 1 ? 33 HELX_P HELX_P37 AE1 PHE H 38 ? ARG H 66 ? PHE H 38 ARG H 66 1 ? 29 HELX_P HELX_P38 AE2 GLY H 84 ? GLU H 113 ? GLY H 84 GLU H 113 1 ? 30 HELX_P HELX_P39 AE3 ASP H 115 ? LEU H 122 ? ASP H 115 LEU H 122 1 ? 8 HELX_P HELX_P40 AE4 LEU H 122 ? ASN H 147 ? LEU H 122 ASN H 147 1 ? 26 HELX_P HELX_P41 AE5 GLN H 149 ? GLY H 161 ? GLN H 149 GLY H 161 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale none ? C GLN 50 NE2 ? ? ? 1_555 FA LFA . C20 ? ? C GLN 50 C LFA 204 1_555 ? ? ? ? ? ? ? 1.433 ? ? metalc1 metalc ? ? A GLU 52 OE1 ? ? ? 1_555 P FE . FE ? ? A GLU 52 A FE 208 1_555 ? ? ? ? ? ? ? 1.869 ? ? metalc2 metalc ? ? A HIS 55 ND1 ? ? ? 1_555 P FE . FE ? ? A HIS 55 A FE 208 1_555 ? ? ? ? ? ? ? 2.116 ? ? metalc3 metalc ? ? P FE . FE ? ? ? 1_555 KB HOH . O ? ? A FE 208 A HOH 304 1_555 ? ? ? ? ? ? ? 2.260 ? ? metalc4 metalc ? ? B GLU 19 OE1 ? ? ? 1_555 BA FE . FE ? ? B GLU 19 B FE 212 1_555 ? ? ? ? ? ? ? 2.274 ? ? metalc5 metalc ? ? B GLU 52 OE2 ? ? ? 1_555 BA FE . FE ? ? B GLU 52 B FE 212 1_555 ? ? ? ? ? ? ? 2.019 ? ? metalc6 metalc ? ? B HIS 55 ND1 ? ? ? 1_555 BA FE . FE ? ? B HIS 55 B FE 212 1_555 ? ? ? ? ? ? ? 2.244 ? ? metalc7 metalc ? ? BA FE . FE ? ? ? 1_555 LB HOH . O ? ? B FE 212 B HOH 306 1_555 ? ? ? ? ? ? ? 2.535 ? ? metalc8 metalc ? ? BA FE . FE ? ? ? 1_555 LB HOH . O ? ? B FE 212 B HOH 312 1_555 ? ? ? ? ? ? ? 2.458 ? ? metalc9 metalc ? ? BA FE . FE ? ? ? 1_555 LB HOH . O ? ? B FE 212 B HOH 319 1_555 ? ? ? ? ? ? ? 2.244 ? ? metalc10 metalc ? ? C GLU 19 OE1 ? ? ? 1_555 GA FE . FE ? ? C GLU 19 C FE 205 1_555 ? ? ? ? ? ? ? 2.451 ? ? metalc11 metalc ? ? C GLU 52 OE1 ? ? ? 1_555 GA FE . FE ? ? C GLU 52 C FE 205 1_555 ? ? ? ? ? ? ? 1.964 ? ? metalc12 metalc ? ? C HIS 55 ND1 ? ? ? 1_555 GA FE . FE ? ? C HIS 55 C FE 205 1_555 ? ? ? ? ? ? ? 2.480 ? ? metalc13 metalc ? ? GA FE . FE ? ? ? 1_555 MB HOH . O ? ? C FE 205 C HOH 302 1_555 ? ? ? ? ? ? ? 2.257 ? ? metalc14 metalc ? ? D GLU 19 OE1 ? ? ? 1_555 MA FE . FE ? ? D GLU 19 D FE 206 1_555 ? ? ? ? ? ? ? 2.248 ? ? metalc15 metalc ? ? D GLU 52 OE1 ? ? ? 1_555 MA FE . FE ? ? D GLU 52 D FE 206 1_555 ? ? ? ? ? ? ? 1.980 ? ? metalc16 metalc ? ? D HIS 55 ND1 ? ? ? 1_555 MA FE . FE ? ? D HIS 55 D FE 206 1_555 ? ? ? ? ? ? ? 2.252 ? ? metalc17 metalc ? ? MA FE . FE ? ? ? 1_555 NB HOH . O ? ? D FE 206 D HOH 301 1_555 ? ? ? ? ? ? ? 2.592 ? ? metalc18 metalc ? ? E GLU 19 OE1 ? ? ? 1_555 QA FE . FE ? ? E GLU 19 E FE 204 1_555 ? ? ? ? ? ? ? 2.102 ? ? metalc19 metalc ? ? E GLU 52 OE1 ? ? ? 1_555 QA FE . FE ? ? E GLU 52 E FE 204 1_555 ? ? ? ? ? ? ? 1.712 ? ? metalc20 metalc ? ? E HIS 55 ND1 ? ? ? 1_555 QA FE . FE ? ? E HIS 55 E FE 204 1_555 ? ? ? ? ? ? ? 2.215 ? ? metalc21 metalc ? ? QA FE . FE ? ? ? 1_555 OB HOH . O ? ? E FE 204 E HOH 301 1_555 ? ? ? ? ? ? ? 1.807 ? ? metalc22 metalc ? ? QA FE . FE ? ? ? 1_555 OB HOH . O ? ? E FE 204 E HOH 308 1_555 ? ? ? ? ? ? ? 1.933 ? ? metalc23 metalc ? ? F GLU 19 OE1 ? ? ? 1_555 XA FE . FE ? ? F GLU 19 F FE 207 1_555 ? ? ? ? ? ? ? 2.270 ? ? metalc24 metalc ? ? F GLU 52 OE1 ? ? ? 1_555 XA FE . FE ? ? F GLU 52 F FE 207 1_555 ? ? ? ? ? ? ? 1.969 ? ? metalc25 metalc ? ? F HIS 55 ND1 ? ? ? 1_555 XA FE . FE ? ? F HIS 55 F FE 207 1_555 ? ? ? ? ? ? ? 2.244 ? ? metalc26 metalc ? ? G GLU 19 OE1 ? ? ? 1_555 EB FE . FE ? ? G GLU 19 G FE 207 1_555 ? ? ? ? ? ? ? 1.984 ? ? metalc27 metalc ? ? G GLU 52 OE1 ? ? ? 1_555 EB FE . FE ? ? G GLU 52 G FE 207 1_555 ? ? ? ? ? ? ? 1.854 ? ? metalc28 metalc ? ? G HIS 55 ND1 ? ? ? 1_555 EB FE . FE ? ? G HIS 55 G FE 207 1_555 ? ? ? ? ? ? ? 2.191 ? ? metalc29 metalc ? ? EB FE . FE ? ? ? 1_555 QB HOH . O ? ? G FE 207 G HOH 301 1_555 ? ? ? ? ? ? ? 2.041 ? ? metalc30 metalc ? ? H GLU 19 OE1 ? ? ? 1_555 JB FE . FE ? ? H GLU 19 H FE 205 1_555 ? ? ? ? ? ? ? 2.069 ? ? metalc31 metalc ? ? H GLU 52 OE1 ? ? ? 1_555 JB FE . FE ? ? H GLU 52 H FE 205 1_555 ? ? ? ? ? ? ? 2.076 ? ? metalc32 metalc ? ? H HIS 55 ND1 ? ? ? 1_555 JB FE . FE ? ? H HIS 55 H FE 205 1_555 ? ? ? ? ? ? ? 2.165 ? ? metalc33 metalc ? ? JB FE . FE ? ? ? 1_555 RB HOH . O ? ? H FE 205 H HOH 301 1_555 ? ? ? ? ? ? ? 2.151 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OE1 ? A GLU 52 ? A GLU 52 ? 1_555 FE ? P FE . ? A FE 208 ? 1_555 ND1 ? A HIS 55 ? A HIS 55 ? 1_555 98.2 ? 2 OE1 ? A GLU 52 ? A GLU 52 ? 1_555 FE ? P FE . ? A FE 208 ? 1_555 O ? KB HOH . ? A HOH 304 ? 1_555 91.6 ? 3 ND1 ? A HIS 55 ? A HIS 55 ? 1_555 FE ? P FE . ? A FE 208 ? 1_555 O ? KB HOH . ? A HOH 304 ? 1_555 108.3 ? 4 OE1 ? B GLU 19 ? B GLU 19 ? 1_555 FE ? BA FE . ? B FE 212 ? 1_555 OE2 ? B GLU 52 ? B GLU 52 ? 1_555 92.4 ? 5 OE1 ? B GLU 19 ? B GLU 19 ? 1_555 FE ? BA FE . ? B FE 212 ? 1_555 ND1 ? B HIS 55 ? B HIS 55 ? 1_555 101.7 ? 6 OE2 ? B GLU 52 ? B GLU 52 ? 1_555 FE ? BA FE . ? B FE 212 ? 1_555 ND1 ? B HIS 55 ? B HIS 55 ? 1_555 88.0 ? 7 OE1 ? B GLU 19 ? B GLU 19 ? 1_555 FE ? BA FE . ? B FE 212 ? 1_555 O ? LB HOH . ? B HOH 306 ? 1_555 157.6 ? 8 OE2 ? B GLU 52 ? B GLU 52 ? 1_555 FE ? BA FE . ? B FE 212 ? 1_555 O ? LB HOH . ? B HOH 306 ? 1_555 83.0 ? 9 ND1 ? B HIS 55 ? B HIS 55 ? 1_555 FE ? BA FE . ? B FE 212 ? 1_555 O ? LB HOH . ? B HOH 306 ? 1_555 100.0 ? 10 OE1 ? B GLU 19 ? B GLU 19 ? 1_555 FE ? BA FE . ? B FE 212 ? 1_555 O ? LB HOH . ? B HOH 312 ? 1_555 86.2 ? 11 OE2 ? B GLU 52 ? B GLU 52 ? 1_555 FE ? BA FE . ? B FE 212 ? 1_555 O ? LB HOH . ? B HOH 312 ? 1_555 70.0 ? 12 ND1 ? B HIS 55 ? B HIS 55 ? 1_555 FE ? BA FE . ? B FE 212 ? 1_555 O ? LB HOH . ? B HOH 312 ? 1_555 157.0 ? 13 O ? LB HOH . ? B HOH 306 ? 1_555 FE ? BA FE . ? B FE 212 ? 1_555 O ? LB HOH . ? B HOH 312 ? 1_555 71.7 ? 14 OE1 ? B GLU 19 ? B GLU 19 ? 1_555 FE ? BA FE . ? B FE 212 ? 1_555 O ? LB HOH . ? B HOH 319 ? 1_555 91.6 ? 15 OE2 ? B GLU 52 ? B GLU 52 ? 1_555 FE ? BA FE . ? B FE 212 ? 1_555 O ? LB HOH . ? B HOH 319 ? 1_555 175.8 ? 16 ND1 ? B HIS 55 ? B HIS 55 ? 1_555 FE ? BA FE . ? B FE 212 ? 1_555 O ? LB HOH . ? B HOH 319 ? 1_555 92.2 ? 17 O ? LB HOH . ? B HOH 306 ? 1_555 FE ? BA FE . ? B FE 212 ? 1_555 O ? LB HOH . ? B HOH 319 ? 1_555 92.9 ? 18 O ? LB HOH . ? B HOH 312 ? 1_555 FE ? BA FE . ? B FE 212 ? 1_555 O ? LB HOH . ? B HOH 319 ? 1_555 109.3 ? 19 OE1 ? C GLU 19 ? C GLU 19 ? 1_555 FE ? GA FE . ? C FE 205 ? 1_555 OE1 ? C GLU 52 ? C GLU 52 ? 1_555 78.6 ? 20 OE1 ? C GLU 19 ? C GLU 19 ? 1_555 FE ? GA FE . ? C FE 205 ? 1_555 ND1 ? C HIS 55 ? C HIS 55 ? 1_555 96.4 ? 21 OE1 ? C GLU 52 ? C GLU 52 ? 1_555 FE ? GA FE . ? C FE 205 ? 1_555 ND1 ? C HIS 55 ? C HIS 55 ? 1_555 101.4 ? 22 OE1 ? C GLU 19 ? C GLU 19 ? 1_555 FE ? GA FE . ? C FE 205 ? 1_555 O ? MB HOH . ? C HOH 302 ? 1_555 79.0 ? 23 OE1 ? C GLU 52 ? C GLU 52 ? 1_555 FE ? GA FE . ? C FE 205 ? 1_555 O ? MB HOH . ? C HOH 302 ? 1_555 157.3 ? 24 ND1 ? C HIS 55 ? C HIS 55 ? 1_555 FE ? GA FE . ? C FE 205 ? 1_555 O ? MB HOH . ? C HOH 302 ? 1_555 77.6 ? 25 OE1 ? D GLU 19 ? D GLU 19 ? 1_555 FE ? MA FE . ? D FE 206 ? 1_555 OE1 ? D GLU 52 ? D GLU 52 ? 1_555 76.8 ? 26 OE1 ? D GLU 19 ? D GLU 19 ? 1_555 FE ? MA FE . ? D FE 206 ? 1_555 ND1 ? D HIS 55 ? D HIS 55 ? 1_555 98.4 ? 27 OE1 ? D GLU 52 ? D GLU 52 ? 1_555 FE ? MA FE . ? D FE 206 ? 1_555 ND1 ? D HIS 55 ? D HIS 55 ? 1_555 86.6 ? 28 OE1 ? D GLU 19 ? D GLU 19 ? 1_555 FE ? MA FE . ? D FE 206 ? 1_555 O ? NB HOH . ? D HOH 301 ? 1_555 157.0 ? 29 OE1 ? D GLU 52 ? D GLU 52 ? 1_555 FE ? MA FE . ? D FE 206 ? 1_555 O ? NB HOH . ? D HOH 301 ? 1_555 88.5 ? 30 ND1 ? D HIS 55 ? D HIS 55 ? 1_555 FE ? MA FE . ? D FE 206 ? 1_555 O ? NB HOH . ? D HOH 301 ? 1_555 98.3 ? 31 OE1 ? E GLU 19 ? E GLU 19 ? 1_555 FE ? QA FE . ? E FE 204 ? 1_555 OE1 ? E GLU 52 ? E GLU 52 ? 1_555 91.2 ? 32 OE1 ? E GLU 19 ? E GLU 19 ? 1_555 FE ? QA FE . ? E FE 204 ? 1_555 ND1 ? E HIS 55 ? E HIS 55 ? 1_555 111.1 ? 33 OE1 ? E GLU 52 ? E GLU 52 ? 1_555 FE ? QA FE . ? E FE 204 ? 1_555 ND1 ? E HIS 55 ? E HIS 55 ? 1_555 110.4 ? 34 OE1 ? E GLU 19 ? E GLU 19 ? 1_555 FE ? QA FE . ? E FE 204 ? 1_555 O ? OB HOH . ? E HOH 301 ? 1_555 82.4 ? 35 OE1 ? E GLU 52 ? E GLU 52 ? 1_555 FE ? QA FE . ? E FE 204 ? 1_555 O ? OB HOH . ? E HOH 301 ? 1_555 172.6 ? 36 ND1 ? E HIS 55 ? E HIS 55 ? 1_555 FE ? QA FE . ? E FE 204 ? 1_555 O ? OB HOH . ? E HOH 301 ? 1_555 75.6 ? 37 OE1 ? E GLU 19 ? E GLU 19 ? 1_555 FE ? QA FE . ? E FE 204 ? 1_555 O ? OB HOH . ? E HOH 308 ? 1_555 139.6 ? 38 OE1 ? E GLU 52 ? E GLU 52 ? 1_555 FE ? QA FE . ? E FE 204 ? 1_555 O ? OB HOH . ? E HOH 308 ? 1_555 112.2 ? 39 ND1 ? E HIS 55 ? E HIS 55 ? 1_555 FE ? QA FE . ? E FE 204 ? 1_555 O ? OB HOH . ? E HOH 308 ? 1_555 91.8 ? 40 O ? OB HOH . ? E HOH 301 ? 1_555 FE ? QA FE . ? E FE 204 ? 1_555 O ? OB HOH . ? E HOH 308 ? 1_555 71.2 ? 41 OE1 ? F GLU 19 ? F GLU 19 ? 1_555 FE ? XA FE . ? F FE 207 ? 1_555 OE1 ? F GLU 52 ? F GLU 52 ? 1_555 73.5 ? 42 OE1 ? F GLU 19 ? F GLU 19 ? 1_555 FE ? XA FE . ? F FE 207 ? 1_555 ND1 ? F HIS 55 ? F HIS 55 ? 1_555 103.2 ? 43 OE1 ? F GLU 52 ? F GLU 52 ? 1_555 FE ? XA FE . ? F FE 207 ? 1_555 ND1 ? F HIS 55 ? F HIS 55 ? 1_555 86.9 ? 44 OE1 ? G GLU 19 ? G GLU 19 ? 1_555 FE ? EB FE . ? G FE 207 ? 1_555 OE1 ? G GLU 52 ? G GLU 52 ? 1_555 83.7 ? 45 OE1 ? G GLU 19 ? G GLU 19 ? 1_555 FE ? EB FE . ? G FE 207 ? 1_555 ND1 ? G HIS 55 ? G HIS 55 ? 1_555 107.5 ? 46 OE1 ? G GLU 52 ? G GLU 52 ? 1_555 FE ? EB FE . ? G FE 207 ? 1_555 ND1 ? G HIS 55 ? G HIS 55 ? 1_555 100.6 ? 47 OE1 ? G GLU 19 ? G GLU 19 ? 1_555 FE ? EB FE . ? G FE 207 ? 1_555 O ? QB HOH . ? G HOH 301 ? 1_555 145.4 ? 48 OE1 ? G GLU 52 ? G GLU 52 ? 1_555 FE ? EB FE . ? G FE 207 ? 1_555 O ? QB HOH . ? G HOH 301 ? 1_555 96.8 ? 49 ND1 ? G HIS 55 ? G HIS 55 ? 1_555 FE ? EB FE . ? G FE 207 ? 1_555 O ? QB HOH . ? G HOH 301 ? 1_555 106.4 ? 50 OE1 ? H GLU 19 ? H GLU 19 ? 1_555 FE ? JB FE . ? H FE 205 ? 1_555 OE1 ? H GLU 52 ? H GLU 52 ? 1_555 78.0 ? 51 OE1 ? H GLU 19 ? H GLU 19 ? 1_555 FE ? JB FE . ? H FE 205 ? 1_555 ND1 ? H HIS 55 ? H HIS 55 ? 1_555 114.6 ? 52 OE1 ? H GLU 52 ? H GLU 52 ? 1_555 FE ? JB FE . ? H FE 205 ? 1_555 ND1 ? H HIS 55 ? H HIS 55 ? 1_555 95.3 ? 53 OE1 ? H GLU 19 ? H GLU 19 ? 1_555 FE ? JB FE . ? H FE 205 ? 1_555 O ? RB HOH . ? H HOH 301 ? 1_555 143.8 ? 54 OE1 ? H GLU 52 ? H GLU 52 ? 1_555 FE ? JB FE . ? H FE 205 ? 1_555 O ? RB HOH . ? H HOH 301 ? 1_555 81.6 ? 55 ND1 ? H HIS 55 ? H HIS 55 ? 1_555 FE ? JB FE . ? H FE 205 ? 1_555 O ? RB HOH . ? H HOH 301 ? 1_555 96.7 ? # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A SO4 201 ? 2 'binding site for residue SO4 A 201' AC2 Software A GOL 202 ? 2 'binding site for residue GOL A 202' AC3 Software A SO4 203 ? 3 'binding site for residue SO4 A 203' AC4 Software A SO4 204 ? 3 'binding site for residue SO4 A 204' AC5 Software A SO4 205 ? 2 'binding site for residue SO4 A 205' AC6 Software A SO4 206 ? 5 'binding site for residue SO4 A 206' AC7 Software A GOL 207 ? 2 'binding site for residue GOL A 207' AC8 Software A FE 208 ? 4 'binding site for residue FE A 208' AC9 Software B SO4 201 ? 4 'binding site for residue SO4 B 201' AD1 Software B SO4 202 ? 9 'binding site for residue SO4 B 202' AD2 Software B SO4 203 ? 4 'binding site for residue SO4 B 203' AD3 Software B SO4 204 ? 2 'binding site for residue SO4 B 204' AD4 Software B SO4 205 ? 4 'binding site for residue SO4 B 205' AD5 Software B SO4 206 ? 4 'binding site for residue SO4 B 206' AD6 Software B GOL 207 ? 4 'binding site for residue GOL B 207' AD7 Software B GOL 208 ? 4 'binding site for residue GOL B 208' AD8 Software B GOL 209 ? 6 'binding site for residue GOL B 209' AD9 Software B GOL 210 ? 2 'binding site for residue GOL B 210' AE1 Software B LFA 211 ? 6 'binding site for residue LFA B 211' AE2 Software B FE 212 ? 6 'binding site for residue FE B 212' AE3 Software C SO4 201 ? 2 'binding site for residue SO4 C 201' AE4 Software C SO4 202 ? 4 'binding site for residue SO4 C 202' AE5 Software C SO4 203 ? 2 'binding site for residue SO4 C 203' AE6 Software C FE 205 ? 4 'binding site for residue FE C 205' AE7 Software D SO4 201 ? 3 'binding site for residue SO4 D 201' AE8 Software D SO4 202 ? 3 'binding site for residue SO4 D 202' AE9 Software D SO4 203 ? 2 'binding site for residue SO4 D 203' AF1 Software D SO4 204 ? 3 'binding site for residue SO4 D 204' AF2 Software D GOL 205 ? 1 'binding site for residue GOL D 205' AF3 Software D FE 206 ? 4 'binding site for residue FE D 206' AF4 Software E SO4 201 ? 2 'binding site for residue SO4 E 201' AF5 Software E SO4 202 ? 5 'binding site for residue SO4 E 202' AF6 Software E SO4 203 ? 2 'binding site for residue SO4 E 203' AF7 Software E FE 204 ? 5 'binding site for residue FE E 204' AF8 Software F SO4 201 ? 5 'binding site for residue SO4 F 201' AF9 Software F SO4 202 ? 4 'binding site for residue SO4 F 202' AG1 Software F SO4 203 ? 2 'binding site for residue SO4 F 203' AG2 Software F SO4 204 ? 3 'binding site for residue SO4 F 204' AG3 Software F SO4 205 ? 8 'binding site for residue SO4 F 205' AG4 Software F LFA 206 ? 5 'binding site for residue LFA F 206' AG5 Software F FE 207 ? 4 'binding site for residue FE F 207' AG6 Software G SO4 201 ? 3 'binding site for residue SO4 G 201' AG7 Software G SO4 202 ? 4 'binding site for residue SO4 G 202' AG8 Software G SO4 203 ? 2 'binding site for residue SO4 G 203' AG9 Software G SO4 204 ? 3 'binding site for residue SO4 G 204' AH1 Software G SO4 205 ? 3 'binding site for residue SO4 G 205' AH2 Software G LFA 206 ? 4 'binding site for residue LFA G 206' AH3 Software G FE 207 ? 4 'binding site for residue FE G 207' AH4 Software H SO4 201 ? 3 'binding site for residue SO4 H 201' AH5 Software H SO4 202 ? 1 'binding site for residue SO4 H 202' AH6 Software H SO4 203 ? 3 'binding site for residue SO4 H 203' AH7 Software H SO4 204 ? 2 'binding site for residue SO4 H 204' AH8 Software H FE 205 ? 4 'binding site for residue FE H 205' AH9 Software C LFA 204 ? 11 'binding site for Di-peptide LFA C 204 and GLN C 50' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 2 HIS A 43 ? HIS A 43 . ? 1_555 ? 2 AC1 2 LYS A 46 ? LYS A 46 . ? 1_555 ? 3 AC2 2 ARG A 18 ? ARG A 18 . ? 1_555 ? 4 AC2 2 HOH KB . ? HOH A 312 . ? 1_555 ? 5 AC3 3 SER A 111 ? SER A 111 . ? 1_555 ? 6 AC3 3 HIS A 116 ? HIS A 116 . ? 1_555 ? 7 AC3 3 VAL A 119 ? VAL A 119 . ? 1_555 ? 8 AC4 3 PRO A 79 ? PRO A 79 . ? 1_555 ? 9 AC4 3 SER A 80 ? SER A 80 . ? 1_555 ? 10 AC4 3 ASN A 81 ? ASN A 81 . ? 1_555 ? 11 AC5 2 TRP A 44 ? TRP A 44 . ? 1_555 ? 12 AC5 2 GLN A 135 ? GLN A 135 . ? 1_555 ? 13 AC6 5 GLU A 97 ? GLU A 97 . ? 1_555 ? 14 AC6 5 THR A 100 ? THR A 100 . ? 1_555 ? 15 AC6 5 GLU A 133 ? GLU A 133 . ? 1_555 ? 16 AC6 5 VAL F 3 ? VAL F 3 . ? 3_565 ? 17 AC6 5 ARG F 66 ? ARG F 66 . ? 3_565 ? 18 AC7 2 PHE A 154 ? PHE A 154 . ? 1_555 ? 19 AC7 2 ASP A 157 ? ASP A 157 . ? 1_555 ? 20 AC8 4 GLU A 19 ? GLU A 19 . ? 1_555 ? 21 AC8 4 GLU A 52 ? GLU A 52 . ? 1_555 ? 22 AC8 4 HIS A 55 ? HIS A 55 . ? 1_555 ? 23 AC8 4 HOH KB . ? HOH A 304 . ? 1_555 ? 24 AC9 4 GLY B 84 ? GLY B 84 . ? 1_555 ? 25 AC9 4 ILE B 85 ? ILE B 85 . ? 1_555 ? 26 AC9 4 LYS B 86 ? LYS B 86 . ? 1_555 ? 27 AC9 4 HOH LB . ? HOH B 303 . ? 1_555 ? 28 AD1 9 GLN A 149 ? GLN A 149 . ? 2_665 ? 29 AD1 9 SER A 151 ? SER A 151 . ? 2_665 ? 30 AD1 9 GLN B 149 ? GLN B 149 . ? 1_555 ? 31 AD1 9 SER B 151 ? SER B 151 . ? 1_555 ? 32 AD1 9 GLN D 149 ? GLN D 149 . ? 1_555 ? 33 AD1 9 SER D 151 ? SER D 151 . ? 1_555 ? 34 AD1 9 ASN E 147 ? ASN E 147 . ? 18_655 ? 35 AD1 9 GLN E 149 ? GLN E 149 . ? 1_555 ? 36 AD1 9 SER E 151 ? SER E 151 . ? 1_555 ? 37 AD2 4 SER B 111 ? SER B 111 . ? 1_555 ? 38 AD2 4 HIS B 116 ? HIS B 116 . ? 1_555 ? 39 AD2 4 VAL B 119 ? VAL B 119 . ? 1_555 ? 40 AD2 4 HOH LB . ? HOH B 317 . ? 1_555 ? 41 AD3 2 HIS B 43 ? HIS B 43 . ? 1_555 ? 42 AD3 2 LYS B 46 ? LYS B 46 . ? 1_555 ? 43 AD4 4 PRO B 79 ? PRO B 79 . ? 1_555 ? 44 AD4 4 SER B 80 ? SER B 80 . ? 1_555 ? 45 AD4 4 ASN B 81 ? ASN B 81 . ? 1_555 ? 46 AD4 4 HOH LB . ? HOH B 301 . ? 1_555 ? 47 AD5 4 VAL B 3 ? VAL B 3 . ? 2_665 ? 48 AD5 4 ARG B 66 ? ARG B 66 . ? 2_665 ? 49 AD5 4 GLU B 97 ? GLU B 97 . ? 1_555 ? 50 AD5 4 GLU B 133 ? GLU B 133 . ? 1_555 ? 51 AD6 4 SER B 5 ? SER B 5 . ? 1_555 ? 52 AD6 4 GLU B 6 ? GLU B 6 . ? 1_555 ? 53 AD6 4 LYS B 7 ? LYS B 7 . ? 1_555 ? 54 AD6 4 HOH LB . ? HOH B 322 . ? 1_555 ? 55 AD7 4 ARG B 18 ? ARG B 18 . ? 1_555 ? 56 AD7 4 PHE B 98 ? PHE B 98 . ? 1_555 ? 57 AD7 4 HOH LB . ? HOH B 305 . ? 1_555 ? 58 AD7 4 HOH LB . ? HOH B 314 . ? 1_555 ? 59 AD8 6 TRP B 44 ? TRP B 44 . ? 1_555 ? 60 AD8 6 GLN B 135 ? GLN B 135 . ? 1_555 ? 61 AD8 6 GLU B 138 ? GLU B 138 . ? 1_555 ? 62 AD8 6 ILE B 139 ? ILE B 139 . ? 1_555 ? 63 AD8 6 TYR B 159 ? TYR B 159 . ? 1_555 ? 64 AD8 6 LEU B 160 ? LEU B 160 . ? 1_555 ? 65 AD9 2 ASP B 157 ? ASP B 157 . ? 1_555 ? 66 AD9 2 TYR D 159 ? TYR D 159 . ? 1_555 ? 67 AE1 6 ILE A 20 ? ILE A 20 . ? 1_555 ? 68 AE1 6 SER A 23 ? SER A 23 . ? 1_555 ? 69 AE1 6 GLN A 50 ? GLN A 50 . ? 1_555 ? 70 AE1 6 MET A 57 ? MET A 57 . ? 1_555 ? 71 AE1 6 SER B 23 ? SER B 23 . ? 1_555 ? 72 AE1 6 GLN B 50 ? GLN B 50 . ? 1_555 ? 73 AE2 6 GLU B 19 ? GLU B 19 . ? 1_555 ? 74 AE2 6 GLU B 52 ? GLU B 52 . ? 1_555 ? 75 AE2 6 HIS B 55 ? HIS B 55 . ? 1_555 ? 76 AE2 6 HOH LB . ? HOH B 306 . ? 1_555 ? 77 AE2 6 HOH LB . ? HOH B 312 . ? 1_555 ? 78 AE2 6 HOH LB . ? HOH B 319 . ? 1_555 ? 79 AE3 2 ARG C 18 ? ARG C 18 . ? 1_555 ? 80 AE3 2 PHE C 98 ? PHE C 98 . ? 1_555 ? 81 AE4 4 SER C 111 ? SER C 111 . ? 1_555 ? 82 AE4 4 HIS C 116 ? HIS C 116 . ? 1_555 ? 83 AE4 4 VAL C 119 ? VAL C 119 . ? 1_555 ? 84 AE4 4 HOH OB . ? HOH E 306 . ? 1_555 ? 85 AE5 2 HIS C 43 ? HIS C 43 . ? 1_555 ? 86 AE5 2 LYS C 46 ? LYS C 46 . ? 1_555 ? 87 AE6 4 GLU C 19 ? GLU C 19 . ? 1_555 ? 88 AE6 4 GLU C 52 ? GLU C 52 . ? 1_555 ? 89 AE6 4 HIS C 55 ? HIS C 55 . ? 1_555 ? 90 AE6 4 HOH MB . ? HOH C 302 . ? 1_555 ? 91 AE7 3 GLY D 84 ? GLY D 84 . ? 1_555 ? 92 AE7 3 ILE D 85 ? ILE D 85 . ? 1_555 ? 93 AE7 3 LYS D 86 ? LYS D 86 . ? 1_555 ? 94 AE8 3 SER D 111 ? SER D 111 . ? 1_555 ? 95 AE8 3 HIS D 116 ? HIS D 116 . ? 1_555 ? 96 AE8 3 VAL D 119 ? VAL D 119 . ? 1_555 ? 97 AE9 2 HIS D 43 ? HIS D 43 . ? 1_555 ? 98 AE9 2 LYS D 46 ? LYS D 46 . ? 1_555 ? 99 AF1 3 PRO D 79 ? PRO D 79 . ? 1_555 ? 100 AF1 3 SER D 80 ? SER D 80 . ? 1_555 ? 101 AF1 3 ASN D 81 ? ASN D 81 . ? 1_555 ? 102 AF2 1 ARG D 18 ? ARG D 18 . ? 1_555 ? 103 AF3 4 GLU D 19 ? GLU D 19 . ? 1_555 ? 104 AF3 4 GLU D 52 ? GLU D 52 . ? 1_555 ? 105 AF3 4 HIS D 55 ? HIS D 55 . ? 1_555 ? 106 AF3 4 HOH NB . ? HOH D 301 . ? 1_555 ? 107 AF4 2 ARG E 18 ? ARG E 18 . ? 1_555 ? 108 AF4 2 PHE E 98 ? PHE E 98 . ? 1_555 ? 109 AF5 5 SER E 111 ? SER E 111 . ? 1_555 ? 110 AF5 5 HIS E 116 ? HIS E 116 . ? 1_555 ? 111 AF5 5 VAL E 119 ? VAL E 119 . ? 1_555 ? 112 AF5 5 HOH OB . ? HOH E 306 . ? 1_555 ? 113 AF5 5 SO4 ZA . ? SO4 G 202 . ? 1_555 ? 114 AF6 2 HIS E 43 ? HIS E 43 . ? 1_555 ? 115 AF6 2 HOH OB . ? HOH E 309 . ? 1_555 ? 116 AF7 5 GLU E 19 ? GLU E 19 . ? 1_555 ? 117 AF7 5 GLU E 52 ? GLU E 52 . ? 1_555 ? 118 AF7 5 HIS E 55 ? HIS E 55 . ? 1_555 ? 119 AF7 5 HOH OB . ? HOH E 301 . ? 1_555 ? 120 AF7 5 HOH OB . ? HOH E 308 . ? 1_555 ? 121 AF8 5 ASN F 83 ? ASN F 83 . ? 1_555 ? 122 AF8 5 GLY F 84 ? GLY F 84 . ? 1_555 ? 123 AF8 5 ILE F 85 ? ILE F 85 . ? 1_555 ? 124 AF8 5 LYS F 86 ? LYS F 86 . ? 1_555 ? 125 AF8 5 ASN G 147 ? ASN G 147 . ? 5_676 ? 126 AF9 4 SER F 111 ? SER F 111 . ? 1_555 ? 127 AF9 4 HIS F 116 ? HIS F 116 . ? 1_555 ? 128 AF9 4 VAL F 119 ? VAL F 119 . ? 1_555 ? 129 AF9 4 HOH PB . ? HOH F 302 . ? 1_555 ? 130 AG1 2 HIS F 43 ? HIS F 43 . ? 1_555 ? 131 AG1 2 LYS F 46 ? LYS F 46 . ? 1_555 ? 132 AG2 3 PRO F 79 ? PRO F 79 . ? 1_555 ? 133 AG2 3 SER F 80 ? SER F 80 . ? 1_555 ? 134 AG2 3 ASN F 81 ? ASN F 81 . ? 1_555 ? 135 AG3 8 GLN C 149 ? GLN C 149 . ? 2_665 ? 136 AG3 8 SER C 151 ? SER C 151 . ? 2_665 ? 137 AG3 8 GLN F 149 ? GLN F 149 . ? 1_555 ? 138 AG3 8 SER F 151 ? SER F 151 . ? 1_555 ? 139 AG3 8 GLN G 149 ? GLN G 149 . ? 1_555 ? 140 AG3 8 SER G 151 ? SER G 151 . ? 1_555 ? 141 AG3 8 GLN H 149 ? GLN H 149 . ? 2_665 ? 142 AG3 8 SER H 151 ? SER H 151 . ? 2_665 ? 143 AG4 5 SER E 23 ? SER E 23 . ? 1_555 ? 144 AG4 5 SER F 23 ? SER F 23 . ? 1_555 ? 145 AG4 5 TYR F 24 ? TYR F 24 . ? 1_555 ? 146 AG4 5 GLN F 50 ? GLN F 50 . ? 1_555 ? 147 AG4 5 MET F 57 ? MET F 57 . ? 1_555 ? 148 AG5 4 GLU F 19 ? GLU F 19 . ? 1_555 ? 149 AG5 4 GLU F 52 ? GLU F 52 . ? 1_555 ? 150 AG5 4 HIS F 55 ? HIS F 55 . ? 1_555 ? 151 AG5 4 GLN F 129 ? GLN F 129 . ? 1_555 ? 152 AG6 3 GLY G 84 ? GLY G 84 . ? 1_555 ? 153 AG6 3 ILE G 85 ? ILE G 85 . ? 1_555 ? 154 AG6 3 LYS G 86 ? LYS G 86 . ? 1_555 ? 155 AG7 4 SO4 OA . ? SO4 E 202 . ? 1_555 ? 156 AG7 4 SER G 111 ? SER G 111 . ? 1_555 ? 157 AG7 4 HIS G 116 ? HIS G 116 . ? 1_555 ? 158 AG7 4 VAL G 119 ? VAL G 119 . ? 1_555 ? 159 AG8 2 HIS G 43 ? HIS G 43 . ? 1_555 ? 160 AG8 2 LYS G 46 ? LYS G 46 . ? 1_555 ? 161 AG9 3 PRO G 79 ? PRO G 79 . ? 1_555 ? 162 AG9 3 SER G 80 ? SER G 80 . ? 1_555 ? 163 AG9 3 ASN G 81 ? ASN G 81 . ? 1_555 ? 164 AH1 3 TRP G 44 ? TRP G 44 . ? 1_555 ? 165 AH1 3 GLN G 135 ? GLN G 135 . ? 1_555 ? 166 AH1 3 LEU G 160 ? LEU G 160 . ? 1_555 ? 167 AH2 4 SER G 23 ? SER G 23 . ? 1_555 ? 168 AH2 4 TYR G 24 ? TYR G 24 . ? 1_555 ? 169 AH2 4 SER H 23 ? SER H 23 . ? 1_555 ? 170 AH2 4 GLN H 50 ? GLN H 50 . ? 1_555 ? 171 AH3 4 GLU G 19 ? GLU G 19 . ? 1_555 ? 172 AH3 4 GLU G 52 ? GLU G 52 . ? 1_555 ? 173 AH3 4 HIS G 55 ? HIS G 55 . ? 1_555 ? 174 AH3 4 HOH QB . ? HOH G 301 . ? 1_555 ? 175 AH4 3 GLY H 84 ? GLY H 84 . ? 1_555 ? 176 AH4 3 ILE H 85 ? ILE H 85 . ? 1_555 ? 177 AH4 3 LYS H 86 ? LYS H 86 . ? 1_555 ? 178 AH5 1 HIS H 43 ? HIS H 43 . ? 1_555 ? 179 AH6 3 PRO H 79 ? PRO H 79 . ? 1_555 ? 180 AH6 3 SER H 80 ? SER H 80 . ? 1_555 ? 181 AH6 3 ASN H 81 ? ASN H 81 . ? 1_555 ? 182 AH7 2 SER H 5 ? SER H 5 . ? 1_555 ? 183 AH7 2 GLU H 6 ? GLU H 6 . ? 1_555 ? 184 AH8 4 GLU H 19 ? GLU H 19 . ? 1_555 ? 185 AH8 4 GLU H 52 ? GLU H 52 . ? 1_555 ? 186 AH8 4 HIS H 55 ? HIS H 55 . ? 1_555 ? 187 AH8 4 HOH RB . ? HOH H 301 . ? 1_555 ? 188 AH9 11 SER C 23 ? SER C 23 . ? 1_555 ? 189 AH9 11 LYS C 46 ? LYS C 46 . ? 1_555 ? 190 AH9 11 LYS C 47 ? LYS C 47 . ? 1_555 ? 191 AH9 11 GLN C 48 ? GLN C 48 . ? 1_555 ? 192 AH9 11 ALA C 49 ? ALA C 49 . ? 1_555 ? 193 AH9 11 GLU C 51 ? GLU C 51 . ? 1_555 ? 194 AH9 11 GLU C 52 ? GLU C 52 . ? 1_555 ? 195 AH9 11 LEU C 53 ? LEU C 53 . ? 1_555 ? 196 AH9 11 THR C 54 ? THR C 54 . ? 1_555 ? 197 AH9 11 SER D 23 ? SER D 23 . ? 1_555 ? 198 AH9 11 GLN D 50 ? GLN D 50 . ? 1_555 ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OE2 A GLU 19 ? ? FE A FE 208 ? ? 1.69 2 1 NH2 H ARG 18 ? ? CB H SER 102 ? ? 1.75 3 1 OE2 G GLU 96 ? ? O G HOH 301 ? ? 2.05 4 1 OH G TYR 26 ? ? OE1 G GLU 96 ? ? 2.07 5 1 O2 B SO4 205 ? ? O B HOH 301 ? ? 2.16 6 1 O E HOH 301 ? ? O E HOH 308 ? ? 2.18 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CA C GLU 76 ? ? CB C GLU 76 ? ? CG C GLU 76 ? ? 133.94 113.40 20.54 2.20 N 2 1 CA C LEU 156 ? ? CB C LEU 156 ? ? CG C LEU 156 ? ? 131.97 115.30 16.67 2.30 N 3 1 CB C LEU 156 ? ? CG C LEU 156 ? ? CD1 C LEU 156 ? ? 95.46 111.00 -15.54 1.70 N 4 1 CA F LYS 7 ? ? CB F LYS 7 ? ? CG F LYS 7 ? ? 130.45 113.40 17.05 2.20 N 5 1 CB F LYS 7 ? ? CG F LYS 7 ? ? CD F LYS 7 ? ? 93.32 111.60 -18.28 2.60 N 6 1 CD G LYS 10 ? ? CE G LYS 10 ? ? NZ G LYS 10 ? ? 132.71 111.70 21.01 2.30 N 7 1 CA G LYS 114 ? ? CB G LYS 114 ? ? CG G LYS 114 ? ? 129.82 113.40 16.42 2.20 N 8 1 CB G LYS 114 ? ? CG G LYS 114 ? ? CD G LYS 114 ? ? 94.33 111.60 -17.27 2.60 N 9 1 CD H LYS 86 ? ? CE H LYS 86 ? ? NZ H LYS 86 ? ? 125.86 111.70 14.16 2.30 N # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id ASN _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 83 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -90.66 _pdbx_validate_torsion.psi 48.32 # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined 27.7359 76.3867 108.0766 0.6737 ? 0.0750 ? 0.0186 ? 0.5799 ? 0.0498 ? 0.6908 ? 0.2814 ? -0.6621 ? 0.1808 ? 1.0914 ? -0.0079 ? 0.5227 ? 0.0401 ? 0.1025 ? 0.0623 ? 0.0319 ? -0.0478 ? 0.0549 ? 0.3293 ? 0.1702 ? 0.0003 ? 2 'X-RAY DIFFRACTION' ? refined 25.1707 80.3718 112.3557 0.7364 ? 0.0590 ? 0.0113 ? 0.6936 ? 0.0076 ? 0.7381 ? 0.4682 ? 1.1026 ? 0.7651 ? 0.6825 ? 0.0811 ? -0.0819 ? 0.1459 ? -0.1738 ? -0.2557 ? 0.2145 ? -0.0658 ? -0.0865 ? 0.2604 ? 0.0888 ? 0.0001 ? 3 'X-RAY DIFFRACTION' ? refined 20.8912 67.5144 115.6340 0.8399 ? 0.0546 ? -0.0044 ? 0.5876 ? 0.0635 ? 0.6847 ? 1.2156 ? 0.0993 ? 0.4306 ? 0.3067 ? -0.0964 ? 0.2000 ? 0.0474 ? -0.1335 ? -0.0993 ? 0.1524 ? -0.0510 ? 0.0306 ? 0.4311 ? 0.0728 ? 0.0001 ? 4 'X-RAY DIFFRACTION' ? refined 19.5739 87.9327 98.5071 0.5959 ? 0.0414 ? -0.0061 ? 0.5866 ? 0.0203 ? 0.7369 ? 0.1168 ? -0.2766 ? 0.2241 ? 0.2363 ? -0.6437 ? 0.9854 ? 0.1449 ? 0.0255 ? 0.0614 ? 0.0873 ? -0.0934 ? -0.0305 ? 0.2376 ? 0.1326 ? -0.0007 ? 5 'X-RAY DIFFRACTION' ? refined 16.7743 88.6655 104.5140 0.6030 ? 0.0027 ? 0.0345 ? 0.5698 ? -0.0142 ? 0.6758 ? 0.0905 ? 0.3723 ? -0.1399 ? 0.8989 ? -0.3608 ? -0.2049 ? -0.0592 ? -0.0535 ? -0.0102 ? 0.0370 ? 0.0466 ? 0.1240 ? 0.0466 ? 0.0510 ? -0.0005 ? 6 'X-RAY DIFFRACTION' ? refined 34.9806 91.9881 99.2388 0.6046 ? 0.0043 ? 0.0324 ? 0.7862 ? 0.0051 ? 0.7391 ? 0.0156 ? 0.0014 ? -0.0779 ? 0.1003 ? -0.0023 ? 0.2409 ? -0.2341 ? -0.5390 ? 0.4581 ? -0.6157 ? 0.2017 ? -0.0695 ? 0.8307 ? 0.8069 ? -0.0006 ? 7 'X-RAY DIFFRACTION' ? refined 16.6908 100.4692 96.9796 0.4514 ? -0.0080 ? -0.0168 ? 0.5244 ? 0.0187 ? 0.6386 ? 0.8996 ? 0.2345 ? 0.6364 ? 0.0564 ? 0.0346 ? 1.1533 ? -0.1153 ? -0.1457 ? -0.0795 ? -0.2454 ? -0.0051 ? -0.0929 ? -0.1014 ? 0.0851 ? -0.0000 ? 8 'X-RAY DIFFRACTION' ? refined 31.6136 107.6272 114.2206 0.6134 ? -0.0531 ? -0.0448 ? 0.7931 ? 0.0030 ? 0.8552 ? 0.3894 ? -0.2966 ? 0.3961 ? 0.4458 ? -0.0521 ? 0.6920 ? 0.0609 ? -0.0473 ? 0.0587 ? 0.3720 ? -0.0517 ? 0.2863 ? -0.0792 ? 0.0646 ? 0.0035 ? 9 'X-RAY DIFFRACTION' ? refined 53.3627 99.3613 152.9995 0.7131 ? 0.0306 ? -0.1026 ? 1.1454 ? 0.0377 ? 0.8073 ? 0.4238 ? 0.0690 ? 0.0678 ? 0.1565 ? 0.2539 ? 0.2914 ? -0.1429 ? -0.2760 ? -0.2510 ? 0.1990 ? 0.0840 ? -0.5957 ? 0.0331 ? 0.5023 ? -0.0002 ? 10 'X-RAY DIFFRACTION' ? refined 47.2656 99.5108 151.4032 0.6145 ? 0.0239 ? -0.1054 ? 1.0839 ? 0.0300 ? 0.8591 ? -0.4135 ? 0.2509 ? 0.0970 ? 0.3579 ? 0.2864 ? 0.9797 ? 0.0998 ? -0.0893 ? 0.0748 ? 0.0146 ? -0.0835 ? 0.3646 ? -0.1000 ? 0.3265 ? 0.0007 ? 11 'X-RAY DIFFRACTION' ? refined 46.9372 97.1230 164.8128 0.7017 ? 0.0376 ? -0.1074 ? 1.1404 ? -0.0112 ? 0.7641 ? -0.1886 ? 0.2199 ? 0.0536 ? 1.9476 ? -0.2502 ? 0.6296 ? -0.0084 ? -0.1956 ? 0.1046 ? 0.1795 ? 0.0476 ? 0.1650 ? 0.0025 ? 0.3869 ? 0.0003 ? 12 'X-RAY DIFFRACTION' ? refined 51.8601 88.1011 140.1623 0.6759 ? 0.1905 ? -0.0446 ? 1.0284 ? 0.0944 ? 0.7787 ? -0.2975 ? 0.1395 ? 0.3246 ? 0.2633 ? 0.1383 ? -0.0932 ? -0.0732 ? -0.2179 ? 0.1301 ? -0.2774 ? 0.0554 ? 0.2492 ? 0.1378 ? 0.5972 ? -0.0002 ? 13 'X-RAY DIFFRACTION' ? refined 45.7956 89.1701 142.0274 0.6729 ? 0.1282 ? -0.0438 ? 0.9195 ? 0.0875 ? 0.8740 ? -0.3473 ? 1.0093 ? 0.1751 ? 0.7248 ? -0.4037 ? 1.3872 ? 0.1711 ? -0.1889 ? -0.0050 ? -0.0960 ? -0.1684 ? 0.0576 ? 0.2996 ? 0.2489 ? -0.0010 ? 14 'X-RAY DIFFRACTION' ? refined 52.6548 86.7476 130.9278 0.7397 ? 0.1062 ? -0.0823 ? 1.0161 ? 0.0718 ? 0.8854 ? 0.3240 ? 0.0735 ? -0.3667 ? 0.0810 ? 0.2366 ? -0.0600 ? -0.0817 ? -0.0276 ? -0.1690 ? -0.1784 ? 0.1843 ? -0.3498 ? 0.1617 ? 0.4492 ? -0.0003 ? 15 'X-RAY DIFFRACTION' ? refined 42.9317 87.5074 127.5691 0.6689 ? 0.0648 ? -0.1173 ? 0.9167 ? 0.0339 ? 0.7907 ? 0.7160 ? -0.7544 ? -0.4986 ? 0.6726 ? 0.4579 ? 0.2484 ? 0.0263 ? -0.0787 ? 0.0463 ? -0.1851 ? 0.2764 ? 0.6825 ? 0.1982 ? 0.1453 ? 0.0001 ? 16 'X-RAY DIFFRACTION' ? refined 40.7270 108.1903 125.2137 0.6891 ? -0.0781 ? -0.1053 ? 0.8817 ? 0.0817 ? 0.8557 ? 0.2992 ? -0.0525 ? 0.1769 ? 0.8954 ? 0.7191 ? 0.5771 ? 0.0415 ? 0.3197 ? -0.1145 ? 0.0848 ? 0.4336 ? 0.0512 ? -0.1309 ? -0.7822 ? 0.0043 ? 17 'X-RAY DIFFRACTION' ? refined 39.5328 138.1895 150.5221 0.7934 ? -0.2402 ? -0.0737 ? 0.9306 ? -0.0461 ? 0.7786 ? -0.1648 ? -0.2683 ? 0.1485 ? 0.2741 ? -0.6236 ? 0.4073 ? -0.0598 ? 0.0714 ? 0.0532 ? 0.1215 ? -0.1143 ? -0.0739 ? -0.4214 ? 0.5120 ? -0.0007 ? 18 'X-RAY DIFFRACTION' ? refined 33.6464 131.6872 148.4237 0.8132 ? -0.2278 ? -0.0927 ? 0.9209 ? -0.0039 ? 0.7563 ? -0.6619 ? 0.0607 ? 0.2089 ? -0.4648 ? 0.0714 ? 0.2751 ? -0.0100 ? -0.0062 ? 0.1329 ? 0.0836 ? 0.2314 ? 0.0007 ? 0.0898 ? 0.1288 ? -0.0018 ? 19 'X-RAY DIFFRACTION' ? refined 36.8734 144.8628 157.0997 0.9343 ? -0.3019 ? -0.0966 ? 1.1637 ? -0.1978 ? 0.8942 ? 0.0821 ? -0.1320 ? 0.0499 ? 0.0439 ? -0.0155 ? 0.0763 ? 0.2947 ? -0.6525 ? -0.0410 ? -0.2132 ? 0.6132 ? -0.3411 ? 1.3016 ? 2.0401 ? 0.0013 ? 20 'X-RAY DIFFRACTION' ? refined 47.3137 133.0066 147.7868 0.6991 ? -0.2609 ? -0.0812 ? 0.9245 ? -0.0378 ? 0.7453 ? 0.7255 ? -0.5941 ? -0.2220 ? 0.0684 ? -0.0635 ? 0.0618 ? 0.0274 ? -0.0860 ? 0.2136 ? -0.0839 ? -0.0578 ? -0.1439 ? -0.0727 ? 0.4102 ? 0.0004 ? 21 'X-RAY DIFFRACTION' ? refined 43.7423 123.3557 147.6312 0.7471 ? -0.1813 ? -0.0859 ? 0.9582 ? 0.0281 ? 0.7710 ? 0.5582 ? 0.3340 ? 0.4212 ? 0.3309 ? -0.1531 ? 0.5752 ? -0.0336 ? -0.1045 ? -0.0920 ? 0.1500 ? -0.1220 ? -0.0997 ? -0.1325 ? -0.1400 ? -0.0053 ? 22 'X-RAY DIFFRACTION' ? refined 36.6649 122.2847 128.0097 0.7627 ? -0.2458 ? 0.0065 ? 0.8950 ? -0.0466 ? 0.7163 ? 0.3872 ? -0.2823 ? 0.2638 ? 0.4817 ? -0.1210 ? 0.2376 ? -0.3881 ? 0.9803 ? -0.5734 ? -0.0062 ? -0.0328 ? -0.2735 ? 0.5678 ? -0.9329 ? -0.0001 ? 23 'X-RAY DIFFRACTION' ? refined 27.3023 148.1605 120.9314 1.0519 ? -0.2381 ? -0.2398 ? 0.8098 ? -0.0633 ? 0.9138 ? 0.0290 ? 0.0612 ? -0.0300 ? 0.6748 ? 0.1356 ? 0.0692 ? 0.3540 ? 0.3386 ? -0.8046 ? -0.2301 ? 0.0807 ? 1.1911 ? -1.0863 ? -0.0512 ? -0.0007 ? 24 'X-RAY DIFFRACTION' ? refined 24.2279 148.2464 145.2329 0.9289 ? -0.2559 ? -0.0780 ? 0.7172 ? -0.1050 ? 0.7961 ? 1.1162 ? -0.4214 ? 0.3313 ? -0.3884 ? -0.2292 ? 0.3262 ? -0.0388 ? -0.0038 ? 0.1729 ? 0.1669 ? -0.0147 ? -0.1207 ? -0.4229 ? 0.2677 ? 0.0001 ? 25 'X-RAY DIFFRACTION' ? refined 12.0935 149.3087 146.2484 0.9916 ? -0.1066 ? -0.0635 ? 0.7953 ? -0.0826 ? 0.8085 ? -0.1917 ? -0.4085 ? 0.1821 ? 0.2071 ? -0.2765 ? 0.2904 ? -0.1996 ? 0.1007 ? 0.1252 ? 0.0876 ? 0.0381 ? -0.0293 ? 0.0776 ? -0.3933 ? -0.0002 ? 26 'X-RAY DIFFRACTION' ? refined 12.1181 141.8648 165.5296 1.2100 ? -0.0851 ? -0.0130 ? 1.0241 ? -0.1400 ? 0.8834 ? 0.7853 ? 0.3397 ? 0.1754 ? 0.4348 ? -0.3285 ? 0.8833 ? -0.3371 ? 0.0310 ? 0.2320 ? 0.3709 ? -0.1122 ? 0.9366 ? -0.3042 ? 0.0241 ? -0.0660 ? 27 'X-RAY DIFFRACTION' ? refined 30.8534 116.8686 182.9235 0.9145 ? -0.0969 ? -0.1238 ? 1.0550 ? -0.0323 ? 0.6546 ? 0.0522 ? 0.1454 ? -0.4820 ? 0.5370 ? 0.2830 ? 0.1465 ? 0.1378 ? -0.1304 ? -0.0109 ? -0.1138 ? -0.0814 ? 0.1162 ? -0.2402 ? 0.3434 ? 0.0003 ? 28 'X-RAY DIFFRACTION' ? refined 37.5339 121.4796 183.8671 0.8043 ? -0.1114 ? -0.1698 ? 1.0180 ? -0.1084 ? 0.6733 ? -0.2039 ? 0.1189 ? 0.3419 ? 0.5814 ? -1.0433 ? 1.2428 ? 0.1231 ? -0.1169 ? 0.0844 ? 0.2438 ? -0.1881 ? -0.0579 ? -0.2077 ? 0.4600 ? -0.0001 ? 29 'X-RAY DIFFRACTION' ? refined 32.6240 126.6177 173.4520 0.9017 ? -0.1263 ? -0.0212 ? 1.0568 ? -0.0469 ? 0.7359 ? 0.3404 ? -0.1330 ? 0.2851 ? 0.1811 ? 0.7000 ? 0.3996 ? 0.2235 ? -0.6537 ? -0.0819 ? -0.4557 ? 0.1496 ? 0.1380 ? -0.2096 ? 0.5201 ? 0.0033 ? 30 'X-RAY DIFFRACTION' ? refined 13.4776 133.1102 177.5655 0.9385 ? -0.0283 ? -0.0685 ? 0.9102 ? -0.0677 ? 0.7389 ? 0.7992 ? 0.1834 ? -0.1899 ? 0.2038 ? -0.2080 ? 0.1959 ? 0.2925 ? 0.1587 ? 0.1436 ? -0.6492 ? -0.0655 ? -0.6062 ? -0.3269 ? 0.1938 ? 0.0061 ? 31 'X-RAY DIFFRACTION' ? refined 22.6977 108.8113 195.5355 0.9358 ? 0.0422 ? -0.1038 ? 1.0964 ? -0.0152 ? 0.5944 ? 0.3915 ? 0.5820 ? -0.3012 ? 0.5302 ? -0.3951 ? 0.3999 ? -0.0647 ? -0.5109 ? 0.0614 ? 0.2941 ? 0.1319 ? -0.1123 ? 0.1663 ? 0.4166 ? -0.0001 ? 32 'X-RAY DIFFRACTION' ? refined 20.4879 105.5268 187.0574 0.7681 ? 0.0462 ? -0.1010 ? 0.9340 ? -0.0518 ? 0.6011 ? 0.2079 ? 0.2305 ? -0.3207 ? 0.3812 ? -0.4237 ? 0.8253 ? 0.2310 ? 0.2815 ? -0.3739 ? -0.1942 ? -0.4280 ? 0.3301 ? -0.1843 ? -0.1661 ? -0.0013 ? 33 'X-RAY DIFFRACTION' ? refined 20.5399 97.8881 193.7933 0.9196 ? 0.0343 ? -0.0750 ? 1.0088 ? 0.0250 ? 0.6688 ? -0.0537 ? 0.1974 ? 0.3121 ? 0.9612 ? -0.4174 ? 0.6318 ? -0.0803 ? -0.2208 ? -0.0396 ? 0.1319 ? -0.0020 ? -0.0856 ? 0.0785 ? 0.1434 ? 0.0005 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? A 2 ? ? ? A 36 ? ? ;chain 'A' and (resid 2 through 36 ) ; 2 'X-RAY DIFFRACTION' 2 ? ? A 37 ? ? ? A 76 ? ? ;chain 'A' and (resid 37 through 76 ) ; 3 'X-RAY DIFFRACTION' 3 ? ? A 77 ? ? ? A 164 ? ? ;chain 'A' and (resid 77 through 164 ) ; 4 'X-RAY DIFFRACTION' 4 ? ? B 1 ? ? ? B 36 ? ? ;chain 'B' and (resid 1 through 36 ) ; 5 'X-RAY DIFFRACTION' 5 ? ? B 37 ? ? ? B 75 ? ? ;chain 'B' and (resid 37 through 75 ) ; 6 'X-RAY DIFFRACTION' 6 ? ? B 76 ? ? ? B 84 ? ? ;chain 'B' and (resid 76 through 84 ) ; 7 'X-RAY DIFFRACTION' 7 ? ? B 85 ? ? ? B 146 ? ? ;chain 'B' and (resid 85 through 146 ) ; 8 'X-RAY DIFFRACTION' 8 ? ? B 147 ? ? ? B 164 ? ? ;chain 'B' and (resid 147 through 164 ) ; 9 'X-RAY DIFFRACTION' 9 ? ? C 1 ? ? ? C 36 ? ? ;chain 'C' and (resid 1 through 36 ) ; 10 'X-RAY DIFFRACTION' 10 ? ? C 37 ? ? ? C 76 ? ? ;chain 'C' and (resid 37 through 76 ) ; 11 'X-RAY DIFFRACTION' 11 ? ? C 77 ? ? ? C 164 ? ? ;chain 'C' and (resid 77 through 164 ) ; 12 'X-RAY DIFFRACTION' 12 ? ? D 2 ? ? ? D 36 ? ? ;chain 'D' and (resid 2 through 36 ) ; 13 'X-RAY DIFFRACTION' 13 ? ? D 37 ? ? ? D 76 ? ? ;chain 'D' and (resid 37 through 76 ) ; 14 'X-RAY DIFFRACTION' 14 ? ? D 77 ? ? ? D 115 ? ? ;chain 'D' and (resid 77 through 115 ) ; 15 'X-RAY DIFFRACTION' 15 ? ? D 116 ? ? ? D 146 ? ? ;chain 'D' and (resid 116 through 146 ) ; 16 'X-RAY DIFFRACTION' 16 ? ? D 147 ? ? ? D 164 ? ? ;chain 'D' and (resid 147 through 164 ) ; 17 'X-RAY DIFFRACTION' 17 ? ? E 1 ? ? ? E 36 ? ? ;chain 'E' and (resid 1 through 36 ) ; 18 'X-RAY DIFFRACTION' 18 ? ? E 37 ? ? ? E 66 ? ? ;chain 'E' and (resid 37 through 66 ) ; 19 'X-RAY DIFFRACTION' 19 ? ? E 67 ? ? ? E 76 ? ? ;chain 'E' and (resid 67 through 76 ) ; 20 'X-RAY DIFFRACTION' 20 ? ? E 77 ? ? ? E 115 ? ? ;chain 'E' and (resid 77 through 115 ) ; 21 'X-RAY DIFFRACTION' 21 ? ? E 116 ? ? ? E 146 ? ? ;chain 'E' and (resid 116 through 146 ) ; 22 'X-RAY DIFFRACTION' 22 ? ? E 147 ? ? ? E 164 ? ? ;chain 'E' and (resid 147 through 164 ) ; 23 'X-RAY DIFFRACTION' 23 ? ? F 1 ? ? ? F 5 ? ? ;chain 'F' and (resid 1 through 5 ) ; 24 'X-RAY DIFFRACTION' 24 ? ? F 6 ? ? ? F 115 ? ? ;chain 'F' and (resid 6 through 115 ) ; 25 'X-RAY DIFFRACTION' 25 ? ? F 116 ? ? ? F 146 ? ? ;chain 'F' and (resid 116 through 146 ) ; 26 'X-RAY DIFFRACTION' 26 ? ? F 147 ? ? ? F 164 ? ? ;chain 'F' and (resid 147 through 164 ) ; 27 'X-RAY DIFFRACTION' 27 ? ? G 2 ? ? ? G 65 ? ? ;chain 'G' and (resid 2 through 65 ) ; 28 'X-RAY DIFFRACTION' 28 ? ? G 66 ? ? ? G 115 ? ? ;chain 'G' and (resid 66 through 115 ) ; 29 'X-RAY DIFFRACTION' 29 ? ? G 116 ? ? ? G 146 ? ? ;chain 'G' and (resid 116 through 146 ) ; 30 'X-RAY DIFFRACTION' 30 ? ? G 147 ? ? ? G 164 ? ? ;chain 'G' and (resid 147 through 164 ) ; 31 'X-RAY DIFFRACTION' 31 ? ? H 1 ? ? ? H 36 ? ? ;chain 'H' and (resid 1 through 36 ) ; 32 'X-RAY DIFFRACTION' 32 ? ? H 37 ? ? ? H 65 ? ? ;chain 'H' and (resid 37 through 65 ) ; 33 'X-RAY DIFFRACTION' 33 ? ? H 66 ? ? ? H 164 ? ? ;chain 'H' and (resid 66 through 164 ) ; # _pdbx_phasing_MR.entry_id 6TXJ _pdbx_phasing_MR.method_rotation ? _pdbx_phasing_MR.method_translation ? _pdbx_phasing_MR.model_details ? _pdbx_phasing_MR.R_factor ? _pdbx_phasing_MR.R_rigid_body ? _pdbx_phasing_MR.correlation_coeff_Fo_to_Fc ? _pdbx_phasing_MR.correlation_coeff_Io_to_Ic ? _pdbx_phasing_MR.d_res_high_rotation 7.590 _pdbx_phasing_MR.d_res_low_rotation 48.270 _pdbx_phasing_MR.d_res_high_translation 7.590 _pdbx_phasing_MR.d_res_low_translation 48.270 _pdbx_phasing_MR.packing ? _pdbx_phasing_MR.reflns_percent_rotation ? _pdbx_phasing_MR.reflns_percent_translation ? _pdbx_phasing_MR.sigma_F_rotation ? _pdbx_phasing_MR.sigma_F_translation ? _pdbx_phasing_MR.sigma_I_rotation ? _pdbx_phasing_MR.sigma_I_translation ? # _phasing.method MR # _pdbx_entry_details.entry_id 6TXJ _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest N # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 D MET 1 ? D MET 1 3 1 Y 1 G MET 1 ? G MET 1 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 FE FE FE N N 74 GLN N N N N 75 GLN CA C N S 76 GLN C C N N 77 GLN O O N N 78 GLN CB C N N 79 GLN CG C N N 80 GLN CD C N N 81 GLN OE1 O N N 82 GLN NE2 N N N 83 GLN OXT O N N 84 GLN H H N N 85 GLN H2 H N N 86 GLN HA H N N 87 GLN HB2 H N N 88 GLN HB3 H N N 89 GLN HG2 H N N 90 GLN HG3 H N N 91 GLN HE21 H N N 92 GLN HE22 H N N 93 GLN HXT H N N 94 GLU N N N N 95 GLU CA C N S 96 GLU C C N N 97 GLU O O N N 98 GLU CB C N N 99 GLU CG C N N 100 GLU CD C N N 101 GLU OE1 O N N 102 GLU OE2 O N N 103 GLU OXT O N N 104 GLU H H N N 105 GLU H2 H N N 106 GLU HA H N N 107 GLU HB2 H N N 108 GLU HB3 H N N 109 GLU HG2 H N N 110 GLU HG3 H N N 111 GLU HE2 H N N 112 GLU HXT H N N 113 GLY N N N N 114 GLY CA C N N 115 GLY C C N N 116 GLY O O N N 117 GLY OXT O N N 118 GLY H H N N 119 GLY H2 H N N 120 GLY HA2 H N N 121 GLY HA3 H N N 122 GLY HXT H N N 123 GOL C1 C N N 124 GOL O1 O N N 125 GOL C2 C N N 126 GOL O2 O N N 127 GOL C3 C N N 128 GOL O3 O N N 129 GOL H11 H N N 130 GOL H12 H N N 131 GOL HO1 H N N 132 GOL H2 H N N 133 GOL HO2 H N N 134 GOL H31 H N N 135 GOL H32 H N N 136 GOL HO3 H N N 137 HIS N N N N 138 HIS CA C N S 139 HIS C C N N 140 HIS O O N N 141 HIS CB C N N 142 HIS CG C Y N 143 HIS ND1 N Y N 144 HIS CD2 C Y N 145 HIS CE1 C Y N 146 HIS NE2 N Y N 147 HIS OXT O N N 148 HIS H H N N 149 HIS H2 H N N 150 HIS HA H N N 151 HIS HB2 H N N 152 HIS HB3 H N N 153 HIS HD1 H N N 154 HIS HD2 H N N 155 HIS HE1 H N N 156 HIS HE2 H N N 157 HIS HXT H N N 158 HOH O O N N 159 HOH H1 H N N 160 HOH H2 H N N 161 ILE N N N N 162 ILE CA C N S 163 ILE C C N N 164 ILE O O N N 165 ILE CB C N S 166 ILE CG1 C N N 167 ILE CG2 C N N 168 ILE CD1 C N N 169 ILE OXT O N N 170 ILE H H N N 171 ILE H2 H N N 172 ILE HA H N N 173 ILE HB H N N 174 ILE HG12 H N N 175 ILE HG13 H N N 176 ILE HG21 H N N 177 ILE HG22 H N N 178 ILE HG23 H N N 179 ILE HD11 H N N 180 ILE HD12 H N N 181 ILE HD13 H N N 182 ILE HXT H N N 183 LEU N N N N 184 LEU CA C N S 185 LEU C C N N 186 LEU O O N N 187 LEU CB C N N 188 LEU CG C N N 189 LEU CD1 C N N 190 LEU CD2 C N N 191 LEU OXT O N N 192 LEU H H N N 193 LEU H2 H N N 194 LEU HA H N N 195 LEU HB2 H N N 196 LEU HB3 H N N 197 LEU HG H N N 198 LEU HD11 H N N 199 LEU HD12 H N N 200 LEU HD13 H N N 201 LEU HD21 H N N 202 LEU HD22 H N N 203 LEU HD23 H N N 204 LEU HXT H N N 205 LFA C1 C N N 206 LFA C2 C N N 207 LFA C3 C N N 208 LFA C4 C N N 209 LFA C5 C N N 210 LFA C6 C N N 211 LFA C7 C N N 212 LFA C8 C N N 213 LFA C9 C N N 214 LFA C10 C N N 215 LFA C11 C N N 216 LFA C12 C N N 217 LFA C13 C N N 218 LFA C14 C N N 219 LFA C15 C N N 220 LFA C16 C N N 221 LFA C17 C N N 222 LFA C18 C N N 223 LFA C19 C N N 224 LFA C20 C N N 225 LFA H11 H N N 226 LFA H12 H N N 227 LFA H13 H N N 228 LFA H21 H N N 229 LFA H22 H N N 230 LFA H31 H N N 231 LFA H32 H N N 232 LFA H41 H N N 233 LFA H42 H N N 234 LFA H51 H N N 235 LFA H52 H N N 236 LFA H61 H N N 237 LFA H62 H N N 238 LFA H71 H N N 239 LFA H72 H N N 240 LFA H81 H N N 241 LFA H82 H N N 242 LFA H91 H N N 243 LFA H92 H N N 244 LFA H101 H N N 245 LFA H102 H N N 246 LFA H111 H N N 247 LFA H112 H N N 248 LFA H121 H N N 249 LFA H122 H N N 250 LFA H131 H N N 251 LFA H132 H N N 252 LFA H141 H N N 253 LFA H142 H N N 254 LFA H151 H N N 255 LFA H152 H N N 256 LFA H161 H N N 257 LFA H162 H N N 258 LFA H171 H N N 259 LFA H172 H N N 260 LFA H181 H N N 261 LFA H182 H N N 262 LFA H191 H N N 263 LFA H192 H N N 264 LFA H201 H N N 265 LFA H202 H N N 266 LFA H203 H N N 267 LYS N N N N 268 LYS CA C N S 269 LYS C C N N 270 LYS O O N N 271 LYS CB C N N 272 LYS CG C N N 273 LYS CD C N N 274 LYS CE C N N 275 LYS NZ N N N 276 LYS OXT O N N 277 LYS H H N N 278 LYS H2 H N N 279 LYS HA H N N 280 LYS HB2 H N N 281 LYS HB3 H N N 282 LYS HG2 H N N 283 LYS HG3 H N N 284 LYS HD2 H N N 285 LYS HD3 H N N 286 LYS HE2 H N N 287 LYS HE3 H N N 288 LYS HZ1 H N N 289 LYS HZ2 H N N 290 LYS HZ3 H N N 291 LYS HXT H N N 292 MET N N N N 293 MET CA C N S 294 MET C C N N 295 MET O O N N 296 MET CB C N N 297 MET CG C N N 298 MET SD S N N 299 MET CE C N N 300 MET OXT O N N 301 MET H H N N 302 MET H2 H N N 303 MET HA H N N 304 MET HB2 H N N 305 MET HB3 H N N 306 MET HG2 H N N 307 MET HG3 H N N 308 MET HE1 H N N 309 MET HE2 H N N 310 MET HE3 H N N 311 MET HXT H N N 312 PHE N N N N 313 PHE CA C N S 314 PHE C C N N 315 PHE O O N N 316 PHE CB C N N 317 PHE CG C Y N 318 PHE CD1 C Y N 319 PHE CD2 C Y N 320 PHE CE1 C Y N 321 PHE CE2 C Y N 322 PHE CZ C Y N 323 PHE OXT O N N 324 PHE H H N N 325 PHE H2 H N N 326 PHE HA H N N 327 PHE HB2 H N N 328 PHE HB3 H N N 329 PHE HD1 H N N 330 PHE HD2 H N N 331 PHE HE1 H N N 332 PHE HE2 H N N 333 PHE HZ H N N 334 PHE HXT H N N 335 PRO N N N N 336 PRO CA C N S 337 PRO C C N N 338 PRO O O N N 339 PRO CB C N N 340 PRO CG C N N 341 PRO CD C N N 342 PRO OXT O N N 343 PRO H H N N 344 PRO HA H N N 345 PRO HB2 H N N 346 PRO HB3 H N N 347 PRO HG2 H N N 348 PRO HG3 H N N 349 PRO HD2 H N N 350 PRO HD3 H N N 351 PRO HXT H N N 352 SER N N N N 353 SER CA C N S 354 SER C C N N 355 SER O O N N 356 SER CB C N N 357 SER OG O N N 358 SER OXT O N N 359 SER H H N N 360 SER H2 H N N 361 SER HA H N N 362 SER HB2 H N N 363 SER HB3 H N N 364 SER HG H N N 365 SER HXT H N N 366 SO4 S S N N 367 SO4 O1 O N N 368 SO4 O2 O N N 369 SO4 O3 O N N 370 SO4 O4 O N N 371 THR N N N N 372 THR CA C N S 373 THR C C N N 374 THR O O N N 375 THR CB C N R 376 THR OG1 O N N 377 THR CG2 C N N 378 THR OXT O N N 379 THR H H N N 380 THR H2 H N N 381 THR HA H N N 382 THR HB H N N 383 THR HG1 H N N 384 THR HG21 H N N 385 THR HG22 H N N 386 THR HG23 H N N 387 THR HXT H N N 388 TRP N N N N 389 TRP CA C N S 390 TRP C C N N 391 TRP O O N N 392 TRP CB C N N 393 TRP CG C Y N 394 TRP CD1 C Y N 395 TRP CD2 C Y N 396 TRP NE1 N Y N 397 TRP CE2 C Y N 398 TRP CE3 C Y N 399 TRP CZ2 C Y N 400 TRP CZ3 C Y N 401 TRP CH2 C Y N 402 TRP OXT O N N 403 TRP H H N N 404 TRP H2 H N N 405 TRP HA H N N 406 TRP HB2 H N N 407 TRP HB3 H N N 408 TRP HD1 H N N 409 TRP HE1 H N N 410 TRP HE3 H N N 411 TRP HZ2 H N N 412 TRP HZ3 H N N 413 TRP HH2 H N N 414 TRP HXT H N N 415 TYR N N N N 416 TYR CA C N S 417 TYR C C N N 418 TYR O O N N 419 TYR CB C N N 420 TYR CG C Y N 421 TYR CD1 C Y N 422 TYR CD2 C Y N 423 TYR CE1 C Y N 424 TYR CE2 C Y N 425 TYR CZ C Y N 426 TYR OH O N N 427 TYR OXT O N N 428 TYR H H N N 429 TYR H2 H N N 430 TYR HA H N N 431 TYR HB2 H N N 432 TYR HB3 H N N 433 TYR HD1 H N N 434 TYR HD2 H N N 435 TYR HE1 H N N 436 TYR HE2 H N N 437 TYR HH H N N 438 TYR HXT H N N 439 VAL N N N N 440 VAL CA C N S 441 VAL C C N N 442 VAL O O N N 443 VAL CB C N N 444 VAL CG1 C N N 445 VAL CG2 C N N 446 VAL OXT O N N 447 VAL H H N N 448 VAL H2 H N N 449 VAL HA H N N 450 VAL HB H N N 451 VAL HG11 H N N 452 VAL HG12 H N N 453 VAL HG13 H N N 454 VAL HG21 H N N 455 VAL HG22 H N N 456 VAL HG23 H N N 457 VAL HXT H N N 458 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 GOL C1 O1 sing N N 116 GOL C1 C2 sing N N 117 GOL C1 H11 sing N N 118 GOL C1 H12 sing N N 119 GOL O1 HO1 sing N N 120 GOL C2 O2 sing N N 121 GOL C2 C3 sing N N 122 GOL C2 H2 sing N N 123 GOL O2 HO2 sing N N 124 GOL C3 O3 sing N N 125 GOL C3 H31 sing N N 126 GOL C3 H32 sing N N 127 GOL O3 HO3 sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LFA C1 C2 sing N N 194 LFA C1 H11 sing N N 195 LFA C1 H12 sing N N 196 LFA C1 H13 sing N N 197 LFA C2 C3 sing N N 198 LFA C2 H21 sing N N 199 LFA C2 H22 sing N N 200 LFA C3 C4 sing N N 201 LFA C3 H31 sing N N 202 LFA C3 H32 sing N N 203 LFA C4 C5 sing N N 204 LFA C4 H41 sing N N 205 LFA C4 H42 sing N N 206 LFA C5 C6 sing N N 207 LFA C5 H51 sing N N 208 LFA C5 H52 sing N N 209 LFA C6 C7 sing N N 210 LFA C6 H61 sing N N 211 LFA C6 H62 sing N N 212 LFA C7 C8 sing N N 213 LFA C7 H71 sing N N 214 LFA C7 H72 sing N N 215 LFA C8 C9 sing N N 216 LFA C8 H81 sing N N 217 LFA C8 H82 sing N N 218 LFA C9 C10 sing N N 219 LFA C9 H91 sing N N 220 LFA C9 H92 sing N N 221 LFA C10 C11 sing N N 222 LFA C10 H101 sing N N 223 LFA C10 H102 sing N N 224 LFA C11 C12 sing N N 225 LFA C11 H111 sing N N 226 LFA C11 H112 sing N N 227 LFA C12 C13 sing N N 228 LFA C12 H121 sing N N 229 LFA C12 H122 sing N N 230 LFA C13 C14 sing N N 231 LFA C13 H131 sing N N 232 LFA C13 H132 sing N N 233 LFA C14 C15 sing N N 234 LFA C14 H141 sing N N 235 LFA C14 H142 sing N N 236 LFA C15 C16 sing N N 237 LFA C15 H151 sing N N 238 LFA C15 H152 sing N N 239 LFA C16 C17 sing N N 240 LFA C16 H161 sing N N 241 LFA C16 H162 sing N N 242 LFA C17 C18 sing N N 243 LFA C17 H171 sing N N 244 LFA C17 H172 sing N N 245 LFA C18 C19 sing N N 246 LFA C18 H181 sing N N 247 LFA C18 H182 sing N N 248 LFA C19 C20 sing N N 249 LFA C19 H191 sing N N 250 LFA C19 H192 sing N N 251 LFA C20 H201 sing N N 252 LFA C20 H202 sing N N 253 LFA C20 H203 sing N N 254 LYS N CA sing N N 255 LYS N H sing N N 256 LYS N H2 sing N N 257 LYS CA C sing N N 258 LYS CA CB sing N N 259 LYS CA HA sing N N 260 LYS C O doub N N 261 LYS C OXT sing N N 262 LYS CB CG sing N N 263 LYS CB HB2 sing N N 264 LYS CB HB3 sing N N 265 LYS CG CD sing N N 266 LYS CG HG2 sing N N 267 LYS CG HG3 sing N N 268 LYS CD CE sing N N 269 LYS CD HD2 sing N N 270 LYS CD HD3 sing N N 271 LYS CE NZ sing N N 272 LYS CE HE2 sing N N 273 LYS CE HE3 sing N N 274 LYS NZ HZ1 sing N N 275 LYS NZ HZ2 sing N N 276 LYS NZ HZ3 sing N N 277 LYS OXT HXT sing N N 278 MET N CA sing N N 279 MET N H sing N N 280 MET N H2 sing N N 281 MET CA C sing N N 282 MET CA CB sing N N 283 MET CA HA sing N N 284 MET C O doub N N 285 MET C OXT sing N N 286 MET CB CG sing N N 287 MET CB HB2 sing N N 288 MET CB HB3 sing N N 289 MET CG SD sing N N 290 MET CG HG2 sing N N 291 MET CG HG3 sing N N 292 MET SD CE sing N N 293 MET CE HE1 sing N N 294 MET CE HE2 sing N N 295 MET CE HE3 sing N N 296 MET OXT HXT sing N N 297 PHE N CA sing N N 298 PHE N H sing N N 299 PHE N H2 sing N N 300 PHE CA C sing N N 301 PHE CA CB sing N N 302 PHE CA HA sing N N 303 PHE C O doub N N 304 PHE C OXT sing N N 305 PHE CB CG sing N N 306 PHE CB HB2 sing N N 307 PHE CB HB3 sing N N 308 PHE CG CD1 doub Y N 309 PHE CG CD2 sing Y N 310 PHE CD1 CE1 sing Y N 311 PHE CD1 HD1 sing N N 312 PHE CD2 CE2 doub Y N 313 PHE CD2 HD2 sing N N 314 PHE CE1 CZ doub Y N 315 PHE CE1 HE1 sing N N 316 PHE CE2 CZ sing Y N 317 PHE CE2 HE2 sing N N 318 PHE CZ HZ sing N N 319 PHE OXT HXT sing N N 320 PRO N CA sing N N 321 PRO N CD sing N N 322 PRO N H sing N N 323 PRO CA C sing N N 324 PRO CA CB sing N N 325 PRO CA HA sing N N 326 PRO C O doub N N 327 PRO C OXT sing N N 328 PRO CB CG sing N N 329 PRO CB HB2 sing N N 330 PRO CB HB3 sing N N 331 PRO CG CD sing N N 332 PRO CG HG2 sing N N 333 PRO CG HG3 sing N N 334 PRO CD HD2 sing N N 335 PRO CD HD3 sing N N 336 PRO OXT HXT sing N N 337 SER N CA sing N N 338 SER N H sing N N 339 SER N H2 sing N N 340 SER CA C sing N N 341 SER CA CB sing N N 342 SER CA HA sing N N 343 SER C O doub N N 344 SER C OXT sing N N 345 SER CB OG sing N N 346 SER CB HB2 sing N N 347 SER CB HB3 sing N N 348 SER OG HG sing N N 349 SER OXT HXT sing N N 350 SO4 S O1 doub N N 351 SO4 S O2 doub N N 352 SO4 S O3 sing N N 353 SO4 S O4 sing N N 354 THR N CA sing N N 355 THR N H sing N N 356 THR N H2 sing N N 357 THR CA C sing N N 358 THR CA CB sing N N 359 THR CA HA sing N N 360 THR C O doub N N 361 THR C OXT sing N N 362 THR CB OG1 sing N N 363 THR CB CG2 sing N N 364 THR CB HB sing N N 365 THR OG1 HG1 sing N N 366 THR CG2 HG21 sing N N 367 THR CG2 HG22 sing N N 368 THR CG2 HG23 sing N N 369 THR OXT HXT sing N N 370 TRP N CA sing N N 371 TRP N H sing N N 372 TRP N H2 sing N N 373 TRP CA C sing N N 374 TRP CA CB sing N N 375 TRP CA HA sing N N 376 TRP C O doub N N 377 TRP C OXT sing N N 378 TRP CB CG sing N N 379 TRP CB HB2 sing N N 380 TRP CB HB3 sing N N 381 TRP CG CD1 doub Y N 382 TRP CG CD2 sing Y N 383 TRP CD1 NE1 sing Y N 384 TRP CD1 HD1 sing N N 385 TRP CD2 CE2 doub Y N 386 TRP CD2 CE3 sing Y N 387 TRP NE1 CE2 sing Y N 388 TRP NE1 HE1 sing N N 389 TRP CE2 CZ2 sing Y N 390 TRP CE3 CZ3 doub Y N 391 TRP CE3 HE3 sing N N 392 TRP CZ2 CH2 doub Y N 393 TRP CZ2 HZ2 sing N N 394 TRP CZ3 CH2 sing Y N 395 TRP CZ3 HZ3 sing N N 396 TRP CH2 HH2 sing N N 397 TRP OXT HXT sing N N 398 TYR N CA sing N N 399 TYR N H sing N N 400 TYR N H2 sing N N 401 TYR CA C sing N N 402 TYR CA CB sing N N 403 TYR CA HA sing N N 404 TYR C O doub N N 405 TYR C OXT sing N N 406 TYR CB CG sing N N 407 TYR CB HB2 sing N N 408 TYR CB HB3 sing N N 409 TYR CG CD1 doub Y N 410 TYR CG CD2 sing Y N 411 TYR CD1 CE1 sing Y N 412 TYR CD1 HD1 sing N N 413 TYR CD2 CE2 doub Y N 414 TYR CD2 HD2 sing N N 415 TYR CE1 CZ doub Y N 416 TYR CE1 HE1 sing N N 417 TYR CE2 CZ sing Y N 418 TYR CE2 HE2 sing N N 419 TYR CZ OH sing N N 420 TYR OH HH sing N N 421 TYR OXT HXT sing N N 422 VAL N CA sing N N 423 VAL N H sing N N 424 VAL N H2 sing N N 425 VAL CA C sing N N 426 VAL CA CB sing N N 427 VAL CA HA sing N N 428 VAL C O doub N N 429 VAL C OXT sing N N 430 VAL CB CG1 sing N N 431 VAL CB CG2 sing N N 432 VAL CB HB sing N N 433 VAL CG1 HG11 sing N N 434 VAL CG1 HG12 sing N N 435 VAL CG1 HG13 sing N N 436 VAL CG2 HG21 sing N N 437 VAL CG2 HG22 sing N N 438 VAL CG2 HG23 sing N N 439 VAL OXT HXT sing N N 440 # _pdbx_audit_support.funding_organization 'Foundation for Polish Science' _pdbx_audit_support.country Poland _pdbx_audit_support.grant_number Homing/2017-3/22 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1VLG _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 6TXJ _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.005675 _atom_sites.fract_transf_matrix[1][2] 0.003277 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.006553 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.002835 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C FE N O S # loop_