data_6TXS # _entry.id 6TXS # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.386 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6TXS pdb_00006txs 10.2210/pdb6txs/pdb WWPDB D_1292106237 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-01-29 2 'Structure model' 2 0 2020-12-02 3 'Structure model' 2 1 2023-10-25 4 'Structure model' 2 2 2023-11-01 5 'Structure model' 2 3 2024-01-24 6 'Structure model' 2 4 2024-02-14 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 2 'Structure model' author 'Coordinate replacement' 'Model orientation/position' 'The side chain of His288 was the wrong way round. It has now been flipped.' # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Atomic model' 2 2 'Structure model' 'Data collection' 3 2 'Structure model' 'Derived calculations' 4 2 'Structure model' 'Refinement description' 5 3 'Structure model' 'Data collection' 6 3 'Structure model' 'Database references' 7 3 'Structure model' 'Derived calculations' 8 4 'Structure model' 'Database references' 9 5 'Structure model' 'Refinement description' 10 6 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' atom_site 2 2 'Structure model' pdbx_nonpoly_scheme 3 2 'Structure model' pdbx_struct_assembly_prop 4 2 'Structure model' pdbx_validate_torsion 5 2 'Structure model' refine 6 2 'Structure model' refine_ls_restr 7 2 'Structure model' refine_ls_shell 8 2 'Structure model' software 9 2 'Structure model' struct_mon_prot_cis 10 3 'Structure model' atom_type 11 3 'Structure model' chem_comp_atom 12 3 'Structure model' chem_comp_bond 13 3 'Structure model' citation 14 3 'Structure model' database_2 15 4 'Structure model' citation 16 4 'Structure model' citation_author 17 5 'Structure model' pdbx_initial_refinement_model 18 6 'Structure model' citation 19 6 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_atom_site.B_iso_or_equiv' 2 2 'Structure model' '_atom_site.Cartn_x' 3 2 'Structure model' '_atom_site.Cartn_y' 4 2 'Structure model' '_atom_site.Cartn_z' 5 2 'Structure model' '_atom_site.pdbx_formal_charge' 6 2 'Structure model' '_pdbx_nonpoly_scheme.auth_seq_num' 7 2 'Structure model' '_pdbx_struct_assembly_prop.value' 8 2 'Structure model' '_pdbx_validate_torsion.auth_comp_id' 9 2 'Structure model' '_pdbx_validate_torsion.auth_seq_id' 10 2 'Structure model' '_pdbx_validate_torsion.phi' 11 2 'Structure model' '_pdbx_validate_torsion.psi' 12 2 'Structure model' '_refine.B_iso_mean' 13 2 'Structure model' '_refine.aniso_B[1][1]' 14 2 'Structure model' '_refine.aniso_B[2][2]' 15 2 'Structure model' '_refine.aniso_B[3][3]' 16 2 'Structure model' '_refine.correlation_coeff_Fo_to_Fc_free' 17 2 'Structure model' '_refine.ls_R_factor_R_free' 18 2 'Structure model' '_refine.ls_R_factor_R_work' 19 2 'Structure model' '_refine.ls_R_factor_all' 20 2 'Structure model' '_refine.ls_number_reflns_R_work' 21 2 'Structure model' '_refine.ls_wR_factor_R_free' 22 2 'Structure model' '_refine.ls_wR_factor_R_work' 23 2 'Structure model' '_refine.overall_SU_B' 24 2 'Structure model' '_refine.pdbx_average_fsc_free' 25 2 'Structure model' '_refine.pdbx_average_fsc_work' 26 2 'Structure model' '_refine.pdbx_overall_ESU_R' 27 2 'Structure model' '_refine.pdbx_overall_ESU_R_Free' 28 2 'Structure model' '_refine.solvent_model_details' 29 2 'Structure model' '_refine_ls_restr.dev_ideal' 30 2 'Structure model' '_refine_ls_restr.dev_ideal_target' 31 2 'Structure model' '_refine_ls_restr.number' 32 2 'Structure model' '_refine_ls_shell.R_factor_R_free' 33 2 'Structure model' '_refine_ls_shell.R_factor_R_work' 34 2 'Structure model' '_refine_ls_shell.R_factor_all' 35 2 'Structure model' '_refine_ls_shell.pdbx_fsc_free' 36 2 'Structure model' '_refine_ls_shell.pdbx_fsc_work' 37 2 'Structure model' '_refine_ls_shell.wR_factor_R_work' 38 2 'Structure model' '_software.version' 39 2 'Structure model' '_struct_mon_prot_cis.pdbx_omega_angle' 40 3 'Structure model' '_atom_type.pdbx_N_electrons' 41 3 'Structure model' '_atom_type.pdbx_scat_Z' 42 3 'Structure model' '_citation.country' 43 3 'Structure model' '_citation.journal_abbrev' 44 3 'Structure model' '_citation.journal_id_ASTM' 45 3 'Structure model' '_citation.journal_id_CSD' 46 3 'Structure model' '_citation.journal_id_ISSN' 47 3 'Structure model' '_citation.title' 48 3 'Structure model' '_citation.year' 49 3 'Structure model' '_database_2.pdbx_DOI' 50 3 'Structure model' '_database_2.pdbx_database_accession' 51 4 'Structure model' '_citation.pdbx_database_id_DOI' 52 4 'Structure model' '_citation.title' 53 6 'Structure model' '_citation.journal_volume' 54 6 'Structure model' '_citation.page_first' 55 6 'Structure model' '_citation.page_last' 56 6 'Structure model' '_citation.pdbx_database_id_PubMed' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6TXS _pdbx_database_status.recvd_initial_deposition_date 2020-01-14 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible N # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Bradshaw, W.J.' 1 0000-0002-7985-9752 'Katis, V.L.' 2 0000-0002-0696-8042 'Kelly, J.J.' 3 0000-0003-3067-4500 'von Delft, F.' 4 0000-0003-0378-0017 'Arrowsmith, C.H.' 5 0000-0002-4971-3250 'Edwards, A.' 6 0000-0002-4782-6016 'Bountra, C.' 7 0000-0001-6596-153X 'Gileadi, O.' 8 0000-0001-6886-898X # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Biol.Chem. _citation.journal_id_ASTM JBCHA3 _citation.journal_id_CSD 0071 _citation.journal_id_ISSN 1083-351X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 299 _citation.language ? _citation.page_first 105382 _citation.page_last 105382 _citation.title ;Discovery of FERM domain protein-protein interaction inhibitors for MSN and CD44 as a potential therapeutic approach for Alzheimer's disease. ; _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.jbc.2023.105382 _citation.pdbx_database_id_PubMed 37866628 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Du, Y.' 1 ? primary 'Bradshaw, W.J.' 2 ? primary 'Leisner, T.M.' 3 ? primary 'Annor-Gyamfi, J.K.' 4 ? primary 'Qian, K.' 5 ? primary 'Bashore, F.M.' 6 ? primary 'Sikdar, A.' 7 ? primary 'Nwogbo, F.O.' 8 ? primary 'Ivanov, A.A.' 9 ? primary 'Frye, S.V.' 10 ? primary 'Gileadi, O.' 11 ? primary 'Brennan, P.E.' 12 ? primary 'Levey, A.I.' 13 ? primary 'Axtman, A.D.' 14 ? primary 'Pearce, K.H.' 15 ? primary 'Fu, H.' 16 ? primary 'Katis, V.L.' 17 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Moesin 41141.383 1 ? ? ? ? 2 polymer syn 'CD44 antigen' 973.233 1 ? ? ? 'Octapeptide based on the intracellular C-terminal tail of CD44' 3 water nat water 18.015 39 ? ? ? ? # loop_ _entity_name_com.entity_id _entity_name_com.name 1 'Membrane-organizing extension spike protein' 2 ;CDw44,Epican,Extracellular matrix receptor III,ECMR-III,GP90 lymphocyte homing/adhesion receptor,HUTCH-I,Heparan sulfate proteoglycan,Hermes antigen,Hyaluronate receptor,Phagocytic glycoprotein 1,PGP-1,Phagocytic glycoprotein I,PGP-I ; # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;SMPKTISVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWFFGLQYQDTKGFSTWLKLNKKVTAQDVRKESPLLFK FRAKFYPEDVSEELIQDITQRLFFLQVKEGILNDDIYCPPETAVLLASYAVQSKYGDFNKEVHKSGYLAGDKLLPQRVLE QHKLNKDQWEERIQVWHEEHRGMLREDAVLEYLKIAQDLEMYGVNYFSIKNKKGSELWLGVDALGLNIYEQNDRLTPKIG FPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKPDTIEVQQMKAQAREEKHQKQME RAMLENEKKKREMAEKEKEKIEREKEE ; ;SMPKTISVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWFFGLQYQDTKGFSTWLKLNKKVTAQDVRKESPLLFK FRAKFYPEDVSEELIQDITQRLFFLQVKEGILNDDIYCPPETAVLLASYAVQSKYGDFNKEVHKSGYLAGDKLLPQRVLE QHKLNKDQWEERIQVWHEEHRGMLREDAVLEYLKIAQDLEMYGVNYFSIKNKKGSELWLGVDALGLNIYEQNDRLTPKIG FPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKPDTIEVQQMKAQAREEKHQKQME RAMLENEKKKREMAEKEKEKIEREKEE ; AAA ? 2 'polypeptide(L)' no no QKKKLVIN QKKKLVIN BBB ? # _pdbx_entity_nonpoly.entity_id 3 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 MET n 1 3 PRO n 1 4 LYS n 1 5 THR n 1 6 ILE n 1 7 SER n 1 8 VAL n 1 9 ARG n 1 10 VAL n 1 11 THR n 1 12 THR n 1 13 MET n 1 14 ASP n 1 15 ALA n 1 16 GLU n 1 17 LEU n 1 18 GLU n 1 19 PHE n 1 20 ALA n 1 21 ILE n 1 22 GLN n 1 23 PRO n 1 24 ASN n 1 25 THR n 1 26 THR n 1 27 GLY n 1 28 LYS n 1 29 GLN n 1 30 LEU n 1 31 PHE n 1 32 ASP n 1 33 GLN n 1 34 VAL n 1 35 VAL n 1 36 LYS n 1 37 THR n 1 38 ILE n 1 39 GLY n 1 40 LEU n 1 41 ARG n 1 42 GLU n 1 43 VAL n 1 44 TRP n 1 45 PHE n 1 46 PHE n 1 47 GLY n 1 48 LEU n 1 49 GLN n 1 50 TYR n 1 51 GLN n 1 52 ASP n 1 53 THR n 1 54 LYS n 1 55 GLY n 1 56 PHE n 1 57 SER n 1 58 THR n 1 59 TRP n 1 60 LEU n 1 61 LYS n 1 62 LEU n 1 63 ASN n 1 64 LYS n 1 65 LYS n 1 66 VAL n 1 67 THR n 1 68 ALA n 1 69 GLN n 1 70 ASP n 1 71 VAL n 1 72 ARG n 1 73 LYS n 1 74 GLU n 1 75 SER n 1 76 PRO n 1 77 LEU n 1 78 LEU n 1 79 PHE n 1 80 LYS n 1 81 PHE n 1 82 ARG n 1 83 ALA n 1 84 LYS n 1 85 PHE n 1 86 TYR n 1 87 PRO n 1 88 GLU n 1 89 ASP n 1 90 VAL n 1 91 SER n 1 92 GLU n 1 93 GLU n 1 94 LEU n 1 95 ILE n 1 96 GLN n 1 97 ASP n 1 98 ILE n 1 99 THR n 1 100 GLN n 1 101 ARG n 1 102 LEU n 1 103 PHE n 1 104 PHE n 1 105 LEU n 1 106 GLN n 1 107 VAL n 1 108 LYS n 1 109 GLU n 1 110 GLY n 1 111 ILE n 1 112 LEU n 1 113 ASN n 1 114 ASP n 1 115 ASP n 1 116 ILE n 1 117 TYR n 1 118 CYS n 1 119 PRO n 1 120 PRO n 1 121 GLU n 1 122 THR n 1 123 ALA n 1 124 VAL n 1 125 LEU n 1 126 LEU n 1 127 ALA n 1 128 SER n 1 129 TYR n 1 130 ALA n 1 131 VAL n 1 132 GLN n 1 133 SER n 1 134 LYS n 1 135 TYR n 1 136 GLY n 1 137 ASP n 1 138 PHE n 1 139 ASN n 1 140 LYS n 1 141 GLU n 1 142 VAL n 1 143 HIS n 1 144 LYS n 1 145 SER n 1 146 GLY n 1 147 TYR n 1 148 LEU n 1 149 ALA n 1 150 GLY n 1 151 ASP n 1 152 LYS n 1 153 LEU n 1 154 LEU n 1 155 PRO n 1 156 GLN n 1 157 ARG n 1 158 VAL n 1 159 LEU n 1 160 GLU n 1 161 GLN n 1 162 HIS n 1 163 LYS n 1 164 LEU n 1 165 ASN n 1 166 LYS n 1 167 ASP n 1 168 GLN n 1 169 TRP n 1 170 GLU n 1 171 GLU n 1 172 ARG n 1 173 ILE n 1 174 GLN n 1 175 VAL n 1 176 TRP n 1 177 HIS n 1 178 GLU n 1 179 GLU n 1 180 HIS n 1 181 ARG n 1 182 GLY n 1 183 MET n 1 184 LEU n 1 185 ARG n 1 186 GLU n 1 187 ASP n 1 188 ALA n 1 189 VAL n 1 190 LEU n 1 191 GLU n 1 192 TYR n 1 193 LEU n 1 194 LYS n 1 195 ILE n 1 196 ALA n 1 197 GLN n 1 198 ASP n 1 199 LEU n 1 200 GLU n 1 201 MET n 1 202 TYR n 1 203 GLY n 1 204 VAL n 1 205 ASN n 1 206 TYR n 1 207 PHE n 1 208 SER n 1 209 ILE n 1 210 LYS n 1 211 ASN n 1 212 LYS n 1 213 LYS n 1 214 GLY n 1 215 SER n 1 216 GLU n 1 217 LEU n 1 218 TRP n 1 219 LEU n 1 220 GLY n 1 221 VAL n 1 222 ASP n 1 223 ALA n 1 224 LEU n 1 225 GLY n 1 226 LEU n 1 227 ASN n 1 228 ILE n 1 229 TYR n 1 230 GLU n 1 231 GLN n 1 232 ASN n 1 233 ASP n 1 234 ARG n 1 235 LEU n 1 236 THR n 1 237 PRO n 1 238 LYS n 1 239 ILE n 1 240 GLY n 1 241 PHE n 1 242 PRO n 1 243 TRP n 1 244 SER n 1 245 GLU n 1 246 ILE n 1 247 ARG n 1 248 ASN n 1 249 ILE n 1 250 SER n 1 251 PHE n 1 252 ASN n 1 253 ASP n 1 254 LYS n 1 255 LYS n 1 256 PHE n 1 257 VAL n 1 258 ILE n 1 259 LYS n 1 260 PRO n 1 261 ILE n 1 262 ASP n 1 263 LYS n 1 264 LYS n 1 265 ALA n 1 266 PRO n 1 267 ASP n 1 268 PHE n 1 269 VAL n 1 270 PHE n 1 271 TYR n 1 272 ALA n 1 273 PRO n 1 274 ARG n 1 275 LEU n 1 276 ARG n 1 277 ILE n 1 278 ASN n 1 279 LYS n 1 280 ARG n 1 281 ILE n 1 282 LEU n 1 283 ALA n 1 284 LEU n 1 285 CYS n 1 286 MET n 1 287 GLY n 1 288 ASN n 1 289 HIS n 1 290 GLU n 1 291 LEU n 1 292 TYR n 1 293 MET n 1 294 ARG n 1 295 ARG n 1 296 ARG n 1 297 LYS n 1 298 PRO n 1 299 ASP n 1 300 THR n 1 301 ILE n 1 302 GLU n 1 303 VAL n 1 304 GLN n 1 305 GLN n 1 306 MET n 1 307 LYS n 1 308 ALA n 1 309 GLN n 1 310 ALA n 1 311 ARG n 1 312 GLU n 1 313 GLU n 1 314 LYS n 1 315 HIS n 1 316 GLN n 1 317 LYS n 1 318 GLN n 1 319 MET n 1 320 GLU n 1 321 ARG n 1 322 ALA n 1 323 MET n 1 324 LEU n 1 325 GLU n 1 326 ASN n 1 327 GLU n 1 328 LYS n 1 329 LYS n 1 330 LYS n 1 331 ARG n 1 332 GLU n 1 333 MET n 1 334 ALA n 1 335 GLU n 1 336 LYS n 1 337 GLU n 1 338 LYS n 1 339 GLU n 1 340 LYS n 1 341 ILE n 1 342 GLU n 1 343 ARG n 1 344 GLU n 1 345 LYS n 1 346 GLU n 1 347 GLU n 2 1 GLN n 2 2 LYS n 2 3 LYS n 2 4 LYS n 2 5 LEU n 2 6 VAL n 2 7 ILE n 2 8 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 347 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene MSN _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant Rosetta _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 8 _pdbx_entity_src_syn.organism_scientific 'Homo sapiens' _pdbx_entity_src_syn.organism_common_name Human _pdbx_entity_src_syn.ncbi_taxonomy_id 9606 _pdbx_entity_src_syn.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 0 ? ? ? AAA . n A 1 2 MET 2 1 ? ? ? AAA . n A 1 3 PRO 3 2 ? ? ? AAA . n A 1 4 LYS 4 3 3 LYS LYS AAA . n A 1 5 THR 5 4 4 THR THR AAA . n A 1 6 ILE 6 5 5 ILE ILE AAA . n A 1 7 SER 7 6 6 SER SER AAA . n A 1 8 VAL 8 7 7 VAL VAL AAA . n A 1 9 ARG 9 8 8 ARG ARG AAA . n A 1 10 VAL 10 9 9 VAL VAL AAA . n A 1 11 THR 11 10 10 THR THR AAA . n A 1 12 THR 12 11 11 THR THR AAA . n A 1 13 MET 13 12 12 MET MET AAA . n A 1 14 ASP 14 13 13 ASP ASP AAA . n A 1 15 ALA 15 14 14 ALA ALA AAA . n A 1 16 GLU 16 15 15 GLU GLU AAA . n A 1 17 LEU 17 16 16 LEU LEU AAA . n A 1 18 GLU 18 17 17 GLU GLU AAA . n A 1 19 PHE 19 18 18 PHE PHE AAA . n A 1 20 ALA 20 19 19 ALA ALA AAA . n A 1 21 ILE 21 20 20 ILE ILE AAA . n A 1 22 GLN 22 21 21 GLN GLN AAA . n A 1 23 PRO 23 22 22 PRO PRO AAA . n A 1 24 ASN 24 23 23 ASN ASN AAA . n A 1 25 THR 25 24 24 THR THR AAA . n A 1 26 THR 26 25 25 THR THR AAA . n A 1 27 GLY 27 26 26 GLY GLY AAA . n A 1 28 LYS 28 27 27 LYS LYS AAA . n A 1 29 GLN 29 28 28 GLN GLN AAA . n A 1 30 LEU 30 29 29 LEU LEU AAA . n A 1 31 PHE 31 30 30 PHE PHE AAA . n A 1 32 ASP 32 31 31 ASP ASP AAA . n A 1 33 GLN 33 32 32 GLN GLN AAA . n A 1 34 VAL 34 33 33 VAL VAL AAA . n A 1 35 VAL 35 34 34 VAL VAL AAA . n A 1 36 LYS 36 35 35 LYS LYS AAA . n A 1 37 THR 37 36 36 THR THR AAA . n A 1 38 ILE 38 37 37 ILE ILE AAA . n A 1 39 GLY 39 38 38 GLY GLY AAA . n A 1 40 LEU 40 39 39 LEU LEU AAA . n A 1 41 ARG 41 40 40 ARG ARG AAA . n A 1 42 GLU 42 41 41 GLU GLU AAA . n A 1 43 VAL 43 42 42 VAL VAL AAA . n A 1 44 TRP 44 43 43 TRP TRP AAA . n A 1 45 PHE 45 44 44 PHE PHE AAA . n A 1 46 PHE 46 45 45 PHE PHE AAA . n A 1 47 GLY 47 46 46 GLY GLY AAA . n A 1 48 LEU 48 47 47 LEU LEU AAA . n A 1 49 GLN 49 48 48 GLN GLN AAA . n A 1 50 TYR 50 49 49 TYR TYR AAA . n A 1 51 GLN 51 50 50 GLN GLN AAA . n A 1 52 ASP 52 51 51 ASP ASP AAA . n A 1 53 THR 53 52 52 THR THR AAA . n A 1 54 LYS 54 53 53 LYS LYS AAA . n A 1 55 GLY 55 54 54 GLY GLY AAA . n A 1 56 PHE 56 55 55 PHE PHE AAA . n A 1 57 SER 57 56 56 SER SER AAA . n A 1 58 THR 58 57 57 THR THR AAA . n A 1 59 TRP 59 58 58 TRP TRP AAA . n A 1 60 LEU 60 59 59 LEU LEU AAA . n A 1 61 LYS 61 60 60 LYS LYS AAA . n A 1 62 LEU 62 61 61 LEU LEU AAA . n A 1 63 ASN 63 62 62 ASN ASN AAA . n A 1 64 LYS 64 63 63 LYS LYS AAA . n A 1 65 LYS 65 64 64 LYS LYS AAA . n A 1 66 VAL 66 65 65 VAL VAL AAA . n A 1 67 THR 67 66 66 THR THR AAA . n A 1 68 ALA 68 67 67 ALA ALA AAA . n A 1 69 GLN 69 68 68 GLN GLN AAA . n A 1 70 ASP 70 69 69 ASP ASP AAA . n A 1 71 VAL 71 70 70 VAL VAL AAA . n A 1 72 ARG 72 71 71 ARG ARG AAA . n A 1 73 LYS 73 72 72 LYS LYS AAA . n A 1 74 GLU 74 73 73 GLU GLU AAA . n A 1 75 SER 75 74 74 SER SER AAA . n A 1 76 PRO 76 75 75 PRO PRO AAA . n A 1 77 LEU 77 76 76 LEU LEU AAA . n A 1 78 LEU 78 77 77 LEU LEU AAA . n A 1 79 PHE 79 78 78 PHE PHE AAA . n A 1 80 LYS 80 79 79 LYS LYS AAA . n A 1 81 PHE 81 80 80 PHE PHE AAA . n A 1 82 ARG 82 81 81 ARG ARG AAA . n A 1 83 ALA 83 82 82 ALA ALA AAA . n A 1 84 LYS 84 83 83 LYS LYS AAA . n A 1 85 PHE 85 84 84 PHE PHE AAA . n A 1 86 TYR 86 85 85 TYR TYR AAA . n A 1 87 PRO 87 86 86 PRO PRO AAA . n A 1 88 GLU 88 87 87 GLU GLU AAA . n A 1 89 ASP 89 88 88 ASP ASP AAA . n A 1 90 VAL 90 89 89 VAL VAL AAA . n A 1 91 SER 91 90 90 SER SER AAA . n A 1 92 GLU 92 91 91 GLU GLU AAA . n A 1 93 GLU 93 92 92 GLU GLU AAA . n A 1 94 LEU 94 93 93 LEU LEU AAA . n A 1 95 ILE 95 94 94 ILE ILE AAA . n A 1 96 GLN 96 95 95 GLN GLN AAA . n A 1 97 ASP 97 96 96 ASP ASP AAA . n A 1 98 ILE 98 97 97 ILE ILE AAA . n A 1 99 THR 99 98 98 THR THR AAA . n A 1 100 GLN 100 99 99 GLN GLN AAA . n A 1 101 ARG 101 100 100 ARG ARG AAA . n A 1 102 LEU 102 101 101 LEU LEU AAA . n A 1 103 PHE 103 102 102 PHE PHE AAA . n A 1 104 PHE 104 103 103 PHE PHE AAA . n A 1 105 LEU 105 104 104 LEU LEU AAA . n A 1 106 GLN 106 105 105 GLN GLN AAA . n A 1 107 VAL 107 106 106 VAL VAL AAA . n A 1 108 LYS 108 107 107 LYS LYS AAA . n A 1 109 GLU 109 108 108 GLU GLU AAA . n A 1 110 GLY 110 109 109 GLY GLY AAA . n A 1 111 ILE 111 110 110 ILE ILE AAA . n A 1 112 LEU 112 111 111 LEU LEU AAA . n A 1 113 ASN 113 112 112 ASN ASN AAA . n A 1 114 ASP 114 113 113 ASP ASP AAA . n A 1 115 ASP 115 114 114 ASP ASP AAA . n A 1 116 ILE 116 115 115 ILE ILE AAA . n A 1 117 TYR 117 116 116 TYR TYR AAA . n A 1 118 CYS 118 117 117 CYS CYS AAA . n A 1 119 PRO 119 118 118 PRO PRO AAA . n A 1 120 PRO 120 119 119 PRO PRO AAA . n A 1 121 GLU 121 120 120 GLU GLU AAA . n A 1 122 THR 122 121 121 THR THR AAA . n A 1 123 ALA 123 122 122 ALA ALA AAA . n A 1 124 VAL 124 123 123 VAL VAL AAA . n A 1 125 LEU 125 124 124 LEU LEU AAA . n A 1 126 LEU 126 125 125 LEU LEU AAA . n A 1 127 ALA 127 126 126 ALA ALA AAA . n A 1 128 SER 128 127 127 SER SER AAA . n A 1 129 TYR 129 128 128 TYR TYR AAA . n A 1 130 ALA 130 129 129 ALA ALA AAA . n A 1 131 VAL 131 130 130 VAL VAL AAA . n A 1 132 GLN 132 131 131 GLN GLN AAA . n A 1 133 SER 133 132 132 SER SER AAA . n A 1 134 LYS 134 133 133 LYS LYS AAA . n A 1 135 TYR 135 134 134 TYR TYR AAA . n A 1 136 GLY 136 135 135 GLY GLY AAA . n A 1 137 ASP 137 136 136 ASP ASP AAA . n A 1 138 PHE 138 137 137 PHE PHE AAA . n A 1 139 ASN 139 138 138 ASN ASN AAA . n A 1 140 LYS 140 139 139 LYS LYS AAA . n A 1 141 GLU 141 140 140 GLU GLU AAA . n A 1 142 VAL 142 141 141 VAL VAL AAA . n A 1 143 HIS 143 142 142 HIS HIS AAA . n A 1 144 LYS 144 143 143 LYS LYS AAA . n A 1 145 SER 145 144 144 SER SER AAA . n A 1 146 GLY 146 145 145 GLY GLY AAA . n A 1 147 TYR 147 146 146 TYR TYR AAA . n A 1 148 LEU 148 147 147 LEU LEU AAA . n A 1 149 ALA 149 148 148 ALA ALA AAA . n A 1 150 GLY 150 149 149 GLY GLY AAA . n A 1 151 ASP 151 150 150 ASP ASP AAA . n A 1 152 LYS 152 151 151 LYS LYS AAA . n A 1 153 LEU 153 152 152 LEU LEU AAA . n A 1 154 LEU 154 153 153 LEU LEU AAA . n A 1 155 PRO 155 154 154 PRO PRO AAA . n A 1 156 GLN 156 155 155 GLN GLN AAA . n A 1 157 ARG 157 156 156 ARG ARG AAA . n A 1 158 VAL 158 157 157 VAL VAL AAA . n A 1 159 LEU 159 158 158 LEU LEU AAA . n A 1 160 GLU 160 159 159 GLU GLU AAA . n A 1 161 GLN 161 160 160 GLN GLN AAA . n A 1 162 HIS 162 161 161 HIS HIS AAA . n A 1 163 LYS 163 162 162 LYS LYS AAA . n A 1 164 LEU 164 163 163 LEU LEU AAA . n A 1 165 ASN 165 164 164 ASN ASN AAA . n A 1 166 LYS 166 165 165 LYS LYS AAA . n A 1 167 ASP 167 166 166 ASP ASP AAA . n A 1 168 GLN 168 167 167 GLN GLN AAA . n A 1 169 TRP 169 168 168 TRP TRP AAA . n A 1 170 GLU 170 169 169 GLU GLU AAA . n A 1 171 GLU 171 170 170 GLU GLU AAA . n A 1 172 ARG 172 171 171 ARG ARG AAA . n A 1 173 ILE 173 172 172 ILE ILE AAA . n A 1 174 GLN 174 173 173 GLN GLN AAA . n A 1 175 VAL 175 174 174 VAL VAL AAA . n A 1 176 TRP 176 175 175 TRP TRP AAA . n A 1 177 HIS 177 176 176 HIS HIS AAA . n A 1 178 GLU 178 177 177 GLU GLU AAA . n A 1 179 GLU 179 178 178 GLU GLU AAA . n A 1 180 HIS 180 179 179 HIS HIS AAA . n A 1 181 ARG 181 180 180 ARG ARG AAA . n A 1 182 GLY 182 181 181 GLY GLY AAA . n A 1 183 MET 183 182 182 MET MET AAA . n A 1 184 LEU 184 183 183 LEU LEU AAA . n A 1 185 ARG 185 184 184 ARG ARG AAA . n A 1 186 GLU 186 185 185 GLU GLU AAA . n A 1 187 ASP 187 186 186 ASP ASP AAA . n A 1 188 ALA 188 187 187 ALA ALA AAA . n A 1 189 VAL 189 188 188 VAL VAL AAA . n A 1 190 LEU 190 189 189 LEU LEU AAA . n A 1 191 GLU 191 190 190 GLU GLU AAA . n A 1 192 TYR 192 191 191 TYR TYR AAA . n A 1 193 LEU 193 192 192 LEU LEU AAA . n A 1 194 LYS 194 193 193 LYS LYS AAA . n A 1 195 ILE 195 194 194 ILE ILE AAA . n A 1 196 ALA 196 195 195 ALA ALA AAA . n A 1 197 GLN 197 196 196 GLN GLN AAA . n A 1 198 ASP 198 197 197 ASP ASP AAA . n A 1 199 LEU 199 198 198 LEU LEU AAA . n A 1 200 GLU 200 199 199 GLU GLU AAA . n A 1 201 MET 201 200 200 MET MET AAA . n A 1 202 TYR 202 201 201 TYR TYR AAA . n A 1 203 GLY 203 202 202 GLY GLY AAA . n A 1 204 VAL 204 203 203 VAL VAL AAA . n A 1 205 ASN 205 204 204 ASN ASN AAA . n A 1 206 TYR 206 205 205 TYR TYR AAA . n A 1 207 PHE 207 206 206 PHE PHE AAA . n A 1 208 SER 208 207 207 SER SER AAA . n A 1 209 ILE 209 208 208 ILE ILE AAA . n A 1 210 LYS 210 209 209 LYS LYS AAA . n A 1 211 ASN 211 210 210 ASN ASN AAA . n A 1 212 LYS 212 211 211 LYS LYS AAA . n A 1 213 LYS 213 212 212 LYS LYS AAA . n A 1 214 GLY 214 213 213 GLY GLY AAA . n A 1 215 SER 215 214 214 SER SER AAA . n A 1 216 GLU 216 215 215 GLU GLU AAA . n A 1 217 LEU 217 216 216 LEU LEU AAA . n A 1 218 TRP 218 217 217 TRP TRP AAA . n A 1 219 LEU 219 218 218 LEU LEU AAA . n A 1 220 GLY 220 219 219 GLY GLY AAA . n A 1 221 VAL 221 220 220 VAL VAL AAA . n A 1 222 ASP 222 221 221 ASP ASP AAA . n A 1 223 ALA 223 222 222 ALA ALA AAA . n A 1 224 LEU 224 223 223 LEU LEU AAA . n A 1 225 GLY 225 224 224 GLY GLY AAA . n A 1 226 LEU 226 225 225 LEU LEU AAA . n A 1 227 ASN 227 226 226 ASN ASN AAA . n A 1 228 ILE 228 227 227 ILE ILE AAA . n A 1 229 TYR 229 228 228 TYR TYR AAA . n A 1 230 GLU 230 229 229 GLU GLU AAA . n A 1 231 GLN 231 230 230 GLN GLN AAA . n A 1 232 ASN 232 231 231 ASN ASN AAA . n A 1 233 ASP 233 232 232 ASP ASP AAA . n A 1 234 ARG 234 233 233 ARG ARG AAA . n A 1 235 LEU 235 234 234 LEU LEU AAA . n A 1 236 THR 236 235 235 THR THR AAA . n A 1 237 PRO 237 236 236 PRO PRO AAA . n A 1 238 LYS 238 237 237 LYS LYS AAA . n A 1 239 ILE 239 238 238 ILE ILE AAA . n A 1 240 GLY 240 239 239 GLY GLY AAA . n A 1 241 PHE 241 240 240 PHE PHE AAA . n A 1 242 PRO 242 241 241 PRO PRO AAA . n A 1 243 TRP 243 242 242 TRP TRP AAA . n A 1 244 SER 244 243 243 SER SER AAA . n A 1 245 GLU 245 244 244 GLU GLU AAA . n A 1 246 ILE 246 245 245 ILE ILE AAA . n A 1 247 ARG 247 246 246 ARG ARG AAA . n A 1 248 ASN 248 247 247 ASN ASN AAA . n A 1 249 ILE 249 248 248 ILE ILE AAA . n A 1 250 SER 250 249 249 SER SER AAA . n A 1 251 PHE 251 250 250 PHE PHE AAA . n A 1 252 ASN 252 251 251 ASN ASN AAA . n A 1 253 ASP 253 252 252 ASP ASP AAA . n A 1 254 LYS 254 253 253 LYS LYS AAA . n A 1 255 LYS 255 254 254 LYS LYS AAA . n A 1 256 PHE 256 255 255 PHE PHE AAA . n A 1 257 VAL 257 256 256 VAL VAL AAA . n A 1 258 ILE 258 257 257 ILE ILE AAA . n A 1 259 LYS 259 258 258 LYS LYS AAA . n A 1 260 PRO 260 259 259 PRO PRO AAA . n A 1 261 ILE 261 260 260 ILE ILE AAA . n A 1 262 ASP 262 261 261 ASP ASP AAA . n A 1 263 LYS 263 262 262 LYS LYS AAA . n A 1 264 LYS 264 263 263 LYS LYS AAA . n A 1 265 ALA 265 264 264 ALA ALA AAA . n A 1 266 PRO 266 265 265 PRO PRO AAA . n A 1 267 ASP 267 266 266 ASP ASP AAA . n A 1 268 PHE 268 267 267 PHE PHE AAA . n A 1 269 VAL 269 268 268 VAL VAL AAA . n A 1 270 PHE 270 269 269 PHE PHE AAA . n A 1 271 TYR 271 270 270 TYR TYR AAA . n A 1 272 ALA 272 271 271 ALA ALA AAA . n A 1 273 PRO 273 272 272 PRO PRO AAA . n A 1 274 ARG 274 273 273 ARG ARG AAA . n A 1 275 LEU 275 274 274 LEU LEU AAA . n A 1 276 ARG 276 275 275 ARG ARG AAA . n A 1 277 ILE 277 276 276 ILE ILE AAA . n A 1 278 ASN 278 277 277 ASN ASN AAA . n A 1 279 LYS 279 278 278 LYS LYS AAA . n A 1 280 ARG 280 279 279 ARG ARG AAA . n A 1 281 ILE 281 280 280 ILE ILE AAA . n A 1 282 LEU 282 281 281 LEU LEU AAA . n A 1 283 ALA 283 282 282 ALA ALA AAA . n A 1 284 LEU 284 283 283 LEU LEU AAA . n A 1 285 CYS 285 284 284 CYS CYS AAA . n A 1 286 MET 286 285 285 MET MET AAA . n A 1 287 GLY 287 286 286 GLY GLY AAA . n A 1 288 ASN 288 287 287 ASN ASN AAA . n A 1 289 HIS 289 288 288 HIS HIS AAA . n A 1 290 GLU 290 289 289 GLU GLU AAA . n A 1 291 LEU 291 290 290 LEU LEU AAA . n A 1 292 TYR 292 291 291 TYR TYR AAA . n A 1 293 MET 293 292 292 MET MET AAA . n A 1 294 ARG 294 293 293 ARG ARG AAA . n A 1 295 ARG 295 294 294 ARG ARG AAA . n A 1 296 ARG 296 295 295 ARG ARG AAA . n A 1 297 LYS 297 296 296 LYS LYS AAA . n A 1 298 PRO 298 297 297 PRO PRO AAA . n A 1 299 ASP 299 298 298 ASP ASP AAA . n A 1 300 THR 300 299 299 THR THR AAA . n A 1 301 ILE 301 300 300 ILE ILE AAA . n A 1 302 GLU 302 301 301 GLU GLU AAA . n A 1 303 VAL 303 302 302 VAL VAL AAA . n A 1 304 GLN 304 303 303 GLN GLN AAA . n A 1 305 GLN 305 304 304 GLN GLN AAA . n A 1 306 MET 306 305 305 MET MET AAA . n A 1 307 LYS 307 306 306 LYS LYS AAA . n A 1 308 ALA 308 307 307 ALA ALA AAA . n A 1 309 GLN 309 308 308 GLN GLN AAA . n A 1 310 ALA 310 309 309 ALA ALA AAA . n A 1 311 ARG 311 310 310 ARG ARG AAA . n A 1 312 GLU 312 311 311 GLU GLU AAA . n A 1 313 GLU 313 312 312 GLU GLU AAA . n A 1 314 LYS 314 313 313 LYS LYS AAA . n A 1 315 HIS 315 314 314 HIS HIS AAA . n A 1 316 GLN 316 315 315 GLN GLN AAA . n A 1 317 LYS 317 316 316 LYS LYS AAA . n A 1 318 GLN 318 317 317 GLN GLN AAA . n A 1 319 MET 319 318 318 MET MET AAA . n A 1 320 GLU 320 319 319 GLU GLU AAA . n A 1 321 ARG 321 320 320 ARG ARG AAA . n A 1 322 ALA 322 321 321 ALA ALA AAA . n A 1 323 MET 323 322 322 MET MET AAA . n A 1 324 LEU 324 323 323 LEU LEU AAA . n A 1 325 GLU 325 324 324 GLU GLU AAA . n A 1 326 ASN 326 325 325 ASN ASN AAA . n A 1 327 GLU 327 326 326 GLU GLU AAA . n A 1 328 LYS 328 327 327 LYS LYS AAA . n A 1 329 LYS 329 328 328 LYS LYS AAA . n A 1 330 LYS 330 329 329 LYS LYS AAA . n A 1 331 ARG 331 330 330 ARG ARG AAA . n A 1 332 GLU 332 331 331 GLU GLU AAA . n A 1 333 MET 333 332 332 MET MET AAA . n A 1 334 ALA 334 333 333 ALA ALA AAA . n A 1 335 GLU 335 334 334 GLU GLU AAA . n A 1 336 LYS 336 335 335 LYS LYS AAA . n A 1 337 GLU 337 336 336 GLU GLU AAA . n A 1 338 LYS 338 337 337 LYS LYS AAA . n A 1 339 GLU 339 338 338 GLU GLU AAA . n A 1 340 LYS 340 339 339 LYS LYS AAA . n A 1 341 ILE 341 340 340 ILE ILE AAA . n A 1 342 GLU 342 341 341 GLU GLU AAA . n A 1 343 ARG 343 342 342 ARG ARG AAA . n A 1 344 GLU 344 343 ? ? ? AAA . n A 1 345 LYS 345 344 ? ? ? AAA . n A 1 346 GLU 346 345 ? ? ? AAA . n A 1 347 GLU 347 346 ? ? ? AAA . n B 2 1 GLN 1 678 678 GLN GLN BBB . n B 2 2 LYS 2 679 679 LYS LYS BBB . n B 2 3 LYS 3 680 680 LYS LYS BBB . n B 2 4 LYS 4 681 681 LYS LYS BBB . n B 2 5 LEU 5 682 682 LEU LEU BBB . n B 2 6 VAL 6 683 683 VAL VAL BBB . n B 2 7 ILE 7 684 684 ILE ILE BBB . n B 2 8 ASN 8 685 685 ASN ASN BBB . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 HOH 1 401 36 HOH HOH AAA . C 3 HOH 2 402 26 HOH HOH AAA . C 3 HOH 3 403 10 HOH HOH AAA . C 3 HOH 4 404 4 HOH HOH AAA . C 3 HOH 5 405 12 HOH HOH AAA . C 3 HOH 6 406 18 HOH HOH AAA . C 3 HOH 7 407 38 HOH HOH AAA . C 3 HOH 8 408 1 HOH HOH AAA . C 3 HOH 9 409 25 HOH HOH AAA . C 3 HOH 10 410 9 HOH HOH AAA . C 3 HOH 11 411 15 HOH HOH AAA . C 3 HOH 12 412 7 HOH HOH AAA . C 3 HOH 13 413 5 HOH HOH AAA . C 3 HOH 14 414 29 HOH HOH AAA . C 3 HOH 15 415 39 HOH HOH AAA . C 3 HOH 16 416 24 HOH HOH AAA . C 3 HOH 17 417 11 HOH HOH AAA . C 3 HOH 18 418 6 HOH HOH AAA . C 3 HOH 19 419 33 HOH HOH AAA . C 3 HOH 20 420 22 HOH HOH AAA . C 3 HOH 21 421 8 HOH HOH AAA . C 3 HOH 22 422 3 HOH HOH AAA . C 3 HOH 23 423 23 HOH HOH AAA . C 3 HOH 24 424 2 HOH HOH AAA . C 3 HOH 25 425 20 HOH HOH AAA . C 3 HOH 26 426 34 HOH HOH AAA . C 3 HOH 27 427 28 HOH HOH AAA . C 3 HOH 28 428 31 HOH HOH AAA . C 3 HOH 29 429 32 HOH HOH AAA . C 3 HOH 30 430 30 HOH HOH AAA . C 3 HOH 31 431 27 HOH HOH AAA . C 3 HOH 32 432 19 HOH HOH AAA . C 3 HOH 33 433 16 HOH HOH AAA . C 3 HOH 34 434 14 HOH HOH AAA . C 3 HOH 35 435 21 HOH HOH AAA . C 3 HOH 36 436 13 HOH HOH AAA . D 3 HOH 1 701 35 HOH HOH BBB . D 3 HOH 2 702 17 HOH HOH BBB . D 3 HOH 3 703 37 HOH HOH BBB . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0267 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? DIALS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6TXS _cell.details ? _cell.formula_units_Z ? _cell.length_a 119.967 _cell.length_a_esd ? _cell.length_b 119.967 _cell.length_b_esd ? _cell.length_c 64.596 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6TXS _symmetry.cell_setting ? _symmetry.Int_Tables_number 80 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'I 41' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6TXS _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.76 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 55.42 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2M potassium thiocyanate, 0.1M bis-tris pH 7.0, 10% ethylene glycol, 20% PEG3350' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER2 XE 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2019-11-25 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9795 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I04' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9795 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I04 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6TXS _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.2 _reflns.d_resolution_low 84.83 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 23382 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.7 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 23.7 _reflns.pdbx_Rmerge_I_obs 0.166 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 11.1 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.90 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.173 _reflns.pdbx_Rpim_I_all 0.048 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.20 _reflns_shell.d_res_low 2.27 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 0.6 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1977 _reflns_shell.percent_possible_all 96.4 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 3.189 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 11.7 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared 0.82 _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 3.492 _reflns_shell.pdbx_Rpim_I_all 1.372 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.460 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] -2.521 _refine.aniso_B[1][2] 0.000 _refine.aniso_B[1][3] 0.000 _refine.aniso_B[2][2] -2.521 _refine.aniso_B[2][3] 0.000 _refine.aniso_B[3][3] 5.042 _refine.B_iso_max ? _refine.B_iso_mean 61.379 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.947 _refine.correlation_coeff_Fo_to_Fc_free 0.933 _refine.details 'Hydrogens have been added in their riding positions' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6TXS _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.200 _refine.ls_d_res_low 84.830 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 23293 _refine.ls_number_reflns_R_free 1034 _refine.ls_number_reflns_R_work 22259 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.318 _refine.ls_percent_reflns_R_free 4.439 _refine.ls_R_factor_all 0.234 _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_free 0.2758 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2322 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free 0.263 _refine.ls_wR_factor_R_work 0.215 _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'MASK BULK SOLVENT' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1E5W _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.275 _refine.pdbx_overall_ESU_R_Free 0.225 _refine.pdbx_solvent_vdw_probe_radii 1.200 _refine.pdbx_solvent_ion_probe_radii 0.800 _refine.pdbx_solvent_shrinkage_radii 0.800 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 11.746 _refine.overall_SU_ML 0.264 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work 0.7584 _refine.pdbx_average_fsc_free 0.7371 # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.200 _refine_hist.d_res_low 84.830 _refine_hist.number_atoms_solvent 39 _refine_hist.number_atoms_total 2944 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 2905 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.007 0.013 2962 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.017 2919 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.470 1.651 3975 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.217 1.593 6730 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 6.960 5.000 346 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 33.066 22.733 172 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 17.473 15.000 596 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 20.109 15.000 21 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.057 0.200 367 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.006 0.020 3288 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 694 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? 0.210 0.200 584 ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.177 0.200 2551 ? r_symmetry_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.166 0.200 1368 ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? 0.076 0.200 1519 ? r_symmetry_nbtor_other ? ? 'X-RAY DIFFRACTION' ? 0.162 0.200 71 ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.240 0.200 9 ? r_symmetry_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.186 0.200 32 ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.162 0.200 5 ? r_symmetry_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 4.769 6.075 1390 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 4.770 6.074 1389 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 6.660 9.109 1734 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 6.658 9.110 1735 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 5.104 6.663 1572 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 5.103 6.663 1572 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? 7.816 9.704 2241 ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 7.816 9.704 2241 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 9.832 68.157 3236 ? r_lrange_it ? ? 'X-RAY DIFFRACTION' ? 9.830 68.173 3236 ? r_lrange_other ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.200 2.257 1731 . 90 1570 95.8983 . 0.428 . 0.340 . 0.434 . . . . . 0.438 . 20 . 0.313 0.355 'X-RAY DIFFRACTION' 2.257 2.319 1687 . 67 1614 99.6443 . 0.371 . 0.394 . 0.370 . . . . . 0.364 . 20 . 0.334 0.313 'X-RAY DIFFRACTION' 2.319 2.386 1636 . 59 1577 100.0000 . 0.356 . 0.347 . 0.357 . . . . . 0.342 . 20 . 0.484 0.488 'X-RAY DIFFRACTION' 2.386 2.460 1567 . 95 1472 100.0000 . 0.349 . 0.382 . 0.347 . . . . . 0.328 . 20 . 0.651 0.647 'X-RAY DIFFRACTION' 2.460 2.540 1517 . 72 1434 99.2749 . 0.340 . 0.318 . 0.341 . . . . . 0.316 . 20 . 0.707 0.662 'X-RAY DIFFRACTION' 2.540 2.629 1510 . 64 1433 99.1391 . 0.283 . 0.276 . 0.283 . . . . . 0.259 . 20 . 0.824 0.832 'X-RAY DIFFRACTION' 2.629 2.728 1444 . 49 1379 98.8920 . 0.264 . 0.368 . 0.260 . . . . . 0.229 . 20 . 0.868 0.818 'X-RAY DIFFRACTION' 2.728 2.840 1393 . 74 1303 98.8514 . 0.258 . 0.335 . 0.255 . . . . . 0.229 . 20 . 0.873 0.826 'X-RAY DIFFRACTION' 2.840 2.966 1310 . 66 1233 99.1603 . 0.251 . 0.368 . 0.245 . . . . . 0.222 . 20 . 0.885 0.862 'X-RAY DIFFRACTION' 2.966 3.110 1269 . 55 1210 99.6848 . 0.244 . 0.272 . 0.243 . . . . . 0.224 . 20 . 0.890 0.884 'X-RAY DIFFRACTION' 3.110 3.278 1216 . 37 1176 99.7533 . 0.248 . 0.368 . 0.244 . . . . . 0.227 . 20 . 0.896 0.860 'X-RAY DIFFRACTION' 3.278 3.477 1143 . 30 1111 99.8250 . 0.250 . 0.267 . 0.249 . . . . . 0.240 . 20 . 0.902 0.875 'X-RAY DIFFRACTION' 3.477 3.717 1069 . 39 1029 99.9065 . 0.248 . 0.340 . 0.244 . . . . . 0.236 . 20 . 0.892 0.846 'X-RAY DIFFRACTION' 3.717 4.014 1032 . 46 984 99.8062 . 0.204 . 0.246 . 0.202 . . . . . 0.198 . 20 . 0.932 0.928 'X-RAY DIFFRACTION' 4.014 4.396 909 . 45 863 99.8900 . 0.172 . 0.196 . 0.171 . . . . . 0.171 . 20 . 0.955 0.949 'X-RAY DIFFRACTION' 4.396 4.913 837 . 32 805 100.0000 . 0.155 . 0.175 . 0.154 . . . . . 0.156 . 20 . 0.964 0.956 'X-RAY DIFFRACTION' 4.913 5.670 767 . 55 712 100.0000 . 0.219 . 0.310 . 0.212 . . . . . 0.213 . 20 . 0.930 0.913 'X-RAY DIFFRACTION' 5.670 6.936 624 . 26 598 100.0000 . 0.228 . 0.323 . 0.224 . . . . . 0.224 . 20 . 0.927 0.854 'X-RAY DIFFRACTION' 6.936 9.777 498 . 18 479 99.7992 . 0.165 . 0.207 . 0.163 . . . . . 0.169 . 20 . 0.960 0.964 'X-RAY DIFFRACTION' 9.777 84.830 292 . 15 277 100.0000 . 0.213 . 0.158 . 0.217 . . . . . 0.230 . 20 . 0.957 0.965 # _struct.entry_id 6TXS _struct.title 'The structure of the FERM domain and helical linker of human moesin bound to a CD44 peptide' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6TXS _struct_keywords.text ;PIP, FERM domain, Alzheimer's disease, CD44, PROTEIN BINDING ; _struct_keywords.pdbx_keywords 'PROTEIN BINDING' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP MOES_HUMAN P26038 ? 1 ;MPKTISVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWFFGLQYQDTKGFSTWLKLNKKVTAQDVRKESPLLFKF RAKFYPEDVSEELIQDITQRLFFLQVKEGILNDDIYCPPETAVLLASYAVQSKYGDFNKEVHKSGYLAGDKLLPQRVLEQ HKLNKDQWEERIQVWHEEHRGMLREDAVLEYLKIAQDLEMYGVNYFSIKNKKGSELWLGVDALGLNIYEQNDRLTPKIGF PWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKPDTIEVQQMKAQAREEKHQKQMER AMLENEKKKREMAEKEKEKIEREKEE ; 1 2 UNP CD44_HUMAN P16070 ? 2 QKKKLVIN 678 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 6TXS AAA 2 ? 347 ? P26038 1 ? 346 ? 1 346 2 2 6TXS BBB 1 ? 8 ? P16070 678 ? 685 ? 678 685 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 6TXS _struct_ref_seq_dif.mon_id SER _struct_ref_seq_dif.pdbx_pdb_strand_id AAA _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P26038 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'expression tag' _struct_ref_seq_dif.pdbx_auth_seq_num 0 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1220 ? 1 MORE -5 ? 1 'SSA (A^2)' 20750 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'surface plasmon resonance' _pdbx_struct_assembly_auth_evidence.details 'A longer version of the same peptide has been shown to bind with a Kd of 70 nm' # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 26 ? ILE A 38 ? THR AAA 25 ILE AAA 37 1 ? 13 HELX_P HELX_P2 AA2 GLU A 42 ? TRP A 44 ? GLU AAA 41 TRP AAA 43 5 ? 3 HELX_P HELX_P3 AA3 LYS A 65 ? GLN A 69 ? LYS AAA 64 GLN AAA 68 5 ? 5 HELX_P HELX_P4 AA4 ASP A 89 ? LEU A 94 ? ASP AAA 88 LEU AAA 93 1 ? 6 HELX_P HELX_P5 AA5 GLN A 96 ? ASN A 113 ? GLN AAA 95 ASN AAA 112 1 ? 18 HELX_P HELX_P6 AA6 PRO A 119 ? GLY A 136 ? PRO AAA 118 GLY AAA 135 1 ? 18 HELX_P HELX_P7 AA7 PRO A 155 ? GLN A 161 ? PRO AAA 154 GLN AAA 160 1 ? 7 HELX_P HELX_P8 AA8 ASN A 165 ? HIS A 180 ? ASN AAA 164 HIS AAA 179 1 ? 16 HELX_P HELX_P9 AA9 LEU A 184 ? GLN A 197 ? LEU AAA 183 GLN AAA 196 1 ? 14 HELX_P HELX_P10 AB1 ARG A 274 ? ARG A 296 ? ARG AAA 273 ARG AAA 295 1 ? 23 HELX_P HELX_P11 AB2 THR A 300 ? ARG A 343 ? THR AAA 299 ARG AAA 342 1 ? 44 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id SER _struct_mon_prot_cis.label_seq_id 75 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id SER _struct_mon_prot_cis.auth_seq_id 74 _struct_mon_prot_cis.auth_asym_id AAA _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 76 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 75 _struct_mon_prot_cis.pdbx_auth_asym_id_2 AAA _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 10.80 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 4 ? AA3 ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ALA A 15 ? ILE A 21 ? ALA AAA 14 ILE AAA 20 AA1 2 ILE A 6 ? THR A 12 ? ILE AAA 5 THR AAA 11 AA1 3 LEU A 77 ? ALA A 83 ? LEU AAA 76 ALA AAA 82 AA1 4 PHE A 46 ? GLN A 51 ? PHE AAA 45 GLN AAA 50 AA1 5 SER A 57 ? TRP A 59 ? SER AAA 56 TRP AAA 58 AA2 1 ASN A 205 ? LYS A 210 ? ASN AAA 204 LYS AAA 209 AA2 2 GLU A 216 ? ASP A 222 ? GLU AAA 215 ASP AAA 221 AA2 3 GLY A 225 ? GLU A 230 ? GLY AAA 224 GLU AAA 229 AA2 4 ILE A 239 ? PRO A 242 ? ILE AAA 238 PRO AAA 241 AA3 1 PHE A 268 ? TYR A 271 ? PHE AAA 267 TYR AAA 270 AA3 2 LYS A 255 ? PRO A 260 ? LYS AAA 254 PRO AAA 259 AA3 3 ILE A 246 ? ASN A 252 ? ILE AAA 245 ASN AAA 251 AA3 4 LYS B 2 ? VAL B 6 ? LYS BBB 679 VAL BBB 683 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O LEU A 17 ? O LEU AAA 16 N VAL A 10 ? N VAL AAA 9 AA1 2 3 N ARG A 9 ? N ARG AAA 8 O LEU A 77 ? O LEU AAA 76 AA1 3 4 O LYS A 80 ? O LYS AAA 79 N GLN A 49 ? N GLN AAA 48 AA1 4 5 N TYR A 50 ? N TYR AAA 49 O THR A 58 ? O THR AAA 57 AA2 1 2 N ILE A 209 ? N ILE AAA 208 O LEU A 217 ? O LEU AAA 216 AA2 2 3 N GLY A 220 ? N GLY AAA 219 O ASN A 227 ? O ASN AAA 226 AA2 3 4 N LEU A 226 ? N LEU AAA 225 O PHE A 241 ? O PHE AAA 240 AA3 1 2 O PHE A 270 ? O PHE AAA 269 N PHE A 256 ? N PHE AAA 255 AA3 2 3 O VAL A 257 ? O VAL AAA 256 N SER A 250 ? N SER AAA 249 AA3 3 4 N ILE A 249 ? N ILE AAA 248 O LEU B 5 ? O LEU BBB 682 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP AAA 13 ? ? -147.91 28.89 2 1 LEU AAA 163 ? ? -45.57 151.54 3 1 ASP AAA 252 ? ? 58.18 -117.32 4 1 ARG AAA 295 ? ? -108.79 47.20 5 1 ASP AAA 298 ? ? -35.41 133.15 6 1 ALA AAA 333 ? ? -45.34 -14.57 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 AAA SER 0 ? A SER 1 2 1 Y 1 AAA MET 1 ? A MET 2 3 1 Y 1 AAA PRO 2 ? A PRO 3 4 1 Y 1 AAA GLU 343 ? A GLU 344 5 1 Y 1 AAA LYS 344 ? A LYS 345 6 1 Y 1 AAA GLU 345 ? A GLU 346 7 1 Y 1 AAA GLU 346 ? A GLU 347 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SER N N N N 290 SER CA C N S 291 SER C C N N 292 SER O O N N 293 SER CB C N N 294 SER OG O N N 295 SER OXT O N N 296 SER H H N N 297 SER H2 H N N 298 SER HA H N N 299 SER HB2 H N N 300 SER HB3 H N N 301 SER HG H N N 302 SER HXT H N N 303 THR N N N N 304 THR CA C N S 305 THR C C N N 306 THR O O N N 307 THR CB C N R 308 THR OG1 O N N 309 THR CG2 C N N 310 THR OXT O N N 311 THR H H N N 312 THR H2 H N N 313 THR HA H N N 314 THR HB H N N 315 THR HG1 H N N 316 THR HG21 H N N 317 THR HG22 H N N 318 THR HG23 H N N 319 THR HXT H N N 320 TRP N N N N 321 TRP CA C N S 322 TRP C C N N 323 TRP O O N N 324 TRP CB C N N 325 TRP CG C Y N 326 TRP CD1 C Y N 327 TRP CD2 C Y N 328 TRP NE1 N Y N 329 TRP CE2 C Y N 330 TRP CE3 C Y N 331 TRP CZ2 C Y N 332 TRP CZ3 C Y N 333 TRP CH2 C Y N 334 TRP OXT O N N 335 TRP H H N N 336 TRP H2 H N N 337 TRP HA H N N 338 TRP HB2 H N N 339 TRP HB3 H N N 340 TRP HD1 H N N 341 TRP HE1 H N N 342 TRP HE3 H N N 343 TRP HZ2 H N N 344 TRP HZ3 H N N 345 TRP HH2 H N N 346 TRP HXT H N N 347 TYR N N N N 348 TYR CA C N S 349 TYR C C N N 350 TYR O O N N 351 TYR CB C N N 352 TYR CG C Y N 353 TYR CD1 C Y N 354 TYR CD2 C Y N 355 TYR CE1 C Y N 356 TYR CE2 C Y N 357 TYR CZ C Y N 358 TYR OH O N N 359 TYR OXT O N N 360 TYR H H N N 361 TYR H2 H N N 362 TYR HA H N N 363 TYR HB2 H N N 364 TYR HB3 H N N 365 TYR HD1 H N N 366 TYR HD2 H N N 367 TYR HE1 H N N 368 TYR HE2 H N N 369 TYR HH H N N 370 TYR HXT H N N 371 VAL N N N N 372 VAL CA C N S 373 VAL C C N N 374 VAL O O N N 375 VAL CB C N N 376 VAL CG1 C N N 377 VAL CG2 C N N 378 VAL OXT O N N 379 VAL H H N N 380 VAL H2 H N N 381 VAL HA H N N 382 VAL HB H N N 383 VAL HG11 H N N 384 VAL HG12 H N N 385 VAL HG13 H N N 386 VAL HG21 H N N 387 VAL HG22 H N N 388 VAL HG23 H N N 389 VAL HXT H N N 390 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute on Aging (NIH/NIA)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number 1U54AG065187-01 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1E5W _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 6TXS _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.008336 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.008336 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.015481 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.pdbx_scat_Z _atom_type.pdbx_N_electrons _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c C 6 6 2.310 20.844 1.020 10.208 1.589 0.569 0.865 51.651 0.216 H 1 1 0.493 10.511 0.323 26.126 0.140 3.142 0.041 57.800 0.003 N 7 7 12.222 0.006 3.135 9.893 2.014 28.997 1.167 0.583 -11.538 O 8 8 3.049 13.277 2.287 5.701 1.546 0.324 0.867 32.909 0.251 S 16 16 6.905 1.468 5.203 22.215 1.438 0.254 1.586 56.172 1.050 # loop_