data_6UAQ # _entry.id 6UAQ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.387 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6UAQ pdb_00006uaq 10.2210/pdb6uaq/pdb WWPDB D_1000242413 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-05-20 2 'Structure model' 1 1 2020-06-10 3 'Structure model' 1 2 2020-08-05 4 'Structure model' 1 3 2024-03-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 3 'Structure model' 'Derived calculations' 4 4 'Structure model' 'Data collection' 5 4 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 3 'Structure model' pdbx_struct_conn_angle 5 3 'Structure model' struct_conn 6 4 'Structure model' chem_comp_atom 7 4 'Structure model' chem_comp_bond 8 4 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.pdbx_database_id_PubMed' 2 2 'Structure model' '_citation.title' 3 3 'Structure model' '_citation.journal_volume' 4 3 'Structure model' '_citation.page_first' 5 3 'Structure model' '_citation.page_last' 6 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 7 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 8 3 'Structure model' '_pdbx_struct_conn_angle.value' 9 3 'Structure model' '_struct_conn.pdbx_dist_value' 10 3 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 11 4 'Structure model' '_database_2.pdbx_DOI' 12 4 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6UAQ _pdbx_database_status.recvd_initial_deposition_date 2019-09-11 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Costa, P.A.C.R.' 1 ? 'Santos, C.R.' 2 ? 'Murakami, M.T.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Nat.Chem.Biol. _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1552-4469 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 16 _citation.language ? _citation.page_first 920 _citation.page_last 929 _citation.title 'Structural insights into beta-1,3-glucan cleavage by a glycoside hydrolase family.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41589-020-0554-5 _citation.pdbx_database_id_PubMed 32451508 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Santos, C.R.' 1 ? primary 'Costa, P.A.C.R.' 2 ? primary 'Vieira, P.S.' 3 ? primary 'Gonzalez, S.E.T.' 4 ? primary 'Correa, T.L.R.' 5 ? primary 'Lima, E.A.' 6 ? primary 'Mandelli, F.' 7 ? primary 'Pirolla, R.A.S.' 8 ? primary 'Domingues, M.N.' 9 ? primary 'Cabral, L.' 10 ? primary 'Martins, M.P.' 11 ? primary 'Cordeiro, R.L.' 12 ? primary 'Junior, A.T.' 13 ? primary 'Souza, B.P.' 14 ? primary 'Prates, E.T.' 15 ? primary 'Gozzo, F.C.' 16 ? primary 'Persinoti, G.F.' 17 ? primary 'Skaf, M.S.' 18 ? primary 'Murakami, M.T.' 19 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Glyco_hydro_cc domain-containing protein' 27917.928 1 ? ? ? ? 2 non-polymer syn GLYCEROL 92.094 3 ? ? ? ? 3 non-polymer syn 'SODIUM ION' 22.990 1 ? ? ? ? 4 water nat water 18.015 355 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGSSHHHHHHSSGLVPAGSHMAGTKKGVSAAAFSGVTAALGDVGARWFYTWAADPQGITAPAGTEFVPMIWGRDSVTADQ LQRAKAAGSTLLAFNEPDLAGQANMSVETALDLWPQLQATGMRLGAPAVAYGGDTPGGWLDRFMSGAAARGYRVDFIPLH WYGGDFSAAATGQLQSYLQAVYNRYHRPIWLTEYALTDFSGSTPRYPSAAEQADFVSRSTAMLNGLSFVERYAWFSLSTS TTPTGLYTGTTPNSSGVAYRAAG ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSSHHHHHHSSGLVPAGSHMAGTKKGVSAAAFSGVTAALGDVGARWFYTWAADPQGITAPAGTEFVPMIWGRDSVTADQ LQRAKAAGSTLLAFNEPDLAGQANMSVETALDLWPQLQATGMRLGAPAVAYGGDTPGGWLDRFMSGAAARGYRVDFIPLH WYGGDFSAAATGQLQSYLQAVYNRYHRPIWLTEYALTDFSGSTPRYPSAAEQADFVSRSTAMLNGLSFVERYAWFSLSTS TTPTGLYTGTTPNSSGVAYRAAG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 GLYCEROL GOL 3 'SODIUM ION' NA 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 SER n 1 12 SER n 1 13 GLY n 1 14 LEU n 1 15 VAL n 1 16 PRO n 1 17 ALA n 1 18 GLY n 1 19 SER n 1 20 HIS n 1 21 MET n 1 22 ALA n 1 23 GLY n 1 24 THR n 1 25 LYS n 1 26 LYS n 1 27 GLY n 1 28 VAL n 1 29 SER n 1 30 ALA n 1 31 ALA n 1 32 ALA n 1 33 PHE n 1 34 SER n 1 35 GLY n 1 36 VAL n 1 37 THR n 1 38 ALA n 1 39 ALA n 1 40 LEU n 1 41 GLY n 1 42 ASP n 1 43 VAL n 1 44 GLY n 1 45 ALA n 1 46 ARG n 1 47 TRP n 1 48 PHE n 1 49 TYR n 1 50 THR n 1 51 TRP n 1 52 ALA n 1 53 ALA n 1 54 ASP n 1 55 PRO n 1 56 GLN n 1 57 GLY n 1 58 ILE n 1 59 THR n 1 60 ALA n 1 61 PRO n 1 62 ALA n 1 63 GLY n 1 64 THR n 1 65 GLU n 1 66 PHE n 1 67 VAL n 1 68 PRO n 1 69 MET n 1 70 ILE n 1 71 TRP n 1 72 GLY n 1 73 ARG n 1 74 ASP n 1 75 SER n 1 76 VAL n 1 77 THR n 1 78 ALA n 1 79 ASP n 1 80 GLN n 1 81 LEU n 1 82 GLN n 1 83 ARG n 1 84 ALA n 1 85 LYS n 1 86 ALA n 1 87 ALA n 1 88 GLY n 1 89 SER n 1 90 THR n 1 91 LEU n 1 92 LEU n 1 93 ALA n 1 94 PHE n 1 95 ASN n 1 96 GLU n 1 97 PRO n 1 98 ASP n 1 99 LEU n 1 100 ALA n 1 101 GLY n 1 102 GLN n 1 103 ALA n 1 104 ASN n 1 105 MET n 1 106 SER n 1 107 VAL n 1 108 GLU n 1 109 THR n 1 110 ALA n 1 111 LEU n 1 112 ASP n 1 113 LEU n 1 114 TRP n 1 115 PRO n 1 116 GLN n 1 117 LEU n 1 118 GLN n 1 119 ALA n 1 120 THR n 1 121 GLY n 1 122 MET n 1 123 ARG n 1 124 LEU n 1 125 GLY n 1 126 ALA n 1 127 PRO n 1 128 ALA n 1 129 VAL n 1 130 ALA n 1 131 TYR n 1 132 GLY n 1 133 GLY n 1 134 ASP n 1 135 THR n 1 136 PRO n 1 137 GLY n 1 138 GLY n 1 139 TRP n 1 140 LEU n 1 141 ASP n 1 142 ARG n 1 143 PHE n 1 144 MET n 1 145 SER n 1 146 GLY n 1 147 ALA n 1 148 ALA n 1 149 ALA n 1 150 ARG n 1 151 GLY n 1 152 TYR n 1 153 ARG n 1 154 VAL n 1 155 ASP n 1 156 PHE n 1 157 ILE n 1 158 PRO n 1 159 LEU n 1 160 HIS n 1 161 TRP n 1 162 TYR n 1 163 GLY n 1 164 GLY n 1 165 ASP n 1 166 PHE n 1 167 SER n 1 168 ALA n 1 169 ALA n 1 170 ALA n 1 171 THR n 1 172 GLY n 1 173 GLN n 1 174 LEU n 1 175 GLN n 1 176 SER n 1 177 TYR n 1 178 LEU n 1 179 GLN n 1 180 ALA n 1 181 VAL n 1 182 TYR n 1 183 ASN n 1 184 ARG n 1 185 TYR n 1 186 HIS n 1 187 ARG n 1 188 PRO n 1 189 ILE n 1 190 TRP n 1 191 LEU n 1 192 THR n 1 193 GLU n 1 194 TYR n 1 195 ALA n 1 196 LEU n 1 197 THR n 1 198 ASP n 1 199 PHE n 1 200 SER n 1 201 GLY n 1 202 SER n 1 203 THR n 1 204 PRO n 1 205 ARG n 1 206 TYR n 1 207 PRO n 1 208 SER n 1 209 ALA n 1 210 ALA n 1 211 GLU n 1 212 GLN n 1 213 ALA n 1 214 ASP n 1 215 PHE n 1 216 VAL n 1 217 SER n 1 218 ARG n 1 219 SER n 1 220 THR n 1 221 ALA n 1 222 MET n 1 223 LEU n 1 224 ASN n 1 225 GLY n 1 226 LEU n 1 227 SER n 1 228 PHE n 1 229 VAL n 1 230 GLU n 1 231 ARG n 1 232 TYR n 1 233 ALA n 1 234 TRP n 1 235 PHE n 1 236 SER n 1 237 LEU n 1 238 SER n 1 239 THR n 1 240 SER n 1 241 THR n 1 242 THR n 1 243 PRO n 1 244 THR n 1 245 GLY n 1 246 LEU n 1 247 TYR n 1 248 THR n 1 249 GLY n 1 250 THR n 1 251 THR n 1 252 PRO n 1 253 ASN n 1 254 SER n 1 255 SER n 1 256 GLY n 1 257 VAL n 1 258 ALA n 1 259 TYR n 1 260 ARG n 1 261 ALA n 1 262 ALA n 1 263 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 263 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Amycolatopsis mediterranei' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 33910 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NA non-polymer . 'SODIUM ION' ? 'Na 1' 22.990 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 7 ? ? ? A . n A 1 2 GLY 2 8 ? ? ? A . n A 1 3 SER 3 9 ? ? ? A . n A 1 4 SER 4 10 ? ? ? A . n A 1 5 HIS 5 11 ? ? ? A . n A 1 6 HIS 6 12 ? ? ? A . n A 1 7 HIS 7 13 ? ? ? A . n A 1 8 HIS 8 14 ? ? ? A . n A 1 9 HIS 9 15 ? ? ? A . n A 1 10 HIS 10 16 ? ? ? A . n A 1 11 SER 11 17 ? ? ? A . n A 1 12 SER 12 18 ? ? ? A . n A 1 13 GLY 13 19 ? ? ? A . n A 1 14 LEU 14 20 ? ? ? A . n A 1 15 VAL 15 21 ? ? ? A . n A 1 16 PRO 16 22 ? ? ? A . n A 1 17 ALA 17 23 ? ? ? A . n A 1 18 GLY 18 24 ? ? ? A . n A 1 19 SER 19 25 ? ? ? A . n A 1 20 HIS 20 26 ? ? ? A . n A 1 21 MET 21 27 ? ? ? A . n A 1 22 ALA 22 28 ? ? ? A . n A 1 23 GLY 23 29 29 GLY GLY A . n A 1 24 THR 24 30 30 THR THR A . n A 1 25 LYS 25 31 31 LYS LYS A . n A 1 26 LYS 26 32 32 LYS LYS A . n A 1 27 GLY 27 33 33 GLY GLY A . n A 1 28 VAL 28 34 34 VAL VAL A . n A 1 29 SER 29 35 35 SER SER A . n A 1 30 ALA 30 36 36 ALA ALA A . n A 1 31 ALA 31 37 37 ALA ALA A . n A 1 32 ALA 32 38 38 ALA ALA A . n A 1 33 PHE 33 39 39 PHE PHE A . n A 1 34 SER 34 40 40 SER SER A . n A 1 35 GLY 35 41 41 GLY GLY A . n A 1 36 VAL 36 42 42 VAL VAL A . n A 1 37 THR 37 43 43 THR THR A . n A 1 38 ALA 38 44 44 ALA ALA A . n A 1 39 ALA 39 45 45 ALA ALA A . n A 1 40 LEU 40 46 46 LEU LEU A . n A 1 41 GLY 41 47 47 GLY GLY A . n A 1 42 ASP 42 48 48 ASP ASP A . n A 1 43 VAL 43 49 49 VAL VAL A . n A 1 44 GLY 44 50 50 GLY GLY A . n A 1 45 ALA 45 51 51 ALA ALA A . n A 1 46 ARG 46 52 52 ARG ARG A . n A 1 47 TRP 47 53 53 TRP TRP A . n A 1 48 PHE 48 54 54 PHE PHE A . n A 1 49 TYR 49 55 55 TYR TYR A . n A 1 50 THR 50 56 56 THR THR A . n A 1 51 TRP 51 57 57 TRP TRP A . n A 1 52 ALA 52 58 58 ALA ALA A . n A 1 53 ALA 53 59 59 ALA ALA A . n A 1 54 ASP 54 60 60 ASP ASP A . n A 1 55 PRO 55 61 61 PRO PRO A . n A 1 56 GLN 56 62 62 GLN GLN A . n A 1 57 GLY 57 63 63 GLY GLY A . n A 1 58 ILE 58 64 64 ILE ILE A . n A 1 59 THR 59 65 65 THR THR A . n A 1 60 ALA 60 66 66 ALA ALA A . n A 1 61 PRO 61 67 67 PRO PRO A . n A 1 62 ALA 62 68 68 ALA ALA A . n A 1 63 GLY 63 69 69 GLY GLY A . n A 1 64 THR 64 70 70 THR THR A . n A 1 65 GLU 65 71 71 GLU GLU A . n A 1 66 PHE 66 72 72 PHE PHE A . n A 1 67 VAL 67 73 73 VAL VAL A . n A 1 68 PRO 68 74 74 PRO PRO A . n A 1 69 MET 69 75 75 MET MET A . n A 1 70 ILE 70 76 76 ILE ILE A . n A 1 71 TRP 71 77 77 TRP TRP A . n A 1 72 GLY 72 78 78 GLY GLY A . n A 1 73 ARG 73 79 79 ARG ARG A . n A 1 74 ASP 74 80 80 ASP ASP A . n A 1 75 SER 75 81 81 SER SER A . n A 1 76 VAL 76 82 82 VAL VAL A . n A 1 77 THR 77 83 83 THR THR A . n A 1 78 ALA 78 84 84 ALA ALA A . n A 1 79 ASP 79 85 85 ASP ASP A . n A 1 80 GLN 80 86 86 GLN GLN A . n A 1 81 LEU 81 87 87 LEU LEU A . n A 1 82 GLN 82 88 88 GLN GLN A . n A 1 83 ARG 83 89 89 ARG ARG A . n A 1 84 ALA 84 90 90 ALA ALA A . n A 1 85 LYS 85 91 91 LYS LYS A . n A 1 86 ALA 86 92 92 ALA ALA A . n A 1 87 ALA 87 93 93 ALA ALA A . n A 1 88 GLY 88 94 94 GLY GLY A . n A 1 89 SER 89 95 95 SER SER A . n A 1 90 THR 90 96 96 THR THR A . n A 1 91 LEU 91 97 97 LEU LEU A . n A 1 92 LEU 92 98 98 LEU LEU A . n A 1 93 ALA 93 99 99 ALA ALA A . n A 1 94 PHE 94 100 100 PHE PHE A . n A 1 95 ASN 95 101 101 ASN ASN A . n A 1 96 GLU 96 102 102 GLU GLU A . n A 1 97 PRO 97 103 103 PRO PRO A . n A 1 98 ASP 98 104 104 ASP ASP A . n A 1 99 LEU 99 105 105 LEU LEU A . n A 1 100 ALA 100 106 106 ALA ALA A . n A 1 101 GLY 101 107 107 GLY GLY A . n A 1 102 GLN 102 108 108 GLN GLN A . n A 1 103 ALA 103 109 109 ALA ALA A . n A 1 104 ASN 104 110 110 ASN ASN A . n A 1 105 MET 105 111 111 MET MET A . n A 1 106 SER 106 112 112 SER SER A . n A 1 107 VAL 107 113 113 VAL VAL A . n A 1 108 GLU 108 114 114 GLU GLU A . n A 1 109 THR 109 115 115 THR THR A . n A 1 110 ALA 110 116 116 ALA ALA A . n A 1 111 LEU 111 117 117 LEU LEU A . n A 1 112 ASP 112 118 118 ASP ASP A . n A 1 113 LEU 113 119 119 LEU LEU A . n A 1 114 TRP 114 120 120 TRP TRP A . n A 1 115 PRO 115 121 121 PRO PRO A . n A 1 116 GLN 116 122 122 GLN GLN A . n A 1 117 LEU 117 123 123 LEU LEU A . n A 1 118 GLN 118 124 124 GLN GLN A . n A 1 119 ALA 119 125 125 ALA ALA A . n A 1 120 THR 120 126 126 THR THR A . n A 1 121 GLY 121 127 127 GLY GLY A . n A 1 122 MET 122 128 128 MET MET A . n A 1 123 ARG 123 129 129 ARG ARG A . n A 1 124 LEU 124 130 130 LEU LEU A . n A 1 125 GLY 125 131 131 GLY GLY A . n A 1 126 ALA 126 132 132 ALA ALA A . n A 1 127 PRO 127 133 133 PRO PRO A . n A 1 128 ALA 128 134 134 ALA ALA A . n A 1 129 VAL 129 135 135 VAL VAL A . n A 1 130 ALA 130 136 136 ALA ALA A . n A 1 131 TYR 131 137 137 TYR TYR A . n A 1 132 GLY 132 138 138 GLY GLY A . n A 1 133 GLY 133 139 139 GLY GLY A . n A 1 134 ASP 134 140 140 ASP ASP A . n A 1 135 THR 135 141 141 THR THR A . n A 1 136 PRO 136 142 142 PRO PRO A . n A 1 137 GLY 137 143 143 GLY GLY A . n A 1 138 GLY 138 144 144 GLY GLY A . n A 1 139 TRP 139 145 145 TRP TRP A . n A 1 140 LEU 140 146 146 LEU LEU A . n A 1 141 ASP 141 147 147 ASP ASP A . n A 1 142 ARG 142 148 148 ARG ARG A . n A 1 143 PHE 143 149 149 PHE PHE A . n A 1 144 MET 144 150 150 MET MET A . n A 1 145 SER 145 151 151 SER SER A . n A 1 146 GLY 146 152 152 GLY GLY A . n A 1 147 ALA 147 153 153 ALA ALA A . n A 1 148 ALA 148 154 154 ALA ALA A . n A 1 149 ALA 149 155 155 ALA ALA A . n A 1 150 ARG 150 156 156 ARG ARG A . n A 1 151 GLY 151 157 157 GLY GLY A . n A 1 152 TYR 152 158 158 TYR TYR A . n A 1 153 ARG 153 159 159 ARG ARG A . n A 1 154 VAL 154 160 160 VAL VAL A . n A 1 155 ASP 155 161 161 ASP ASP A . n A 1 156 PHE 156 162 162 PHE PHE A . n A 1 157 ILE 157 163 163 ILE ILE A . n A 1 158 PRO 158 164 164 PRO PRO A . n A 1 159 LEU 159 165 165 LEU LEU A . n A 1 160 HIS 160 166 166 HIS HIS A . n A 1 161 TRP 161 167 167 TRP TRP A . n A 1 162 TYR 162 168 168 TYR TYR A . n A 1 163 GLY 163 169 169 GLY GLY A . n A 1 164 GLY 164 170 170 GLY GLY A . n A 1 165 ASP 165 171 171 ASP ASP A . n A 1 166 PHE 166 172 172 PHE PHE A . n A 1 167 SER 167 173 173 SER SER A . n A 1 168 ALA 168 174 174 ALA ALA A . n A 1 169 ALA 169 175 175 ALA ALA A . n A 1 170 ALA 170 176 176 ALA ALA A . n A 1 171 THR 171 177 177 THR THR A . n A 1 172 GLY 172 178 178 GLY GLY A . n A 1 173 GLN 173 179 179 GLN GLN A . n A 1 174 LEU 174 180 180 LEU LEU A . n A 1 175 GLN 175 181 181 GLN GLN A . n A 1 176 SER 176 182 182 SER SER A . n A 1 177 TYR 177 183 183 TYR TYR A . n A 1 178 LEU 178 184 184 LEU LEU A . n A 1 179 GLN 179 185 185 GLN GLN A . n A 1 180 ALA 180 186 186 ALA ALA A . n A 1 181 VAL 181 187 187 VAL VAL A . n A 1 182 TYR 182 188 188 TYR TYR A . n A 1 183 ASN 183 189 189 ASN ASN A . n A 1 184 ARG 184 190 190 ARG ARG A . n A 1 185 TYR 185 191 191 TYR TYR A . n A 1 186 HIS 186 192 192 HIS HIS A . n A 1 187 ARG 187 193 193 ARG ARG A . n A 1 188 PRO 188 194 194 PRO PRO A . n A 1 189 ILE 189 195 195 ILE ILE A . n A 1 190 TRP 190 196 196 TRP TRP A . n A 1 191 LEU 191 197 197 LEU LEU A . n A 1 192 THR 192 198 198 THR THR A . n A 1 193 GLU 193 199 199 GLU GLU A . n A 1 194 TYR 194 200 200 TYR TYR A . n A 1 195 ALA 195 201 201 ALA ALA A . n A 1 196 LEU 196 202 202 LEU LEU A . n A 1 197 THR 197 203 203 THR THR A . n A 1 198 ASP 198 204 204 ASP ASP A . n A 1 199 PHE 199 205 205 PHE PHE A . n A 1 200 SER 200 206 206 SER SER A . n A 1 201 GLY 201 207 207 GLY GLY A . n A 1 202 SER 202 208 208 SER SER A . n A 1 203 THR 203 209 209 THR THR A . n A 1 204 PRO 204 210 210 PRO PRO A . n A 1 205 ARG 205 211 211 ARG ARG A . n A 1 206 TYR 206 212 212 TYR TYR A . n A 1 207 PRO 207 213 213 PRO PRO A . n A 1 208 SER 208 214 214 SER SER A . n A 1 209 ALA 209 215 215 ALA ALA A . n A 1 210 ALA 210 216 216 ALA ALA A . n A 1 211 GLU 211 217 217 GLU GLU A . n A 1 212 GLN 212 218 218 GLN GLN A . n A 1 213 ALA 213 219 219 ALA ALA A . n A 1 214 ASP 214 220 220 ASP ASP A . n A 1 215 PHE 215 221 221 PHE PHE A . n A 1 216 VAL 216 222 222 VAL VAL A . n A 1 217 SER 217 223 223 SER SER A . n A 1 218 ARG 218 224 224 ARG ARG A . n A 1 219 SER 219 225 225 SER SER A . n A 1 220 THR 220 226 226 THR THR A . n A 1 221 ALA 221 227 227 ALA ALA A . n A 1 222 MET 222 228 228 MET MET A . n A 1 223 LEU 223 229 229 LEU LEU A . n A 1 224 ASN 224 230 230 ASN ASN A . n A 1 225 GLY 225 231 231 GLY GLY A . n A 1 226 LEU 226 232 232 LEU LEU A . n A 1 227 SER 227 233 233 SER SER A . n A 1 228 PHE 228 234 234 PHE PHE A . n A 1 229 VAL 229 235 235 VAL VAL A . n A 1 230 GLU 230 236 236 GLU GLU A . n A 1 231 ARG 231 237 237 ARG ARG A . n A 1 232 TYR 232 238 238 TYR TYR A . n A 1 233 ALA 233 239 239 ALA ALA A . n A 1 234 TRP 234 240 240 TRP TRP A . n A 1 235 PHE 235 241 241 PHE PHE A . n A 1 236 SER 236 242 242 SER SER A . n A 1 237 LEU 237 243 243 LEU LEU A . n A 1 238 SER 238 244 244 SER SER A . n A 1 239 THR 239 245 245 THR THR A . n A 1 240 SER 240 246 246 SER SER A . n A 1 241 THR 241 247 247 THR THR A . n A 1 242 THR 242 248 248 THR THR A . n A 1 243 PRO 243 249 249 PRO PRO A . n A 1 244 THR 244 250 250 THR THR A . n A 1 245 GLY 245 251 251 GLY GLY A . n A 1 246 LEU 246 252 252 LEU LEU A . n A 1 247 TYR 247 253 253 TYR TYR A . n A 1 248 THR 248 254 254 THR THR A . n A 1 249 GLY 249 255 255 GLY GLY A . n A 1 250 THR 250 256 256 THR THR A . n A 1 251 THR 251 257 257 THR THR A . n A 1 252 PRO 252 258 258 PRO PRO A . n A 1 253 ASN 253 259 259 ASN ASN A . n A 1 254 SER 254 260 260 SER SER A . n A 1 255 SER 255 261 261 SER SER A . n A 1 256 GLY 256 262 262 GLY GLY A . n A 1 257 VAL 257 263 263 VAL VAL A . n A 1 258 ALA 258 264 264 ALA ALA A . n A 1 259 TYR 259 265 265 TYR TYR A . n A 1 260 ARG 260 266 266 ARG ARG A . n A 1 261 ALA 261 267 267 ALA ALA A . n A 1 262 ALA 262 268 268 ALA ALA A . n A 1 263 GLY 263 269 269 GLY GLY A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 GOL 1 301 301 GOL GOL A . C 2 GOL 1 302 302 GOL GOL A . D 2 GOL 1 303 303 GOL GOL A . E 3 NA 1 304 401 NA NA A . F 4 HOH 1 401 184 HOH HOH A . F 4 HOH 2 402 89 HOH HOH A . F 4 HOH 3 403 23 HOH HOH A . F 4 HOH 4 404 193 HOH HOH A . F 4 HOH 5 405 248 HOH HOH A . F 4 HOH 6 406 284 HOH HOH A . F 4 HOH 7 407 356 HOH HOH A . F 4 HOH 8 408 197 HOH HOH A . F 4 HOH 9 409 307 HOH HOH A . F 4 HOH 10 410 41 HOH HOH A . F 4 HOH 11 411 224 HOH HOH A . F 4 HOH 12 412 220 HOH HOH A . F 4 HOH 13 413 15 HOH HOH A . F 4 HOH 14 414 333 HOH HOH A . F 4 HOH 15 415 286 HOH HOH A . F 4 HOH 16 416 265 HOH HOH A . F 4 HOH 17 417 211 HOH HOH A . F 4 HOH 18 418 198 HOH HOH A . F 4 HOH 19 419 99 HOH HOH A . F 4 HOH 20 420 240 HOH HOH A . F 4 HOH 21 421 139 HOH HOH A . F 4 HOH 22 422 48 HOH HOH A . F 4 HOH 23 423 68 HOH HOH A . F 4 HOH 24 424 54 HOH HOH A . F 4 HOH 25 425 38 HOH HOH A . F 4 HOH 26 426 60 HOH HOH A . F 4 HOH 27 427 237 HOH HOH A . F 4 HOH 28 428 43 HOH HOH A . F 4 HOH 29 429 151 HOH HOH A . F 4 HOH 30 430 58 HOH HOH A . F 4 HOH 31 431 266 HOH HOH A . F 4 HOH 32 432 245 HOH HOH A . F 4 HOH 33 433 290 HOH HOH A . F 4 HOH 34 434 26 HOH HOH A . F 4 HOH 35 435 144 HOH HOH A . F 4 HOH 36 436 134 HOH HOH A . F 4 HOH 37 437 214 HOH HOH A . F 4 HOH 38 438 123 HOH HOH A . F 4 HOH 39 439 153 HOH HOH A . F 4 HOH 40 440 109 HOH HOH A . F 4 HOH 41 441 166 HOH HOH A . F 4 HOH 42 442 2 HOH HOH A . F 4 HOH 43 443 47 HOH HOH A . F 4 HOH 44 444 355 HOH HOH A . F 4 HOH 45 445 37 HOH HOH A . F 4 HOH 46 446 219 HOH HOH A . F 4 HOH 47 447 112 HOH HOH A . F 4 HOH 48 448 261 HOH HOH A . F 4 HOH 49 449 5 HOH HOH A . F 4 HOH 50 450 155 HOH HOH A . F 4 HOH 51 451 285 HOH HOH A . F 4 HOH 52 452 147 HOH HOH A . F 4 HOH 53 453 317 HOH HOH A . F 4 HOH 54 454 4 HOH HOH A . F 4 HOH 55 455 189 HOH HOH A . F 4 HOH 56 456 118 HOH HOH A . F 4 HOH 57 457 275 HOH HOH A . F 4 HOH 58 458 6 HOH HOH A . F 4 HOH 59 459 276 HOH HOH A . F 4 HOH 60 460 79 HOH HOH A . F 4 HOH 61 461 33 HOH HOH A . F 4 HOH 62 462 252 HOH HOH A . F 4 HOH 63 463 24 HOH HOH A . F 4 HOH 64 464 96 HOH HOH A . F 4 HOH 65 465 55 HOH HOH A . F 4 HOH 66 466 92 HOH HOH A . F 4 HOH 67 467 280 HOH HOH A . F 4 HOH 68 468 27 HOH HOH A . F 4 HOH 69 469 95 HOH HOH A . F 4 HOH 70 470 94 HOH HOH A . F 4 HOH 71 471 57 HOH HOH A . F 4 HOH 72 472 140 HOH HOH A . F 4 HOH 73 473 210 HOH HOH A . F 4 HOH 74 474 86 HOH HOH A . F 4 HOH 75 475 120 HOH HOH A . F 4 HOH 76 476 332 HOH HOH A . F 4 HOH 77 477 163 HOH HOH A . F 4 HOH 78 478 80 HOH HOH A . F 4 HOH 79 479 3 HOH HOH A . F 4 HOH 80 480 277 HOH HOH A . F 4 HOH 81 481 40 HOH HOH A . F 4 HOH 82 482 53 HOH HOH A . F 4 HOH 83 483 7 HOH HOH A . F 4 HOH 84 484 78 HOH HOH A . F 4 HOH 85 485 56 HOH HOH A . F 4 HOH 86 486 69 HOH HOH A . F 4 HOH 87 487 34 HOH HOH A . F 4 HOH 88 488 128 HOH HOH A . F 4 HOH 89 489 344 HOH HOH A . F 4 HOH 90 490 264 HOH HOH A . F 4 HOH 91 491 35 HOH HOH A . F 4 HOH 92 492 169 HOH HOH A . F 4 HOH 93 493 187 HOH HOH A . F 4 HOH 94 494 341 HOH HOH A . F 4 HOH 95 495 63 HOH HOH A . F 4 HOH 96 496 255 HOH HOH A . F 4 HOH 97 497 309 HOH HOH A . F 4 HOH 98 498 8 HOH HOH A . F 4 HOH 99 499 199 HOH HOH A . F 4 HOH 100 500 114 HOH HOH A . F 4 HOH 101 501 227 HOH HOH A . F 4 HOH 102 502 16 HOH HOH A . F 4 HOH 103 503 249 HOH HOH A . F 4 HOH 104 504 39 HOH HOH A . F 4 HOH 105 505 241 HOH HOH A . F 4 HOH 106 506 250 HOH HOH A . F 4 HOH 107 507 11 HOH HOH A . F 4 HOH 108 508 29 HOH HOH A . F 4 HOH 109 509 305 HOH HOH A . F 4 HOH 110 510 97 HOH HOH A . F 4 HOH 111 511 101 HOH HOH A . F 4 HOH 112 512 267 HOH HOH A . F 4 HOH 113 513 244 HOH HOH A . F 4 HOH 114 514 349 HOH HOH A . F 4 HOH 115 515 46 HOH HOH A . F 4 HOH 116 516 9 HOH HOH A . F 4 HOH 117 517 81 HOH HOH A . F 4 HOH 118 518 19 HOH HOH A . F 4 HOH 119 519 185 HOH HOH A . F 4 HOH 120 520 10 HOH HOH A . F 4 HOH 121 521 31 HOH HOH A . F 4 HOH 122 522 291 HOH HOH A . F 4 HOH 123 523 298 HOH HOH A . F 4 HOH 124 524 158 HOH HOH A . F 4 HOH 125 525 186 HOH HOH A . F 4 HOH 126 526 85 HOH HOH A . F 4 HOH 127 527 64 HOH HOH A . F 4 HOH 128 528 110 HOH HOH A . F 4 HOH 129 529 50 HOH HOH A . F 4 HOH 130 530 66 HOH HOH A . F 4 HOH 131 531 150 HOH HOH A . F 4 HOH 132 532 20 HOH HOH A . F 4 HOH 133 533 122 HOH HOH A . F 4 HOH 134 534 340 HOH HOH A . F 4 HOH 135 535 14 HOH HOH A . F 4 HOH 136 536 287 HOH HOH A . F 4 HOH 137 537 22 HOH HOH A . F 4 HOH 138 538 42 HOH HOH A . F 4 HOH 139 539 62 HOH HOH A . F 4 HOH 140 540 215 HOH HOH A . F 4 HOH 141 541 251 HOH HOH A . F 4 HOH 142 542 98 HOH HOH A . F 4 HOH 143 543 13 HOH HOH A . F 4 HOH 144 544 322 HOH HOH A . F 4 HOH 145 545 44 HOH HOH A . F 4 HOH 146 546 357 HOH HOH A . F 4 HOH 147 547 239 HOH HOH A . F 4 HOH 148 548 262 HOH HOH A . F 4 HOH 149 549 12 HOH HOH A . F 4 HOH 150 550 204 HOH HOH A . F 4 HOH 151 551 84 HOH HOH A . F 4 HOH 152 552 75 HOH HOH A . F 4 HOH 153 553 254 HOH HOH A . F 4 HOH 154 554 246 HOH HOH A . F 4 HOH 155 555 83 HOH HOH A . F 4 HOH 156 556 142 HOH HOH A . F 4 HOH 157 557 49 HOH HOH A . F 4 HOH 158 558 259 HOH HOH A . F 4 HOH 159 559 233 HOH HOH A . F 4 HOH 160 560 338 HOH HOH A . F 4 HOH 161 561 296 HOH HOH A . F 4 HOH 162 562 260 HOH HOH A . F 4 HOH 163 563 1 HOH HOH A . F 4 HOH 164 564 18 HOH HOH A . F 4 HOH 165 565 318 HOH HOH A . F 4 HOH 166 566 106 HOH HOH A . F 4 HOH 167 567 59 HOH HOH A . F 4 HOH 168 568 196 HOH HOH A . F 4 HOH 169 569 160 HOH HOH A . F 4 HOH 170 570 93 HOH HOH A . F 4 HOH 171 571 30 HOH HOH A . F 4 HOH 172 572 76 HOH HOH A . F 4 HOH 173 573 183 HOH HOH A . F 4 HOH 174 574 218 HOH HOH A . F 4 HOH 175 575 206 HOH HOH A . F 4 HOH 176 576 353 HOH HOH A . F 4 HOH 177 577 32 HOH HOH A . F 4 HOH 178 578 17 HOH HOH A . F 4 HOH 179 579 77 HOH HOH A . F 4 HOH 180 580 28 HOH HOH A . F 4 HOH 181 581 310 HOH HOH A . F 4 HOH 182 582 271 HOH HOH A . F 4 HOH 183 583 36 HOH HOH A . F 4 HOH 184 584 236 HOH HOH A . F 4 HOH 185 585 72 HOH HOH A . F 4 HOH 186 586 238 HOH HOH A . F 4 HOH 187 587 131 HOH HOH A . F 4 HOH 188 588 190 HOH HOH A . F 4 HOH 189 589 335 HOH HOH A . F 4 HOH 190 590 273 HOH HOH A . F 4 HOH 191 591 352 HOH HOH A . F 4 HOH 192 592 279 HOH HOH A . F 4 HOH 193 593 70 HOH HOH A . F 4 HOH 194 594 312 HOH HOH A . F 4 HOH 195 595 146 HOH HOH A . F 4 HOH 196 596 191 HOH HOH A . F 4 HOH 197 597 91 HOH HOH A . F 4 HOH 198 598 288 HOH HOH A . F 4 HOH 199 599 119 HOH HOH A . F 4 HOH 200 600 330 HOH HOH A . F 4 HOH 201 601 337 HOH HOH A . F 4 HOH 202 602 127 HOH HOH A . F 4 HOH 203 603 339 HOH HOH A . F 4 HOH 204 604 281 HOH HOH A . F 4 HOH 205 605 141 HOH HOH A . F 4 HOH 206 606 308 HOH HOH A . F 4 HOH 207 607 104 HOH HOH A . F 4 HOH 208 608 87 HOH HOH A . F 4 HOH 209 609 205 HOH HOH A . F 4 HOH 210 610 278 HOH HOH A . F 4 HOH 211 611 138 HOH HOH A . F 4 HOH 212 612 105 HOH HOH A . F 4 HOH 213 613 306 HOH HOH A . F 4 HOH 214 614 88 HOH HOH A . F 4 HOH 215 615 257 HOH HOH A . F 4 HOH 216 616 124 HOH HOH A . F 4 HOH 217 617 313 HOH HOH A . F 4 HOH 218 618 82 HOH HOH A . F 4 HOH 219 619 65 HOH HOH A . F 4 HOH 220 620 351 HOH HOH A . F 4 HOH 221 621 272 HOH HOH A . F 4 HOH 222 622 51 HOH HOH A . F 4 HOH 223 623 74 HOH HOH A . F 4 HOH 224 624 52 HOH HOH A . F 4 HOH 225 625 149 HOH HOH A . F 4 HOH 226 626 221 HOH HOH A . F 4 HOH 227 627 303 HOH HOH A . F 4 HOH 228 628 217 HOH HOH A . F 4 HOH 229 629 107 HOH HOH A . F 4 HOH 230 630 130 HOH HOH A . F 4 HOH 231 631 289 HOH HOH A . F 4 HOH 232 632 67 HOH HOH A . F 4 HOH 233 633 61 HOH HOH A . F 4 HOH 234 634 230 HOH HOH A . F 4 HOH 235 635 350 HOH HOH A . F 4 HOH 236 636 179 HOH HOH A . F 4 HOH 237 637 242 HOH HOH A . F 4 HOH 238 638 102 HOH HOH A . F 4 HOH 239 639 111 HOH HOH A . F 4 HOH 240 640 319 HOH HOH A . F 4 HOH 241 641 263 HOH HOH A . F 4 HOH 242 642 320 HOH HOH A . F 4 HOH 243 643 314 HOH HOH A . F 4 HOH 244 644 137 HOH HOH A . F 4 HOH 245 645 274 HOH HOH A . F 4 HOH 246 646 321 HOH HOH A . F 4 HOH 247 647 177 HOH HOH A . F 4 HOH 248 648 311 HOH HOH A . F 4 HOH 249 649 73 HOH HOH A . F 4 HOH 250 650 247 HOH HOH A . F 4 HOH 251 651 283 HOH HOH A . F 4 HOH 252 652 348 HOH HOH A . F 4 HOH 253 653 235 HOH HOH A . F 4 HOH 254 654 173 HOH HOH A . F 4 HOH 255 655 192 HOH HOH A . F 4 HOH 256 656 292 HOH HOH A . F 4 HOH 257 657 268 HOH HOH A . F 4 HOH 258 658 195 HOH HOH A . F 4 HOH 259 659 113 HOH HOH A . F 4 HOH 260 660 182 HOH HOH A . F 4 HOH 261 661 157 HOH HOH A . F 4 HOH 262 662 129 HOH HOH A . F 4 HOH 263 663 100 HOH HOH A . F 4 HOH 264 664 117 HOH HOH A . F 4 HOH 265 665 304 HOH HOH A . F 4 HOH 266 666 243 HOH HOH A . F 4 HOH 267 667 21 HOH HOH A . F 4 HOH 268 668 269 HOH HOH A . F 4 HOH 269 669 282 HOH HOH A . F 4 HOH 270 670 326 HOH HOH A . F 4 HOH 271 671 172 HOH HOH A . F 4 HOH 272 672 25 HOH HOH A . F 4 HOH 273 673 203 HOH HOH A . F 4 HOH 274 674 301 HOH HOH A . F 4 HOH 275 675 126 HOH HOH A . F 4 HOH 276 676 175 HOH HOH A . F 4 HOH 277 677 125 HOH HOH A . F 4 HOH 278 678 132 HOH HOH A . F 4 HOH 279 679 200 HOH HOH A . F 4 HOH 280 680 209 HOH HOH A . F 4 HOH 281 681 176 HOH HOH A . F 4 HOH 282 682 343 HOH HOH A . F 4 HOH 283 683 345 HOH HOH A . F 4 HOH 284 684 136 HOH HOH A . F 4 HOH 285 685 258 HOH HOH A . F 4 HOH 286 686 90 HOH HOH A . F 4 HOH 287 687 297 HOH HOH A . F 4 HOH 288 688 229 HOH HOH A . F 4 HOH 289 689 234 HOH HOH A . F 4 HOH 290 690 223 HOH HOH A . F 4 HOH 291 691 145 HOH HOH A . F 4 HOH 292 692 165 HOH HOH A . F 4 HOH 293 693 354 HOH HOH A . F 4 HOH 294 694 228 HOH HOH A . F 4 HOH 295 695 208 HOH HOH A . F 4 HOH 296 696 336 HOH HOH A . F 4 HOH 297 697 108 HOH HOH A . F 4 HOH 298 698 180 HOH HOH A . F 4 HOH 299 699 329 HOH HOH A . F 4 HOH 300 700 201 HOH HOH A . F 4 HOH 301 701 116 HOH HOH A . F 4 HOH 302 702 181 HOH HOH A . F 4 HOH 303 703 324 HOH HOH A . F 4 HOH 304 704 103 HOH HOH A . F 4 HOH 305 705 293 HOH HOH A . F 4 HOH 306 706 156 HOH HOH A . F 4 HOH 307 707 133 HOH HOH A . F 4 HOH 308 708 194 HOH HOH A . F 4 HOH 309 709 162 HOH HOH A . F 4 HOH 310 710 359 HOH HOH A . F 4 HOH 311 711 232 HOH HOH A . F 4 HOH 312 712 212 HOH HOH A . F 4 HOH 313 713 135 HOH HOH A . F 4 HOH 314 714 346 HOH HOH A . F 4 HOH 315 715 327 HOH HOH A . F 4 HOH 316 716 253 HOH HOH A . F 4 HOH 317 717 207 HOH HOH A . F 4 HOH 318 718 121 HOH HOH A . F 4 HOH 319 719 45 HOH HOH A . F 4 HOH 320 720 143 HOH HOH A . F 4 HOH 321 721 152 HOH HOH A . F 4 HOH 322 722 256 HOH HOH A . F 4 HOH 323 723 216 HOH HOH A . F 4 HOH 324 724 342 HOH HOH A . F 4 HOH 325 725 323 HOH HOH A . F 4 HOH 326 726 178 HOH HOH A . F 4 HOH 327 727 148 HOH HOH A . F 4 HOH 328 728 171 HOH HOH A . F 4 HOH 329 729 328 HOH HOH A . F 4 HOH 330 730 170 HOH HOH A . F 4 HOH 331 731 231 HOH HOH A . F 4 HOH 332 732 188 HOH HOH A . F 4 HOH 333 733 71 HOH HOH A . F 4 HOH 334 734 167 HOH HOH A . F 4 HOH 335 735 302 HOH HOH A . F 4 HOH 336 736 222 HOH HOH A . F 4 HOH 337 737 159 HOH HOH A . F 4 HOH 338 738 168 HOH HOH A . F 4 HOH 339 739 315 HOH HOH A . F 4 HOH 340 740 226 HOH HOH A . F 4 HOH 341 741 334 HOH HOH A . F 4 HOH 342 742 164 HOH HOH A . F 4 HOH 343 743 300 HOH HOH A . F 4 HOH 344 744 115 HOH HOH A . F 4 HOH 345 745 331 HOH HOH A . F 4 HOH 346 746 299 HOH HOH A . F 4 HOH 347 747 316 HOH HOH A . F 4 HOH 348 748 325 HOH HOH A . F 4 HOH 349 749 161 HOH HOH A . F 4 HOH 350 750 213 HOH HOH A . F 4 HOH 351 751 174 HOH HOH A . F 4 HOH 352 752 295 HOH HOH A . F 4 HOH 353 753 202 HOH HOH A . F 4 HOH 354 754 154 HOH HOH A . F 4 HOH 355 755 270 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0238 1 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.22 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? SHELXDE ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 101.620 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6UAQ _cell.details ? _cell.formula_units_Z ? _cell.length_a 37.350 _cell.length_a_esd ? _cell.length_b 78.643 _cell.length_b_esd ? _cell.length_c 46.183 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 2 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6UAQ _symmetry.cell_setting ? _symmetry.Int_Tables_number 4 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1 21 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6UAQ _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.59 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 52.55 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 4.6 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;sodium acetate 0.1 M sodium chloride 1.5 M ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 2M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-11-23 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.033140 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'LNLS BEAMLINE W01B-MX2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.033140 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline W01B-MX2 _diffrn_source.pdbx_synchrotron_site LNLS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6UAQ _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.15 _reflns.d_resolution_low 45.280 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 171671 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 94.0 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 2.35 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 11.51 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.998 _reflns.pdbx_R_split ? _reflns.pdbx_CC_star ? # _reflns_shell.d_res_high 1.15 _reflns_shell.d_res_low 1.22 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 24853 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.808 _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_CC_star ? # _refine.aniso_B[1][1] 0.5600 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] 0.4200 _refine.aniso_B[2][2] -0.5800 _refine.aniso_B[2][3] -0.0000 _refine.aniso_B[3][3] -0.1400 _refine.B_iso_max 97.210 _refine.B_iso_mean 12.7280 _refine.B_iso_min 6.240 _refine.correlation_coeff_Fo_to_Fc 0.9780 _refine.correlation_coeff_Fo_to_Fc_free 0.9720 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES : REFINED INDIVIDUALLY' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6UAQ _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.1500 _refine.ls_d_res_low 45.2800 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 86795 _refine.ls_number_reflns_R_free 4403 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.7600 _refine.ls_percent_reflns_R_free 4.8000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1506 _refine.ls_R_factor_R_free 0.1618 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1500 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct MIRAS _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.0300 _refine.pdbx_overall_ESU_R_Free 0.0310 _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 1.1500 _refine_hist.d_res_low 45.2800 _refine_hist.number_atoms_solvent 355 _refine_hist.number_atoms_total 2187 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 241 _refine_hist.pdbx_B_iso_mean_ligand 21.68 _refine_hist.pdbx_B_iso_mean_solvent 28.94 _refine_hist.pdbx_number_atoms_protein 1813 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 19 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.018 0.012 1936 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.036 0.017 1722 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 2.097 1.648 2645 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 2.440 1.567 3976 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 6.980 5.000 241 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 33.694 20.396 101 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 10.279 15.000 270 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 11.925 15.000 16 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.132 0.200 254 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.013 0.020 2214 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.022 0.020 462 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? 3.668 1.127 966 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 3.251 1.118 964 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 4.221 1.688 1206 ? r_mcangle_it ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.1510 _refine_ls_shell.d_res_low 1.1810 _refine_ls_shell.number_reflns_all 6618 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 314 _refine_ls_shell.number_reflns_R_work 6304 _refine_ls_shell.percent_reflns_obs 96.7700 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.2600 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.2410 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 6UAQ _struct.title 'Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase from Amycolatopsis mediterranei (AmGH128_I)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6UAQ _struct_keywords.text 'Glycosyl hydrolase, CARBOHYDRATE, HYDROLASE' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 3 ? F N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code G0FQ07_AMYMS _struct_ref.pdbx_db_accession G0FQ07 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;AGTKKGVSAAAFSGVTAALGDVGARWFYTWAADPQGITAPAGTEFVPMIWGRDSVTADQLQRAKAAGSTLLAFNEPDLAG QANMSVETALDLWPQLQATGMRLGAPAVAYGGDTPGGWLDRFMSGAAARGYRVDFIPLHWYGGDFSAAATGQLQSYLQAV YNRYHRPIWLTEYALTDFSGSTPRYPSAAEQADFVSRSTAMLNGLSFVERYAWFSLSTSTTPTGLYTGTTPNSSGVAYRA AG ; _struct_ref.pdbx_align_begin 28 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6UAQ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 22 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 263 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession G0FQ07 _struct_ref_seq.db_align_beg 28 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 269 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 28 _struct_ref_seq.pdbx_auth_seq_align_end 269 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6UAQ MET A 1 ? UNP G0FQ07 ? ? 'initiating methionine' 7 1 1 6UAQ GLY A 2 ? UNP G0FQ07 ? ? 'expression tag' 8 2 1 6UAQ SER A 3 ? UNP G0FQ07 ? ? 'expression tag' 9 3 1 6UAQ SER A 4 ? UNP G0FQ07 ? ? 'expression tag' 10 4 1 6UAQ HIS A 5 ? UNP G0FQ07 ? ? 'expression tag' 11 5 1 6UAQ HIS A 6 ? UNP G0FQ07 ? ? 'expression tag' 12 6 1 6UAQ HIS A 7 ? UNP G0FQ07 ? ? 'expression tag' 13 7 1 6UAQ HIS A 8 ? UNP G0FQ07 ? ? 'expression tag' 14 8 1 6UAQ HIS A 9 ? UNP G0FQ07 ? ? 'expression tag' 15 9 1 6UAQ HIS A 10 ? UNP G0FQ07 ? ? 'expression tag' 16 10 1 6UAQ SER A 11 ? UNP G0FQ07 ? ? 'expression tag' 17 11 1 6UAQ SER A 12 ? UNP G0FQ07 ? ? 'expression tag' 18 12 1 6UAQ GLY A 13 ? UNP G0FQ07 ? ? 'expression tag' 19 13 1 6UAQ LEU A 14 ? UNP G0FQ07 ? ? 'expression tag' 20 14 1 6UAQ VAL A 15 ? UNP G0FQ07 ? ? 'expression tag' 21 15 1 6UAQ PRO A 16 ? UNP G0FQ07 ? ? 'expression tag' 22 16 1 6UAQ ALA A 17 ? UNP G0FQ07 ? ? 'expression tag' 23 17 1 6UAQ GLY A 18 ? UNP G0FQ07 ? ? 'expression tag' 24 18 1 6UAQ SER A 19 ? UNP G0FQ07 ? ? 'expression tag' 25 19 1 6UAQ HIS A 20 ? UNP G0FQ07 ? ? 'expression tag' 26 20 1 6UAQ MET A 21 ? UNP G0FQ07 ? ? 'expression tag' 27 21 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'light scattering' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 35 ? GLY A 44 ? GLY A 41 GLY A 50 1 ? 10 HELX_P HELX_P2 AA2 GLY A 72 ? VAL A 76 ? GLY A 78 VAL A 82 5 ? 5 HELX_P HELX_P3 AA3 THR A 77 ? GLY A 88 ? THR A 83 GLY A 94 1 ? 12 HELX_P HELX_P4 AA4 SER A 106 ? ALA A 119 ? SER A 112 ALA A 125 1 ? 14 HELX_P HELX_P5 AA5 GLY A 138 ? GLY A 151 ? GLY A 144 GLY A 157 1 ? 14 HELX_P HELX_P6 AA6 ALA A 169 ? HIS A 186 ? ALA A 175 HIS A 192 1 ? 18 HELX_P HELX_P7 AA7 SER A 208 ? LEU A 226 ? SER A 214 LEU A 232 1 ? 19 HELX_P HELX_P8 AA8 ASN A 253 ? ALA A 262 ? ASN A 259 ALA A 268 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A LYS 85 O ? ? ? 1_555 E NA . NA ? ? A LYS 91 A NA 304 1_555 ? ? ? ? ? ? ? 2.298 ? ? metalc2 metalc ? ? A GLY 88 O ? ? ? 1_555 E NA . NA ? ? A GLY 94 A NA 304 1_555 ? ? ? ? ? ? ? 2.329 ? ? metalc3 metalc ? ? E NA . NA ? ? ? 1_555 F HOH . O ? ? A NA 304 A HOH 595 1_555 ? ? ? ? ? ? ? 2.373 ? ? metalc4 metalc ? ? E NA . NA ? ? ? 1_555 F HOH . O ? ? A NA 304 A HOH 629 1_555 ? ? ? ? ? ? ? 2.449 ? ? metalc5 metalc ? ? E NA . NA ? ? ? 1_555 F HOH . O ? ? A NA 304 A HOH 631 1_555 ? ? ? ? ? ? ? 2.588 ? ? metalc6 metalc ? ? E NA . NA ? ? ? 1_555 F HOH . O ? ? A NA 304 A HOH 672 1_555 ? ? ? ? ? ? ? 2.417 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 O ? A LYS 85 ? A LYS 91 ? 1_555 NA ? E NA . ? A NA 304 ? 1_555 O ? A GLY 88 ? A GLY 94 ? 1_555 80.9 ? 2 O ? A LYS 85 ? A LYS 91 ? 1_555 NA ? E NA . ? A NA 304 ? 1_555 O ? F HOH . ? A HOH 595 ? 1_555 147.5 ? 3 O ? A GLY 88 ? A GLY 94 ? 1_555 NA ? E NA . ? A NA 304 ? 1_555 O ? F HOH . ? A HOH 595 ? 1_555 91.4 ? 4 O ? A LYS 85 ? A LYS 91 ? 1_555 NA ? E NA . ? A NA 304 ? 1_555 O ? F HOH . ? A HOH 629 ? 1_555 83.1 ? 5 O ? A GLY 88 ? A GLY 94 ? 1_555 NA ? E NA . ? A NA 304 ? 1_555 O ? F HOH . ? A HOH 629 ? 1_555 160.6 ? 6 O ? F HOH . ? A HOH 595 ? 1_555 NA ? E NA . ? A NA 304 ? 1_555 O ? F HOH . ? A HOH 629 ? 1_555 96.3 ? 7 O ? A LYS 85 ? A LYS 91 ? 1_555 NA ? E NA . ? A NA 304 ? 1_555 O ? F HOH . ? A HOH 631 ? 1_555 81.2 ? 8 O ? A GLY 88 ? A GLY 94 ? 1_555 NA ? E NA . ? A NA 304 ? 1_555 O ? F HOH . ? A HOH 631 ? 1_555 85.8 ? 9 O ? F HOH . ? A HOH 595 ? 1_555 NA ? E NA . ? A NA 304 ? 1_555 O ? F HOH . ? A HOH 631 ? 1_555 66.8 ? 10 O ? F HOH . ? A HOH 629 ? 1_555 NA ? E NA . ? A NA 304 ? 1_555 O ? F HOH . ? A HOH 631 ? 1_555 81.0 ? 11 O ? A LYS 85 ? A LYS 91 ? 1_555 NA ? E NA . ? A NA 304 ? 1_555 O ? F HOH . ? A HOH 672 ? 1_555 123.1 ? 12 O ? A GLY 88 ? A GLY 94 ? 1_555 NA ? E NA . ? A NA 304 ? 1_555 O ? F HOH . ? A HOH 672 ? 1_555 102.4 ? 13 O ? F HOH . ? A HOH 595 ? 1_555 NA ? E NA . ? A NA 304 ? 1_555 O ? F HOH . ? A HOH 672 ? 1_555 89.4 ? 14 O ? F HOH . ? A HOH 629 ? 1_555 NA ? E NA . ? A NA 304 ? 1_555 O ? F HOH . ? A HOH 672 ? 1_555 95.4 ? 15 O ? F HOH . ? A HOH 631 ? 1_555 NA ? E NA . ? A NA 304 ? 1_555 O ? F HOH . ? A HOH 672 ? 1_555 155.1 ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id PHE _struct_mon_prot_cis.label_seq_id 235 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id PHE _struct_mon_prot_cis.auth_seq_id 241 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 SER _struct_mon_prot_cis.pdbx_label_seq_id_2 236 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 SER _struct_mon_prot_cis.pdbx_auth_seq_id_2 242 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 3.03 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 6 ? AA2 ? 2 ? AA3 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA1 5 6 ? parallel AA2 1 2 ? parallel AA3 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLU A 65 ? PHE A 66 ? GLU A 71 PHE A 72 AA1 2 TRP A 47 ? TYR A 49 ? TRP A 53 TYR A 55 AA1 3 LYS A 26 ? SER A 29 ? LYS A 32 SER A 35 AA1 4 VAL A 229 ? TRP A 234 ? VAL A 235 TRP A 240 AA1 5 ILE A 189 ? LEU A 196 ? ILE A 195 LEU A 202 AA1 6 ILE A 157 ? GLY A 163 ? ILE A 163 GLY A 169 AA2 1 THR A 90 ? LEU A 92 ? THR A 96 LEU A 98 AA2 2 ARG A 123 ? GLY A 125 ? ARG A 129 GLY A 131 AA3 1 TYR A 247 ? THR A 248 ? TYR A 253 THR A 254 AA3 2 THR A 251 ? PRO A 252 ? THR A 257 PRO A 258 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O GLU A 65 ? O GLU A 71 N PHE A 48 ? N PHE A 54 AA1 2 3 O TYR A 49 ? O TYR A 55 N VAL A 28 ? N VAL A 34 AA1 3 4 N GLY A 27 ? N GLY A 33 O TYR A 232 ? O TYR A 238 AA1 4 5 O GLU A 230 ? O GLU A 236 N ILE A 189 ? N ILE A 195 AA1 5 6 O TRP A 190 ? O TRP A 196 N LEU A 159 ? N LEU A 165 AA2 1 2 N LEU A 91 ? N LEU A 97 O ARG A 123 ? O ARG A 129 AA3 1 2 N THR A 248 ? N THR A 254 O THR A 251 ? O THR A 257 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A GOL 301 ? 8 'binding site for residue GOL A 301' AC2 Software A GOL 302 ? 6 'binding site for residue GOL A 302' AC3 Software A GOL 303 ? 7 'binding site for residue GOL A 303' AC4 Software A NA 304 ? 6 'binding site for residue NA A 304' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 8 TYR A 206 ? TYR A 212 . ? 1_555 ? 2 AC1 8 PRO A 207 ? PRO A 213 . ? 1_555 ? 3 AC1 8 ALA A 209 ? ALA A 215 . ? 1_555 ? 4 AC1 8 GLN A 212 ? GLN A 218 . ? 1_555 ? 5 AC1 8 PRO A 243 ? PRO A 249 . ? 1_555 ? 6 AC1 8 HOH F . ? HOH A 456 . ? 1_555 ? 7 AC1 8 HOH F . ? HOH A 499 . ? 1_555 ? 8 AC1 8 HOH F . ? HOH A 536 . ? 1_555 ? 9 AC2 6 TRP A 51 ? TRP A 57 . ? 1_555 ? 10 AC2 6 TRP A 71 ? TRP A 77 . ? 1_555 ? 11 AC2 6 ASN A 95 ? ASN A 101 . ? 1_555 ? 12 AC2 6 GLN A 102 ? GLN A 108 . ? 1_555 ? 13 AC2 6 PHE A 235 ? PHE A 241 . ? 1_555 ? 14 AC2 6 HOH F . ? HOH A 540 . ? 1_555 ? 15 AC3 7 GLU A 96 ? GLU A 102 . ? 1_555 ? 16 AC3 7 TYR A 162 ? TYR A 168 . ? 1_555 ? 17 AC3 7 PHE A 199 ? PHE A 205 . ? 1_555 ? 18 AC3 7 HOH F . ? HOH A 455 . ? 1_555 ? 19 AC3 7 HOH F . ? HOH A 471 . ? 1_555 ? 20 AC3 7 HOH F . ? HOH A 523 . ? 1_555 ? 21 AC3 7 HOH F . ? HOH A 598 . ? 1_555 ? 22 AC4 6 LYS A 85 ? LYS A 91 . ? 1_555 ? 23 AC4 6 GLY A 88 ? GLY A 94 . ? 1_555 ? 24 AC4 6 HOH F . ? HOH A 595 . ? 1_555 ? 25 AC4 6 HOH F . ? HOH A 629 . ? 1_555 ? 26 AC4 6 HOH F . ? HOH A 631 . ? 1_555 ? 27 AC4 6 HOH F . ? HOH A 672 . ? 1_555 ? # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 OD2 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 ASP _pdbx_validate_close_contact.auth_seq_id_1 204 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 NH1 _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 ARG _pdbx_validate_close_contact.auth_seq_id_2 211 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 A _pdbx_validate_close_contact.dist 2.16 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CD A GLU 114 ? B OE1 A GLU 114 ? B 1.346 1.252 0.094 0.011 N 2 1 CD A GLU 114 ? A OE2 A GLU 114 ? A 1.350 1.252 0.098 0.011 N 3 1 CB A SER 206 ? ? OG A SER 206 ? ? 1.556 1.418 0.138 0.013 N 4 1 CA A SER 233 ? ? CB A SER 233 ? ? 1.424 1.525 -0.101 0.015 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 79 ? ? CZ A ARG 79 ? ? NH1 A ARG 79 ? ? 124.45 120.30 4.15 0.50 N 2 1 NE A ARG 79 ? ? CZ A ARG 79 ? ? NH2 A ARG 79 ? ? 116.69 120.30 -3.61 0.50 N 3 1 NH1 A ARG 129 ? A CZ A ARG 129 ? A NH2 A ARG 129 ? A 131.08 119.40 11.68 1.10 N 4 1 NE A ARG 129 ? B CZ A ARG 129 ? B NH1 A ARG 129 ? B 125.83 120.30 5.53 0.50 N 5 1 NE A ARG 129 ? A CZ A ARG 129 ? A NH2 A ARG 129 ? A 110.98 120.30 -9.32 0.50 N 6 1 NE A ARG 193 ? ? CZ A ARG 193 ? ? NH2 A ARG 193 ? ? 115.72 120.30 -4.58 0.50 N 7 1 CB A ASP 204 ? ? CG A ASP 204 ? ? OD2 A ASP 204 ? ? 111.92 118.30 -6.38 0.90 N 8 1 NH1 A ARG 211 ? B CZ A ARG 211 ? B NH2 A ARG 211 ? B 111.04 119.40 -8.36 1.10 N 9 1 NE A ARG 211 ? B CZ A ARG 211 ? B NH2 A ARG 211 ? B 130.44 120.30 10.14 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 99 ? ? -87.92 -159.32 2 1 GLN A 108 ? ? -119.90 -135.55 # _pdbx_entry_details.entry_id 6UAQ _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # _pdbx_distant_solvent_atoms.id 1 _pdbx_distant_solvent_atoms.PDB_model_num 1 _pdbx_distant_solvent_atoms.auth_atom_id O _pdbx_distant_solvent_atoms.label_alt_id ? _pdbx_distant_solvent_atoms.auth_asym_id A _pdbx_distant_solvent_atoms.auth_comp_id HOH _pdbx_distant_solvent_atoms.auth_seq_id 755 _pdbx_distant_solvent_atoms.PDB_ins_code ? _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 6.52 _pdbx_distant_solvent_atoms.neighbor_ligand_distance . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 7 ? A MET 1 2 1 Y 1 A GLY 8 ? A GLY 2 3 1 Y 1 A SER 9 ? A SER 3 4 1 Y 1 A SER 10 ? A SER 4 5 1 Y 1 A HIS 11 ? A HIS 5 6 1 Y 1 A HIS 12 ? A HIS 6 7 1 Y 1 A HIS 13 ? A HIS 7 8 1 Y 1 A HIS 14 ? A HIS 8 9 1 Y 1 A HIS 15 ? A HIS 9 10 1 Y 1 A HIS 16 ? A HIS 10 11 1 Y 1 A SER 17 ? A SER 11 12 1 Y 1 A SER 18 ? A SER 12 13 1 Y 1 A GLY 19 ? A GLY 13 14 1 Y 1 A LEU 20 ? A LEU 14 15 1 Y 1 A VAL 21 ? A VAL 15 16 1 Y 1 A PRO 22 ? A PRO 16 17 1 Y 1 A ALA 23 ? A ALA 17 18 1 Y 1 A GLY 24 ? A GLY 18 19 1 Y 1 A SER 25 ? A SER 19 20 1 Y 1 A HIS 26 ? A HIS 20 21 1 Y 1 A MET 27 ? A MET 21 22 1 Y 1 A ALA 28 ? A ALA 22 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 GOL C1 C N N 123 GOL O1 O N N 124 GOL C2 C N N 125 GOL O2 O N N 126 GOL C3 C N N 127 GOL O3 O N N 128 GOL H11 H N N 129 GOL H12 H N N 130 GOL HO1 H N N 131 GOL H2 H N N 132 GOL HO2 H N N 133 GOL H31 H N N 134 GOL H32 H N N 135 GOL HO3 H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 NA NA NA N N 250 PHE N N N N 251 PHE CA C N S 252 PHE C C N N 253 PHE O O N N 254 PHE CB C N N 255 PHE CG C Y N 256 PHE CD1 C Y N 257 PHE CD2 C Y N 258 PHE CE1 C Y N 259 PHE CE2 C Y N 260 PHE CZ C Y N 261 PHE OXT O N N 262 PHE H H N N 263 PHE H2 H N N 264 PHE HA H N N 265 PHE HB2 H N N 266 PHE HB3 H N N 267 PHE HD1 H N N 268 PHE HD2 H N N 269 PHE HE1 H N N 270 PHE HE2 H N N 271 PHE HZ H N N 272 PHE HXT H N N 273 PRO N N N N 274 PRO CA C N S 275 PRO C C N N 276 PRO O O N N 277 PRO CB C N N 278 PRO CG C N N 279 PRO CD C N N 280 PRO OXT O N N 281 PRO H H N N 282 PRO HA H N N 283 PRO HB2 H N N 284 PRO HB3 H N N 285 PRO HG2 H N N 286 PRO HG3 H N N 287 PRO HD2 H N N 288 PRO HD3 H N N 289 PRO HXT H N N 290 SER N N N N 291 SER CA C N S 292 SER C C N N 293 SER O O N N 294 SER CB C N N 295 SER OG O N N 296 SER OXT O N N 297 SER H H N N 298 SER H2 H N N 299 SER HA H N N 300 SER HB2 H N N 301 SER HB3 H N N 302 SER HG H N N 303 SER HXT H N N 304 THR N N N N 305 THR CA C N S 306 THR C C N N 307 THR O O N N 308 THR CB C N R 309 THR OG1 O N N 310 THR CG2 C N N 311 THR OXT O N N 312 THR H H N N 313 THR H2 H N N 314 THR HA H N N 315 THR HB H N N 316 THR HG1 H N N 317 THR HG21 H N N 318 THR HG22 H N N 319 THR HG23 H N N 320 THR HXT H N N 321 TRP N N N N 322 TRP CA C N S 323 TRP C C N N 324 TRP O O N N 325 TRP CB C N N 326 TRP CG C Y N 327 TRP CD1 C Y N 328 TRP CD2 C Y N 329 TRP NE1 N Y N 330 TRP CE2 C Y N 331 TRP CE3 C Y N 332 TRP CZ2 C Y N 333 TRP CZ3 C Y N 334 TRP CH2 C Y N 335 TRP OXT O N N 336 TRP H H N N 337 TRP H2 H N N 338 TRP HA H N N 339 TRP HB2 H N N 340 TRP HB3 H N N 341 TRP HD1 H N N 342 TRP HE1 H N N 343 TRP HE3 H N N 344 TRP HZ2 H N N 345 TRP HZ3 H N N 346 TRP HH2 H N N 347 TRP HXT H N N 348 TYR N N N N 349 TYR CA C N S 350 TYR C C N N 351 TYR O O N N 352 TYR CB C N N 353 TYR CG C Y N 354 TYR CD1 C Y N 355 TYR CD2 C Y N 356 TYR CE1 C Y N 357 TYR CE2 C Y N 358 TYR CZ C Y N 359 TYR OH O N N 360 TYR OXT O N N 361 TYR H H N N 362 TYR H2 H N N 363 TYR HA H N N 364 TYR HB2 H N N 365 TYR HB3 H N N 366 TYR HD1 H N N 367 TYR HD2 H N N 368 TYR HE1 H N N 369 TYR HE2 H N N 370 TYR HH H N N 371 TYR HXT H N N 372 VAL N N N N 373 VAL CA C N S 374 VAL C C N N 375 VAL O O N N 376 VAL CB C N N 377 VAL CG1 C N N 378 VAL CG2 C N N 379 VAL OXT O N N 380 VAL H H N N 381 VAL H2 H N N 382 VAL HA H N N 383 VAL HB H N N 384 VAL HG11 H N N 385 VAL HG12 H N N 386 VAL HG13 H N N 387 VAL HG21 H N N 388 VAL HG22 H N N 389 VAL HG23 H N N 390 VAL HXT H N N 391 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 GOL C1 O1 sing N N 116 GOL C1 C2 sing N N 117 GOL C1 H11 sing N N 118 GOL C1 H12 sing N N 119 GOL O1 HO1 sing N N 120 GOL C2 O2 sing N N 121 GOL C2 C3 sing N N 122 GOL C2 H2 sing N N 123 GOL O2 HO2 sing N N 124 GOL C3 O3 sing N N 125 GOL C3 H31 sing N N 126 GOL C3 H32 sing N N 127 GOL O3 HO3 sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 # _pdbx_audit_support.funding_organization 'Sao Paulo Research Foundation (FAPESP)' _pdbx_audit_support.country Brazil _pdbx_audit_support.grant_number 15/26982-0 _pdbx_audit_support.ordinal 1 # _atom_sites.entry_id 6UAQ _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.026774 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.005506 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.012716 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.022106 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N NA O S # loop_ #