data_6UCH # _entry.id 6UCH # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.391 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6UCH pdb_00006uch 10.2210/pdb6uch/pdb WWPDB D_1000244044 ? ? BMRB 30672 ? 10.13018/BMR30672 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-11-27 2 'Structure model' 1 1 2019-12-04 3 'Structure model' 1 2 2019-12-11 4 'Structure model' 1 3 2024-05-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 4 'Structure model' chem_comp_atom 5 4 'Structure model' chem_comp_bond 6 4 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.pdbx_database_id_DOI' 7 2 'Structure model' '_citation.pdbx_database_id_PubMed' 8 2 'Structure model' '_citation.title' 9 3 'Structure model' '_citation.journal_volume' 10 3 'Structure model' '_citation.page_first' 11 3 'Structure model' '_citation.page_last' 12 4 'Structure model' '_database_2.pdbx_DOI' 13 4 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 6UCH _pdbx_database_status.recvd_initial_deposition_date 2019-09-16 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'SMARCB1 nucleosome-interacting C-terminal alpha helix' _pdbx_database_related.db_id 30672 _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Valencia, A.M.' 1 0000-0001-7527-6026 'Sun, Z.Y.J.' 2 0000-0003-2432-9890 'Seo, H.S.' 3 0000-0003-0646-2102 'Vangos, H.S.' 4 ? 'Yeoh, Z.C.' 5 ? 'Mashtalir, N.' 6 0000-0002-6624-4839 'Dhe-Paganon, S.' 7 0000-0003-0824-5929 'Kadoch, C.' 8 0000-0002-4058-5985 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Cell _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1097-4172 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 179 _citation.language ? _citation.page_first 1342 _citation.page_last 1356.e23 _citation.title ;Recurrent SMARCB1 Mutations Reveal a Nucleosome Acidic Patch Interaction Site That Potentiates mSWI/SNF Complex Chromatin Remodeling. ; _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.cell.2019.10.044 _citation.pdbx_database_id_PubMed 31759698 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Valencia, A.M.' 1 ? primary 'Collings, C.K.' 2 ? primary 'Dao, H.T.' 3 ? primary 'St Pierre, R.' 4 ? primary 'Cheng, Y.C.' 5 ? primary 'Huang, J.' 6 ? primary 'Sun, Z.Y.' 7 ? primary 'Seo, H.S.' 8 ? primary 'Mashtalir, N.' 9 ? primary 'Comstock, D.E.' 10 ? primary 'Bolonduro, O.' 11 ? primary 'Vangos, N.E.' 12 ? primary 'Yeoh, Z.C.' 13 ? primary 'Dornon, M.K.' 14 ? primary 'Hermawan, C.' 15 ? primary 'Barrett, L.' 16 ? primary 'Dhe-Paganon, S.' 17 ? primary 'Woolf, C.J.' 18 ? primary 'Muir, T.W.' 19 ? primary 'Kadoch, C.' 20 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1' _entity.formula_weight 4748.473 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'BRG1-associated factor 47,BAF47,Integrase interactor 1 protein,SNF5 homolog,hSNF5' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GPLGSMPLLETLTDAEMEKKIRDQDRNTRRMRRLANTAPAW _entity_poly.pdbx_seq_one_letter_code_can GPLGSMPLLETLTDAEMEKKIRDQDRNTRRMRRLANTAPAW _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 LEU n 1 4 GLY n 1 5 SER n 1 6 MET n 1 7 PRO n 1 8 LEU n 1 9 LEU n 1 10 GLU n 1 11 THR n 1 12 LEU n 1 13 THR n 1 14 ASP n 1 15 ALA n 1 16 GLU n 1 17 MET n 1 18 GLU n 1 19 LYS n 1 20 LYS n 1 21 ILE n 1 22 ARG n 1 23 ASP n 1 24 GLN n 1 25 ASP n 1 26 ARG n 1 27 ASN n 1 28 THR n 1 29 ARG n 1 30 ARG n 1 31 MET n 1 32 ARG n 1 33 ARG n 1 34 LEU n 1 35 ALA n 1 36 ASN n 1 37 THR n 1 38 ALA n 1 39 PRO n 1 40 ALA n 1 41 TRP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 41 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'SMARCB1, BAF47, INI1, SNF5L1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 345 345 GLY GLY A . n A 1 2 PRO 2 346 346 PRO PRO A . n A 1 3 LEU 3 347 347 LEU LEU A . n A 1 4 GLY 4 348 348 GLY GLY A . n A 1 5 SER 5 349 349 SER SER A . n A 1 6 MET 6 350 350 MET MET A . n A 1 7 PRO 7 351 351 PRO PRO A . n A 1 8 LEU 8 352 352 LEU LEU A . n A 1 9 LEU 9 353 353 LEU LEU A . n A 1 10 GLU 10 354 354 GLU GLU A . n A 1 11 THR 11 355 355 THR THR A . n A 1 12 LEU 12 356 356 LEU LEU A . n A 1 13 THR 13 357 357 THR THR A . n A 1 14 ASP 14 358 358 ASP ASP A . n A 1 15 ALA 15 359 359 ALA ALA A . n A 1 16 GLU 16 360 360 GLU GLU A . n A 1 17 MET 17 361 361 MET MET A . n A 1 18 GLU 18 362 362 GLU GLU A . n A 1 19 LYS 19 363 363 LYS LYS A . n A 1 20 LYS 20 364 364 LYS LYS A . n A 1 21 ILE 21 365 365 ILE ILE A . n A 1 22 ARG 22 366 366 ARG ARG A . n A 1 23 ASP 23 367 367 ASP ASP A . n A 1 24 GLN 24 368 368 GLN GLN A . n A 1 25 ASP 25 369 369 ASP ASP A . n A 1 26 ARG 26 370 370 ARG ARG A . n A 1 27 ASN 27 371 371 ASN ASN A . n A 1 28 THR 28 372 372 THR THR A . n A 1 29 ARG 29 373 373 ARG ARG A . n A 1 30 ARG 30 374 374 ARG ARG A . n A 1 31 MET 31 375 375 MET MET A . n A 1 32 ARG 32 376 376 ARG ARG A . n A 1 33 ARG 33 377 377 ARG ARG A . n A 1 34 LEU 34 378 378 LEU LEU A . n A 1 35 ALA 35 379 379 ALA ALA A . n A 1 36 ASN 36 380 380 ASN ASN A . n A 1 37 THR 37 381 381 THR THR A . n A 1 38 ALA 38 382 382 ALA ALA A . n A 1 39 PRO 39 383 383 PRO PRO A . n A 1 40 ALA 40 384 384 ALA ALA A . n A 1 41 TRP 41 385 385 TRP TRP A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6UCH _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 6UCH _struct.title 'SMARCB1 nucleosome-interacting C-terminal alpha helix' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6UCH _struct_keywords.text ;mSWI-SNF complex, BAF complex, Chromatin Remodeling, SMARCB1, BAF47, Positive charge cluster, Arginine cluster, Nucleosome Binding, Alpha Helix, NUCLEAR PROTEIN ; _struct_keywords.pdbx_keywords 'NUCLEAR PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SNF5_HUMAN _struct_ref.pdbx_db_accession Q12824 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code PLLETLTDAEMEKKIRDQDRNTRRMRRLANTAPAW _struct_ref.pdbx_align_begin 351 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6UCH _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 7 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 41 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q12824 _struct_ref_seq.db_align_beg 351 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 385 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 351 _struct_ref_seq.pdbx_auth_seq_align_end 385 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6UCH GLY A 1 ? UNP Q12824 ? ? 'expression tag' 345 1 1 6UCH PRO A 2 ? UNP Q12824 ? ? 'expression tag' 346 2 1 6UCH LEU A 3 ? UNP Q12824 ? ? 'expression tag' 347 3 1 6UCH GLY A 4 ? UNP Q12824 ? ? 'expression tag' 348 4 1 6UCH SER A 5 ? UNP Q12824 ? ? 'expression tag' 349 5 1 6UCH MET A 6 ? UNP Q12824 ? ? 'expression tag' 350 6 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id THR _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 13 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id LEU _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 34 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id THR _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 357 _struct_conf.end_auth_comp_id LEU _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 378 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 22 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 346 ? ? -47.66 -172.84 2 1 MET A 350 ? ? -28.24 90.75 3 1 LEU A 352 ? ? -154.81 38.06 4 1 LEU A 353 ? ? -168.44 24.60 5 1 GLU A 354 ? ? -110.34 59.41 6 1 THR A 355 ? ? -32.87 128.06 7 1 LEU A 356 ? ? -109.91 -161.68 8 1 THR A 357 ? ? -125.16 -167.93 9 1 ALA A 379 ? ? 178.62 78.02 10 1 ASN A 380 ? ? 177.53 110.78 11 1 ALA A 384 ? ? 163.66 148.89 12 2 MET A 350 ? ? -117.69 73.79 13 2 PRO A 351 ? ? -47.78 -165.97 14 2 GLU A 354 ? ? -103.98 -136.16 15 2 LEU A 356 ? ? -115.12 -163.60 16 2 THR A 357 ? ? -106.48 -169.11 17 2 LEU A 378 ? ? 174.32 111.87 18 2 ALA A 379 ? ? -123.76 -141.00 19 2 ASN A 380 ? ? 169.72 -14.48 20 2 ALA A 382 ? ? 51.55 90.59 21 2 PRO A 383 ? ? -47.82 -173.58 22 2 ALA A 384 ? ? 27.05 82.91 23 3 LEU A 347 ? ? 59.04 131.83 24 3 SER A 349 ? ? -164.82 -139.56 25 3 LEU A 352 ? ? -114.19 74.53 26 3 LEU A 353 ? ? 173.28 125.78 27 3 GLU A 354 ? ? 54.01 115.47 28 3 THR A 355 ? ? -45.96 -177.31 29 3 LEU A 356 ? ? -100.68 -160.79 30 3 THR A 357 ? ? -109.03 -165.13 31 3 LEU A 378 ? ? -97.29 39.29 32 3 ALA A 379 ? ? -58.76 -98.96 33 3 ASN A 380 ? ? -66.92 -97.63 34 3 THR A 381 ? ? 38.86 66.08 35 3 ALA A 382 ? ? 84.81 101.67 36 4 PRO A 346 ? ? -47.65 -19.71 37 4 MET A 350 ? ? -168.94 -61.22 38 4 LEU A 352 ? ? -106.37 69.92 39 4 LEU A 356 ? ? -109.56 -161.71 40 4 THR A 357 ? ? -126.12 -167.78 41 4 ALA A 379 ? ? -106.47 -100.77 42 4 ASN A 380 ? ? 73.14 123.51 43 4 THR A 381 ? ? -175.53 121.16 44 4 ALA A 382 ? ? 59.89 89.52 45 5 PRO A 346 ? ? -72.77 -83.75 46 5 LEU A 347 ? ? -159.90 81.41 47 5 SER A 349 ? ? 79.71 45.32 48 5 MET A 350 ? ? 34.95 69.84 49 5 PRO A 351 ? ? -47.59 -164.66 50 5 LEU A 352 ? ? 29.82 71.28 51 5 LEU A 353 ? ? 173.34 125.71 52 5 THR A 355 ? ? 73.74 -179.58 53 5 LEU A 356 ? ? -110.30 -161.68 54 5 THR A 357 ? ? -125.03 -166.54 55 5 LEU A 378 ? ? 83.68 129.26 56 5 ALA A 379 ? ? 77.81 -86.64 57 5 ASN A 380 ? ? 166.19 169.89 58 5 THR A 381 ? ? -90.43 -139.17 59 5 PRO A 383 ? ? -47.66 -166.32 60 6 PRO A 346 ? ? -47.66 96.05 61 6 LEU A 347 ? ? 54.16 80.42 62 6 MET A 350 ? ? -178.94 149.13 63 6 LEU A 352 ? ? 36.27 89.90 64 6 GLU A 354 ? ? 27.84 93.68 65 6 LEU A 356 ? ? -110.90 -161.66 66 6 THR A 357 ? ? -127.71 -167.46 67 6 LEU A 378 ? ? -51.76 -112.07 68 6 ASN A 380 ? ? 29.87 77.48 69 6 PRO A 383 ? ? -72.72 -160.55 70 6 ALA A 384 ? ? 36.92 65.97 71 7 LEU A 347 ? ? 43.04 -167.17 72 7 SER A 349 ? ? -124.70 -157.21 73 7 LEU A 352 ? ? 42.30 91.40 74 7 LEU A 356 ? ? -110.79 -161.95 75 7 LEU A 378 ? ? 64.32 118.84 76 8 MET A 350 ? ? 163.07 -51.09 77 8 PRO A 351 ? ? -47.62 -174.80 78 8 GLU A 354 ? ? -103.05 -136.13 79 8 THR A 355 ? ? 83.25 170.46 80 8 LEU A 356 ? ? -111.76 -161.90 81 8 THR A 357 ? ? -125.01 -165.95 82 8 LEU A 378 ? ? -59.44 -112.10 83 8 ALA A 379 ? ? -82.92 -137.53 84 8 ASN A 380 ? ? 161.64 -29.69 85 8 THR A 381 ? ? -162.29 103.10 86 8 ALA A 382 ? ? -30.66 94.68 87 8 ALA A 384 ? ? -151.58 -149.45 88 9 LEU A 352 ? ? -117.58 71.04 89 9 LEU A 353 ? ? 173.24 125.83 90 9 LEU A 356 ? ? -112.64 -161.96 91 9 THR A 357 ? ? -125.02 -166.14 92 9 ALA A 379 ? ? 162.30 127.47 93 9 THR A 381 ? ? -129.16 -139.27 94 9 ALA A 382 ? ? 71.65 137.58 95 9 ALA A 384 ? ? 79.11 143.74 96 10 LEU A 347 ? ? 66.51 88.21 97 10 SER A 349 ? ? -178.79 -164.43 98 10 MET A 350 ? ? 65.28 157.21 99 10 PRO A 351 ? ? -72.77 -157.47 100 10 LEU A 352 ? ? -79.00 44.15 101 10 GLU A 354 ? ? -164.37 114.80 102 10 THR A 355 ? ? -32.15 144.84 103 10 LEU A 356 ? ? -109.87 -161.71 104 10 THR A 357 ? ? -125.04 -167.22 105 10 LEU A 378 ? ? -123.53 -137.96 106 10 ALA A 379 ? ? 71.64 -85.50 107 10 PRO A 383 ? ? -72.80 -159.60 # _pdbx_nmr_ensemble.entry_id 6UCH _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 6UCH _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 '300 uM [U-100% 13C; U-100% 15N] SMARCB1CC, 137 mM NaCl, 2.7 mM potassium chloride, 10 mM Na2HPO4, 1.8 mM KH2PO4, 90% H2O/10% D2O' '90% H2O/10% D2O' 15N13C-SMARCB1CC solution ? 2 '230 uM SMARCB1CC, 137 mM NaCl, 2.7 mM potassium chloride, 10 mM Na2HPO4, 1.8 mM KH2PO4, 100% D2O' '100% D2O' unlabeled-SMARCB1CC solution ? # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 SMARCB1CC 300 ? uM '[U-100% 13C; U-100% 15N]' 1 NaCl 137 ? mM 'natural abundance' 1 'potassium chloride' 2.7 ? mM 'natural abundance' 1 Na2HPO4 10 ? mM 'natural abundance' 1 KH2PO4 1.8 ? mM 'natural abundance' 2 SMARCB1CC 230 ? uM 'natural abundance' 2 NaCl 137 ? mM 'natural abundance' 2 'potassium chloride' 2.7 ? mM 'natural abundance' 2 Na2HPO4 10 ? mM 'natural abundance' 2 KH2PO4 1.8 ? mM 'natural abundance' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 288 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength 150 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label 1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '3D HNCA' 1 isotropic 2 1 1 '3D HNCACB' 1 isotropic 3 1 1 '3D HNCO' 1 isotropic 4 1 1 '3D HN(CO)CA' 1 isotropic 5 1 1 '3D HN(CA)CO' 1 isotropic 6 1 1 '3D C(CO)NH' 1 isotropic 10 1 1 '3D H(CCO)NH' 1 isotropic 9 1 1 '3D 1H-15N NOESY' 1 isotropic 8 1 2 '2D NOESY' 1 isotropic 7 1 2 '2D TOCSY' 1 isotropic 12 1 1 '2D 1H-15N HSQC' 1 isotropic 11 1 1 '2D 1H-13C HSQC aliphatic' 1 isotropic 13 1 1 '2D 1H-13C HSQC aromatic' 1 isotropic # _pdbx_nmr_refine.entry_id 6UCH _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 4 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 collection VNMR ? Varian 2 processing NMRPipe ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 6 processing hmsIST ? 'Hyberts and Wagner' 3 'data analysis' CARA ? 'Keller and Wuthrich' 4 'structure calculation' 'X-PLOR NIH' ? 'Schwieters, Kuszewski, Tjandra and Clore' 5 'data analysis' TALOS ? 'Cornilescu, Delaglio and Bax' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 ILE N N N N 123 ILE CA C N S 124 ILE C C N N 125 ILE O O N N 126 ILE CB C N S 127 ILE CG1 C N N 128 ILE CG2 C N N 129 ILE CD1 C N N 130 ILE OXT O N N 131 ILE H H N N 132 ILE H2 H N N 133 ILE HA H N N 134 ILE HB H N N 135 ILE HG12 H N N 136 ILE HG13 H N N 137 ILE HG21 H N N 138 ILE HG22 H N N 139 ILE HG23 H N N 140 ILE HD11 H N N 141 ILE HD12 H N N 142 ILE HD13 H N N 143 ILE HXT H N N 144 LEU N N N N 145 LEU CA C N S 146 LEU C C N N 147 LEU O O N N 148 LEU CB C N N 149 LEU CG C N N 150 LEU CD1 C N N 151 LEU CD2 C N N 152 LEU OXT O N N 153 LEU H H N N 154 LEU H2 H N N 155 LEU HA H N N 156 LEU HB2 H N N 157 LEU HB3 H N N 158 LEU HG H N N 159 LEU HD11 H N N 160 LEU HD12 H N N 161 LEU HD13 H N N 162 LEU HD21 H N N 163 LEU HD22 H N N 164 LEU HD23 H N N 165 LEU HXT H N N 166 LYS N N N N 167 LYS CA C N S 168 LYS C C N N 169 LYS O O N N 170 LYS CB C N N 171 LYS CG C N N 172 LYS CD C N N 173 LYS CE C N N 174 LYS NZ N N N 175 LYS OXT O N N 176 LYS H H N N 177 LYS H2 H N N 178 LYS HA H N N 179 LYS HB2 H N N 180 LYS HB3 H N N 181 LYS HG2 H N N 182 LYS HG3 H N N 183 LYS HD2 H N N 184 LYS HD3 H N N 185 LYS HE2 H N N 186 LYS HE3 H N N 187 LYS HZ1 H N N 188 LYS HZ2 H N N 189 LYS HZ3 H N N 190 LYS HXT H N N 191 MET N N N N 192 MET CA C N S 193 MET C C N N 194 MET O O N N 195 MET CB C N N 196 MET CG C N N 197 MET SD S N N 198 MET CE C N N 199 MET OXT O N N 200 MET H H N N 201 MET H2 H N N 202 MET HA H N N 203 MET HB2 H N N 204 MET HB3 H N N 205 MET HG2 H N N 206 MET HG3 H N N 207 MET HE1 H N N 208 MET HE2 H N N 209 MET HE3 H N N 210 MET HXT H N N 211 PRO N N N N 212 PRO CA C N S 213 PRO C C N N 214 PRO O O N N 215 PRO CB C N N 216 PRO CG C N N 217 PRO CD C N N 218 PRO OXT O N N 219 PRO H H N N 220 PRO HA H N N 221 PRO HB2 H N N 222 PRO HB3 H N N 223 PRO HG2 H N N 224 PRO HG3 H N N 225 PRO HD2 H N N 226 PRO HD3 H N N 227 PRO HXT H N N 228 SER N N N N 229 SER CA C N S 230 SER C C N N 231 SER O O N N 232 SER CB C N N 233 SER OG O N N 234 SER OXT O N N 235 SER H H N N 236 SER H2 H N N 237 SER HA H N N 238 SER HB2 H N N 239 SER HB3 H N N 240 SER HG H N N 241 SER HXT H N N 242 THR N N N N 243 THR CA C N S 244 THR C C N N 245 THR O O N N 246 THR CB C N R 247 THR OG1 O N N 248 THR CG2 C N N 249 THR OXT O N N 250 THR H H N N 251 THR H2 H N N 252 THR HA H N N 253 THR HB H N N 254 THR HG1 H N N 255 THR HG21 H N N 256 THR HG22 H N N 257 THR HG23 H N N 258 THR HXT H N N 259 TRP N N N N 260 TRP CA C N S 261 TRP C C N N 262 TRP O O N N 263 TRP CB C N N 264 TRP CG C Y N 265 TRP CD1 C Y N 266 TRP CD2 C Y N 267 TRP NE1 N Y N 268 TRP CE2 C Y N 269 TRP CE3 C Y N 270 TRP CZ2 C Y N 271 TRP CZ3 C Y N 272 TRP CH2 C Y N 273 TRP OXT O N N 274 TRP H H N N 275 TRP H2 H N N 276 TRP HA H N N 277 TRP HB2 H N N 278 TRP HB3 H N N 279 TRP HD1 H N N 280 TRP HE1 H N N 281 TRP HE3 H N N 282 TRP HZ2 H N N 283 TRP HZ3 H N N 284 TRP HH2 H N N 285 TRP HXT H N N 286 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 ILE N CA sing N N 116 ILE N H sing N N 117 ILE N H2 sing N N 118 ILE CA C sing N N 119 ILE CA CB sing N N 120 ILE CA HA sing N N 121 ILE C O doub N N 122 ILE C OXT sing N N 123 ILE CB CG1 sing N N 124 ILE CB CG2 sing N N 125 ILE CB HB sing N N 126 ILE CG1 CD1 sing N N 127 ILE CG1 HG12 sing N N 128 ILE CG1 HG13 sing N N 129 ILE CG2 HG21 sing N N 130 ILE CG2 HG22 sing N N 131 ILE CG2 HG23 sing N N 132 ILE CD1 HD11 sing N N 133 ILE CD1 HD12 sing N N 134 ILE CD1 HD13 sing N N 135 ILE OXT HXT sing N N 136 LEU N CA sing N N 137 LEU N H sing N N 138 LEU N H2 sing N N 139 LEU CA C sing N N 140 LEU CA CB sing N N 141 LEU CA HA sing N N 142 LEU C O doub N N 143 LEU C OXT sing N N 144 LEU CB CG sing N N 145 LEU CB HB2 sing N N 146 LEU CB HB3 sing N N 147 LEU CG CD1 sing N N 148 LEU CG CD2 sing N N 149 LEU CG HG sing N N 150 LEU CD1 HD11 sing N N 151 LEU CD1 HD12 sing N N 152 LEU CD1 HD13 sing N N 153 LEU CD2 HD21 sing N N 154 LEU CD2 HD22 sing N N 155 LEU CD2 HD23 sing N N 156 LEU OXT HXT sing N N 157 LYS N CA sing N N 158 LYS N H sing N N 159 LYS N H2 sing N N 160 LYS CA C sing N N 161 LYS CA CB sing N N 162 LYS CA HA sing N N 163 LYS C O doub N N 164 LYS C OXT sing N N 165 LYS CB CG sing N N 166 LYS CB HB2 sing N N 167 LYS CB HB3 sing N N 168 LYS CG CD sing N N 169 LYS CG HG2 sing N N 170 LYS CG HG3 sing N N 171 LYS CD CE sing N N 172 LYS CD HD2 sing N N 173 LYS CD HD3 sing N N 174 LYS CE NZ sing N N 175 LYS CE HE2 sing N N 176 LYS CE HE3 sing N N 177 LYS NZ HZ1 sing N N 178 LYS NZ HZ2 sing N N 179 LYS NZ HZ3 sing N N 180 LYS OXT HXT sing N N 181 MET N CA sing N N 182 MET N H sing N N 183 MET N H2 sing N N 184 MET CA C sing N N 185 MET CA CB sing N N 186 MET CA HA sing N N 187 MET C O doub N N 188 MET C OXT sing N N 189 MET CB CG sing N N 190 MET CB HB2 sing N N 191 MET CB HB3 sing N N 192 MET CG SD sing N N 193 MET CG HG2 sing N N 194 MET CG HG3 sing N N 195 MET SD CE sing N N 196 MET CE HE1 sing N N 197 MET CE HE2 sing N N 198 MET CE HE3 sing N N 199 MET OXT HXT sing N N 200 PRO N CA sing N N 201 PRO N CD sing N N 202 PRO N H sing N N 203 PRO CA C sing N N 204 PRO CA CB sing N N 205 PRO CA HA sing N N 206 PRO C O doub N N 207 PRO C OXT sing N N 208 PRO CB CG sing N N 209 PRO CB HB2 sing N N 210 PRO CB HB3 sing N N 211 PRO CG CD sing N N 212 PRO CG HG2 sing N N 213 PRO CG HG3 sing N N 214 PRO CD HD2 sing N N 215 PRO CD HD3 sing N N 216 PRO OXT HXT sing N N 217 SER N CA sing N N 218 SER N H sing N N 219 SER N H2 sing N N 220 SER CA C sing N N 221 SER CA CB sing N N 222 SER CA HA sing N N 223 SER C O doub N N 224 SER C OXT sing N N 225 SER CB OG sing N N 226 SER CB HB2 sing N N 227 SER CB HB3 sing N N 228 SER OG HG sing N N 229 SER OXT HXT sing N N 230 THR N CA sing N N 231 THR N H sing N N 232 THR N H2 sing N N 233 THR CA C sing N N 234 THR CA CB sing N N 235 THR CA HA sing N N 236 THR C O doub N N 237 THR C OXT sing N N 238 THR CB OG1 sing N N 239 THR CB CG2 sing N N 240 THR CB HB sing N N 241 THR OG1 HG1 sing N N 242 THR CG2 HG21 sing N N 243 THR CG2 HG22 sing N N 244 THR CG2 HG23 sing N N 245 THR OXT HXT sing N N 246 TRP N CA sing N N 247 TRP N H sing N N 248 TRP N H2 sing N N 249 TRP CA C sing N N 250 TRP CA CB sing N N 251 TRP CA HA sing N N 252 TRP C O doub N N 253 TRP C OXT sing N N 254 TRP CB CG sing N N 255 TRP CB HB2 sing N N 256 TRP CB HB3 sing N N 257 TRP CG CD1 doub Y N 258 TRP CG CD2 sing Y N 259 TRP CD1 NE1 sing Y N 260 TRP CD1 HD1 sing N N 261 TRP CD2 CE2 doub Y N 262 TRP CD2 CE3 sing Y N 263 TRP NE1 CE2 sing Y N 264 TRP NE1 HE1 sing N N 265 TRP CE2 CZ2 sing Y N 266 TRP CE3 CZ3 doub Y N 267 TRP CE3 HE3 sing N N 268 TRP CZ2 CH2 doub Y N 269 TRP CZ2 HZ2 sing N N 270 TRP CZ3 CH2 sing Y N 271 TRP CZ3 HZ3 sing N N 272 TRP CH2 HH2 sing N N 273 TRP OXT HXT sing N N 274 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute of Environmental Health Sciences (NIH/NIEHS)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model DD2 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Agilent _pdbx_nmr_spectrometer.field_strength 700 _pdbx_nmr_spectrometer.details 'cryogenic probe' # _atom_sites.entry_id 6UCH _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_