data_6UMZ # _entry.id 6UMZ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6UMZ pdb_00006umz 10.2210/pdb6umz/pdb WWPDB D_1000244868 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-07-15 2 'Structure model' 1 1 2020-08-19 3 'Structure model' 1 2 2020-11-04 4 'Structure model' 1 3 2023-10-11 5 'Structure model' 1 4 2024-11-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Refinement description' 6 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 4 'Structure model' chem_comp_atom 5 4 'Structure model' chem_comp_bond 6 4 'Structure model' citation 7 4 'Structure model' database_2 8 4 'Structure model' pdbx_initial_refinement_model 9 5 'Structure model' pdbx_entry_details 10 5 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.pdbx_database_id_PubMed' 7 2 'Structure model' '_citation.title' 8 2 'Structure model' '_citation_author.identifier_ORCID' 9 2 'Structure model' '_citation_author.name' 10 3 'Structure model' '_citation.page_first' 11 4 'Structure model' '_citation.country' 12 4 'Structure model' '_database_2.pdbx_DOI' 13 4 'Structure model' '_database_2.pdbx_database_accession' 14 5 'Structure model' '_pdbx_entry_details.has_protein_modification' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6UMZ _pdbx_database_status.recvd_initial_deposition_date 2019-10-10 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Lin, C.-Y.' 1 0000-0001-6555-8767 'Romei, M.G.' 2 0000-0001-6798-7493 'Boxer, S.G.' 3 0000-0001-9167-4286 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country CH _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'J Photochem Photobiol A Chem' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1010-6030 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 401 _citation.language ? _citation.page_first 112738 _citation.page_last ? _citation.title ;Structural and spectroscopic characterization of photoactive yellow protein and photoswitchable fluorescent protein constructs containing heavy atoms. ; _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.jphotochem.2020.112738 _citation.pdbx_database_id_PubMed 32753830 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Romei, M.G.' 1 ? primary 'Lin, C.Y.' 2 ? primary 'Boxer, S.G.' 3 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Photoactive yellow protein' 14170.851 1 ? ? ? ? 2 non-polymer syn '(2E)-3-(3-bromo-4-hydroxyphenyl)prop-2-enoic acid' 243.054 1 ? ? ? ? 3 water nat water 18.015 150 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name PYP # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSHMEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYG KFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV ; _entity_poly.pdbx_seq_one_letter_code_can ;GSHMEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYG KFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '(2E)-3-(3-bromo-4-hydroxyphenyl)prop-2-enoic acid' QBV 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 MET n 1 5 GLU n 1 6 HIS n 1 7 VAL n 1 8 ALA n 1 9 PHE n 1 10 GLY n 1 11 SER n 1 12 GLU n 1 13 ASP n 1 14 ILE n 1 15 GLU n 1 16 ASN n 1 17 THR n 1 18 LEU n 1 19 ALA n 1 20 LYS n 1 21 MET n 1 22 ASP n 1 23 ASP n 1 24 GLY n 1 25 GLN n 1 26 LEU n 1 27 ASP n 1 28 GLY n 1 29 LEU n 1 30 ALA n 1 31 PHE n 1 32 GLY n 1 33 ALA n 1 34 ILE n 1 35 GLN n 1 36 LEU n 1 37 ASP n 1 38 GLY n 1 39 ASP n 1 40 GLY n 1 41 ASN n 1 42 ILE n 1 43 LEU n 1 44 GLN n 1 45 TYR n 1 46 ASN n 1 47 ALA n 1 48 ALA n 1 49 GLU n 1 50 GLY n 1 51 ASP n 1 52 ILE n 1 53 THR n 1 54 GLY n 1 55 ARG n 1 56 ASP n 1 57 PRO n 1 58 LYS n 1 59 GLN n 1 60 VAL n 1 61 ILE n 1 62 GLY n 1 63 LYS n 1 64 ASN n 1 65 PHE n 1 66 PHE n 1 67 LYS n 1 68 ASP n 1 69 VAL n 1 70 ALA n 1 71 PRO n 1 72 CYS n 1 73 THR n 1 74 ASP n 1 75 SER n 1 76 PRO n 1 77 GLU n 1 78 PHE n 1 79 TYR n 1 80 GLY n 1 81 LYS n 1 82 PHE n 1 83 LYS n 1 84 GLU n 1 85 GLY n 1 86 VAL n 1 87 ALA n 1 88 SER n 1 89 GLY n 1 90 ASN n 1 91 LEU n 1 92 ASN n 1 93 THR n 1 94 MET n 1 95 PHE n 1 96 GLU n 1 97 TYR n 1 98 THR n 1 99 PHE n 1 100 ASP n 1 101 TYR n 1 102 GLN n 1 103 MET n 1 104 THR n 1 105 PRO n 1 106 THR n 1 107 LYS n 1 108 VAL n 1 109 LYS n 1 110 VAL n 1 111 HIS n 1 112 MET n 1 113 LYS n 1 114 LYS n 1 115 ALA n 1 116 LEU n 1 117 SER n 1 118 GLY n 1 119 ASP n 1 120 SER n 1 121 TYR n 1 122 TRP n 1 123 VAL n 1 124 PHE n 1 125 VAL n 1 126 LYS n 1 127 ARG n 1 128 VAL n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 128 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene pyp _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Halorhodospira halophila' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1053 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 QBV non-polymer . '(2E)-3-(3-bromo-4-hydroxyphenyl)prop-2-enoic acid' ? 'C9 H7 Br O3' 243.054 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -2 ? ? ? A . n A 1 2 SER 2 -1 -1 SER SER A . n A 1 3 HIS 3 0 0 HIS HIS A . n A 1 4 MET 4 1 1 MET MET A . n A 1 5 GLU 5 2 2 GLU GLU A . n A 1 6 HIS 6 3 3 HIS HIS A . n A 1 7 VAL 7 4 4 VAL VAL A . n A 1 8 ALA 8 5 5 ALA ALA A . n A 1 9 PHE 9 6 6 PHE PHE A . n A 1 10 GLY 10 7 7 GLY GLY A . n A 1 11 SER 11 8 8 SER SER A . n A 1 12 GLU 12 9 9 GLU GLU A . n A 1 13 ASP 13 10 10 ASP ASP A . n A 1 14 ILE 14 11 11 ILE ILE A . n A 1 15 GLU 15 12 12 GLU GLU A . n A 1 16 ASN 16 13 13 ASN ASN A . n A 1 17 THR 17 14 14 THR THR A . n A 1 18 LEU 18 15 15 LEU LEU A . n A 1 19 ALA 19 16 16 ALA ALA A . n A 1 20 LYS 20 17 17 LYS LYS A . n A 1 21 MET 21 18 18 MET MET A . n A 1 22 ASP 22 19 19 ASP ASP A . n A 1 23 ASP 23 20 20 ASP ASP A . n A 1 24 GLY 24 21 21 GLY GLY A . n A 1 25 GLN 25 22 22 GLN GLN A . n A 1 26 LEU 26 23 23 LEU LEU A . n A 1 27 ASP 27 24 24 ASP ASP A . n A 1 28 GLY 28 25 25 GLY GLY A . n A 1 29 LEU 29 26 26 LEU LEU A . n A 1 30 ALA 30 27 27 ALA ALA A . n A 1 31 PHE 31 28 28 PHE PHE A . n A 1 32 GLY 32 29 29 GLY GLY A . n A 1 33 ALA 33 30 30 ALA ALA A . n A 1 34 ILE 34 31 31 ILE ILE A . n A 1 35 GLN 35 32 32 GLN GLN A . n A 1 36 LEU 36 33 33 LEU LEU A . n A 1 37 ASP 37 34 34 ASP ASP A . n A 1 38 GLY 38 35 35 GLY GLY A . n A 1 39 ASP 39 36 36 ASP ASP A . n A 1 40 GLY 40 37 37 GLY GLY A . n A 1 41 ASN 41 38 38 ASN ASN A . n A 1 42 ILE 42 39 39 ILE ILE A . n A 1 43 LEU 43 40 40 LEU LEU A . n A 1 44 GLN 44 41 41 GLN GLN A . n A 1 45 TYR 45 42 42 TYR TYR A . n A 1 46 ASN 46 43 43 ASN ASN A . n A 1 47 ALA 47 44 44 ALA ALA A . n A 1 48 ALA 48 45 45 ALA ALA A . n A 1 49 GLU 49 46 46 GLU GLU A . n A 1 50 GLY 50 47 47 GLY GLY A . n A 1 51 ASP 51 48 48 ASP ASP A . n A 1 52 ILE 52 49 49 ILE ILE A . n A 1 53 THR 53 50 50 THR THR A . n A 1 54 GLY 54 51 51 GLY GLY A . n A 1 55 ARG 55 52 52 ARG ARG A . n A 1 56 ASP 56 53 53 ASP ASP A . n A 1 57 PRO 57 54 54 PRO PRO A . n A 1 58 LYS 58 55 55 LYS LYS A . n A 1 59 GLN 59 56 56 GLN GLN A . n A 1 60 VAL 60 57 57 VAL VAL A . n A 1 61 ILE 61 58 58 ILE ILE A . n A 1 62 GLY 62 59 59 GLY GLY A . n A 1 63 LYS 63 60 60 LYS LYS A . n A 1 64 ASN 64 61 61 ASN ASN A . n A 1 65 PHE 65 62 62 PHE PHE A . n A 1 66 PHE 66 63 63 PHE PHE A . n A 1 67 LYS 67 64 64 LYS LYS A . n A 1 68 ASP 68 65 65 ASP ASP A . n A 1 69 VAL 69 66 66 VAL VAL A . n A 1 70 ALA 70 67 67 ALA ALA A . n A 1 71 PRO 71 68 68 PRO PRO A . n A 1 72 CYS 72 69 69 CYS CYS A . n A 1 73 THR 73 70 70 THR THR A . n A 1 74 ASP 74 71 71 ASP ASP A . n A 1 75 SER 75 72 72 SER SER A . n A 1 76 PRO 76 73 73 PRO PRO A . n A 1 77 GLU 77 74 74 GLU GLU A . n A 1 78 PHE 78 75 75 PHE PHE A . n A 1 79 TYR 79 76 76 TYR TYR A . n A 1 80 GLY 80 77 77 GLY GLY A . n A 1 81 LYS 81 78 78 LYS LYS A . n A 1 82 PHE 82 79 79 PHE PHE A . n A 1 83 LYS 83 80 80 LYS LYS A . n A 1 84 GLU 84 81 81 GLU GLU A . n A 1 85 GLY 85 82 82 GLY GLY A . n A 1 86 VAL 86 83 83 VAL VAL A . n A 1 87 ALA 87 84 84 ALA ALA A . n A 1 88 SER 88 85 85 SER SER A . n A 1 89 GLY 89 86 86 GLY GLY A . n A 1 90 ASN 90 87 87 ASN ASN A . n A 1 91 LEU 91 88 88 LEU LEU A . n A 1 92 ASN 92 89 89 ASN ASN A . n A 1 93 THR 93 90 90 THR THR A . n A 1 94 MET 94 91 91 MET MET A . n A 1 95 PHE 95 92 92 PHE PHE A . n A 1 96 GLU 96 93 93 GLU GLU A . n A 1 97 TYR 97 94 94 TYR TYR A . n A 1 98 THR 98 95 95 THR THR A . n A 1 99 PHE 99 96 96 PHE PHE A . n A 1 100 ASP 100 97 97 ASP ASP A . n A 1 101 TYR 101 98 98 TYR TYR A . n A 1 102 GLN 102 99 99 GLN GLN A . n A 1 103 MET 103 100 100 MET MET A . n A 1 104 THR 104 101 101 THR THR A . n A 1 105 PRO 105 102 102 PRO PRO A . n A 1 106 THR 106 103 103 THR THR A . n A 1 107 LYS 107 104 104 LYS LYS A . n A 1 108 VAL 108 105 105 VAL VAL A . n A 1 109 LYS 109 106 106 LYS LYS A . n A 1 110 VAL 110 107 107 VAL VAL A . n A 1 111 HIS 111 108 108 HIS HIS A . n A 1 112 MET 112 109 109 MET MET A . n A 1 113 LYS 113 110 110 LYS LYS A . n A 1 114 LYS 114 111 111 LYS LYS A . n A 1 115 ALA 115 112 112 ALA ALA A . n A 1 116 LEU 116 113 113 LEU LEU A . n A 1 117 SER 117 114 114 SER SER A . n A 1 118 GLY 118 115 115 GLY GLY A . n A 1 119 ASP 119 116 116 ASP ASP A . n A 1 120 SER 120 117 117 SER SER A . n A 1 121 TYR 121 118 118 TYR TYR A . n A 1 122 TRP 122 119 119 TRP TRP A . n A 1 123 VAL 123 120 120 VAL VAL A . n A 1 124 PHE 124 121 121 PHE PHE A . n A 1 125 VAL 125 122 122 VAL VAL A . n A 1 126 LYS 126 123 123 LYS LYS A . n A 1 127 ARG 127 124 124 ARG ARG A . n A 1 128 VAL 128 125 125 VAL VAL A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id QBV _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id QBV _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 QBV 1 201 201 QBV QBV A . C 3 HOH 1 301 301 HOH HOH A . C 3 HOH 2 302 302 HOH HOH A . C 3 HOH 3 303 303 HOH HOH A . C 3 HOH 4 304 304 HOH HOH A . C 3 HOH 5 305 305 HOH HOH A . C 3 HOH 6 306 306 HOH HOH A . C 3 HOH 7 307 307 HOH HOH A . C 3 HOH 8 308 308 HOH HOH A . C 3 HOH 9 309 309 HOH HOH A . C 3 HOH 10 310 310 HOH HOH A . C 3 HOH 11 311 311 HOH HOH A . C 3 HOH 12 312 312 HOH HOH A . C 3 HOH 13 313 313 HOH HOH A . C 3 HOH 14 314 314 HOH HOH A . C 3 HOH 15 315 315 HOH HOH A . C 3 HOH 16 316 316 HOH HOH A . C 3 HOH 17 317 317 HOH HOH A . C 3 HOH 18 318 318 HOH HOH A . C 3 HOH 19 319 319 HOH HOH A . C 3 HOH 20 320 320 HOH HOH A . C 3 HOH 21 321 321 HOH HOH A . C 3 HOH 22 322 322 HOH HOH A . C 3 HOH 23 323 323 HOH HOH A . C 3 HOH 24 324 324 HOH HOH A . C 3 HOH 25 325 325 HOH HOH A . C 3 HOH 26 326 326 HOH HOH A . C 3 HOH 27 327 327 HOH HOH A . C 3 HOH 28 328 328 HOH HOH A . C 3 HOH 29 329 329 HOH HOH A . C 3 HOH 30 330 330 HOH HOH A . C 3 HOH 31 331 331 HOH HOH A . C 3 HOH 32 332 332 HOH HOH A . C 3 HOH 33 333 333 HOH HOH A . C 3 HOH 34 334 334 HOH HOH A . C 3 HOH 35 335 335 HOH HOH A . C 3 HOH 36 336 336 HOH HOH A . C 3 HOH 37 337 337 HOH HOH A . C 3 HOH 38 338 338 HOH HOH A . C 3 HOH 39 339 339 HOH HOH A . C 3 HOH 40 340 340 HOH HOH A . C 3 HOH 41 341 341 HOH HOH A . C 3 HOH 42 342 342 HOH HOH A . C 3 HOH 43 343 343 HOH HOH A . C 3 HOH 44 344 344 HOH HOH A . C 3 HOH 45 345 345 HOH HOH A . C 3 HOH 46 346 346 HOH HOH A . C 3 HOH 47 347 347 HOH HOH A . C 3 HOH 48 348 348 HOH HOH A . C 3 HOH 49 349 349 HOH HOH A . C 3 HOH 50 350 350 HOH HOH A . C 3 HOH 51 351 351 HOH HOH A . C 3 HOH 52 352 352 HOH HOH A . C 3 HOH 53 353 353 HOH HOH A . C 3 HOH 54 354 354 HOH HOH A . C 3 HOH 55 355 355 HOH HOH A . C 3 HOH 56 356 356 HOH HOH A . C 3 HOH 57 357 357 HOH HOH A . C 3 HOH 58 358 358 HOH HOH A . C 3 HOH 59 359 359 HOH HOH A . C 3 HOH 60 360 360 HOH HOH A . C 3 HOH 61 361 361 HOH HOH A . C 3 HOH 62 362 362 HOH HOH A . C 3 HOH 63 363 363 HOH HOH A . C 3 HOH 64 364 364 HOH HOH A . C 3 HOH 65 365 365 HOH HOH A . C 3 HOH 66 366 366 HOH HOH A . C 3 HOH 67 367 367 HOH HOH A . C 3 HOH 68 368 368 HOH HOH A . C 3 HOH 69 369 369 HOH HOH A . C 3 HOH 70 370 370 HOH HOH A . C 3 HOH 71 371 371 HOH HOH A . C 3 HOH 72 372 372 HOH HOH A . C 3 HOH 73 373 373 HOH HOH A . C 3 HOH 74 374 374 HOH HOH A . C 3 HOH 75 375 375 HOH HOH A . C 3 HOH 76 376 376 HOH HOH A . C 3 HOH 77 377 377 HOH HOH A . C 3 HOH 78 378 378 HOH HOH A . C 3 HOH 79 379 379 HOH HOH A . C 3 HOH 80 380 380 HOH HOH A . C 3 HOH 81 381 381 HOH HOH A . C 3 HOH 82 382 382 HOH HOH A . C 3 HOH 83 383 383 HOH HOH A . C 3 HOH 84 384 384 HOH HOH A . C 3 HOH 85 385 385 HOH HOH A . C 3 HOH 86 386 386 HOH HOH A . C 3 HOH 87 387 387 HOH HOH A . C 3 HOH 88 388 388 HOH HOH A . C 3 HOH 89 389 389 HOH HOH A . C 3 HOH 90 390 390 HOH HOH A . C 3 HOH 91 391 391 HOH HOH A . C 3 HOH 92 392 392 HOH HOH A . C 3 HOH 93 393 393 HOH HOH A . C 3 HOH 94 394 394 HOH HOH A . C 3 HOH 95 395 395 HOH HOH A . C 3 HOH 96 396 396 HOH HOH A . C 3 HOH 97 397 397 HOH HOH A . C 3 HOH 98 398 398 HOH HOH A . C 3 HOH 99 399 399 HOH HOH A . C 3 HOH 100 400 400 HOH HOH A . C 3 HOH 101 401 401 HOH HOH A . C 3 HOH 102 402 402 HOH HOH A . C 3 HOH 103 403 403 HOH HOH A . C 3 HOH 104 404 404 HOH HOH A . C 3 HOH 105 405 405 HOH HOH A . C 3 HOH 106 406 406 HOH HOH A . C 3 HOH 107 407 407 HOH HOH A . C 3 HOH 108 408 408 HOH HOH A . C 3 HOH 109 409 409 HOH HOH A . C 3 HOH 110 410 410 HOH HOH A . C 3 HOH 111 411 411 HOH HOH A . C 3 HOH 112 412 412 HOH HOH A . C 3 HOH 113 413 413 HOH HOH A . C 3 HOH 114 414 414 HOH HOH A . C 3 HOH 115 415 415 HOH HOH A . C 3 HOH 116 416 416 HOH HOH A . C 3 HOH 117 417 417 HOH HOH A . C 3 HOH 118 418 418 HOH HOH A . C 3 HOH 119 419 419 HOH HOH A . C 3 HOH 120 420 420 HOH HOH A . C 3 HOH 121 421 421 HOH HOH A . C 3 HOH 122 422 422 HOH HOH A . C 3 HOH 123 423 423 HOH HOH A . C 3 HOH 124 424 424 HOH HOH A . C 3 HOH 125 425 425 HOH HOH A . C 3 HOH 126 426 426 HOH HOH A . C 3 HOH 127 427 427 HOH HOH A . C 3 HOH 128 428 428 HOH HOH A . C 3 HOH 129 429 429 HOH HOH A . C 3 HOH 130 430 430 HOH HOH A . C 3 HOH 131 431 431 HOH HOH A . C 3 HOH 132 432 432 HOH HOH A . C 3 HOH 133 433 433 HOH HOH A . C 3 HOH 134 434 434 HOH HOH A . C 3 HOH 135 435 435 HOH HOH A . C 3 HOH 136 436 436 HOH HOH A . C 3 HOH 137 437 437 HOH HOH A . C 3 HOH 138 438 438 HOH HOH A . C 3 HOH 139 439 439 HOH HOH A . C 3 HOH 140 440 440 HOH HOH A . C 3 HOH 141 441 441 HOH HOH A . C 3 HOH 142 442 442 HOH HOH A . C 3 HOH 143 443 443 HOH HOH A . C 3 HOH 144 444 444 HOH HOH A . C 3 HOH 145 445 445 HOH HOH A . C 3 HOH 146 446 446 HOH HOH A . C 3 HOH 147 447 447 HOH HOH A . C 3 HOH 148 448 448 HOH HOH A . C 3 HOH 149 449 449 HOH HOH A . C 3 HOH 150 450 450 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.13RC2_2986 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.7.3 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 6UMZ _cell.details ? _cell.formula_units_Z ? _cell.length_a 65.767 _cell.length_a_esd ? _cell.length_b 65.767 _cell.length_b_esd ? _cell.length_c 40.577 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6UMZ _symmetry.cell_setting ? _symmetry.Int_Tables_number 173 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 63' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6UMZ _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.79 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 31.19 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '20 mM potassium phosphate, pH 6.0, 1 M NaCl, 1.9 M ammonium sulfate' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2019-02-10 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.885570 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRL BEAMLINE BL9-2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.885570 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL9-2 _diffrn_source.pdbx_synchrotron_site SSRL # _reflns.B_iso_Wilson_estimate 8.110 _reflns.entry_id 6UMZ _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 0.900 _reflns.d_resolution_low 33.050 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 69351 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 93.700 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 60.100 _reflns.pdbx_Rmerge_I_obs 0.065 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 39.100 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects 285 _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.065 _reflns.pdbx_Rpim_I_all 0.008 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 4167073 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 1.000 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 0.900 _reflns_shell.d_res_low 0.920 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all 68511 _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 2834 _reflns_shell.percent_possible_all 77.500 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 2.011 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 24.200 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs 1.900 _reflns_shell.pdbx_Rrim_I_all 2.055 _reflns_shell.pdbx_Rpim_I_all 0.415 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.656 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 52.380 _refine.B_iso_mean 13.0200 _refine.B_iso_min 3.390 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6UMZ _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 0.9000 _refine.ls_d_res_low 33.0500 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 69337 _refine.ls_number_reflns_R_free 1997 _refine.ls_number_reflns_R_work 67340 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 93.7000 _refine.ls_percent_reflns_R_free 2.8800 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1270 _refine.ls_R_factor_R_free 0.1370 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1270 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.340 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1NWZ _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 12.7900 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.0600 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 0.9000 _refine_hist.d_res_low 33.0500 _refine_hist.number_atoms_solvent 150 _refine_hist.number_atoms_total 1159 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 127 _refine_hist.pdbx_B_iso_mean_ligand 7.80 _refine_hist.pdbx_B_iso_mean_solvent 20.67 _refine_hist.pdbx_number_atoms_protein 992 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 17 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 0.9000 0.9225 4088 . 118 3970 78.0000 . . . 0.2460 0.0000 0.2183 . . . . . . . 14 . . . 'X-RAY DIFFRACTION' 0.9225 0.9475 4331 . 125 4206 83.0000 . . . 0.1886 0.0000 0.1786 . . . . . . . 14 . . . 'X-RAY DIFFRACTION' 0.9475 0.9753 4539 . 128 4411 86.0000 . . . 0.2095 0.0000 0.1627 . . . . . . . 14 . . . 'X-RAY DIFFRACTION' 0.9753 1.0068 4768 . 137 4631 90.0000 . . . 0.1545 0.0000 0.1327 . . . . . . . 14 . . . 'X-RAY DIFFRACTION' 1.0068 1.0428 4981 . 146 4835 95.0000 . . . 0.1177 0.0000 0.1136 . . . . . . . 14 . . . 'X-RAY DIFFRACTION' 1.0428 1.0846 5018 . 144 4874 96.0000 . . . 0.1101 0.0000 0.1052 . . . . . . . 14 . . . 'X-RAY DIFFRACTION' 1.0846 1.1339 5077 . 144 4933 96.0000 . . . 0.1178 0.0000 0.0991 . . . . . . . 14 . . . 'X-RAY DIFFRACTION' 1.1339 1.1937 5097 . 146 4951 97.0000 . . . 0.1001 0.0000 0.0948 . . . . . . . 14 . . . 'X-RAY DIFFRACTION' 1.1937 1.2685 5124 . 151 4973 97.0000 . . . 0.1018 0.0000 0.1006 . . . . . . . 14 . . . 'X-RAY DIFFRACTION' 1.2685 1.3664 5159 . 148 5011 98.0000 . . . 0.1389 0.0000 0.1040 . . . . . . . 14 . . . 'X-RAY DIFFRACTION' 1.3664 1.5040 5213 . 152 5061 98.0000 . . . 0.1292 0.0000 0.1098 . . . . . . . 14 . . . 'X-RAY DIFFRACTION' 1.5040 1.7216 5241 . 152 5089 99.0000 . . . 0.1291 0.0000 0.1182 . . . . . . . 14 . . . 'X-RAY DIFFRACTION' 1.7216 2.1689 5288 . 151 5137 99.0000 . . . 0.1423 0.0000 0.1278 . . . . . . . 14 . . . 'X-RAY DIFFRACTION' 2.1689 33.0480 5413 . 155 5258 100.0000 . . . 0.1460 0.0000 0.1461 . . . . . . . 14 . . . # _struct.entry_id 6UMZ _struct.title 'Crystal structure of photoactive yellow protein (PYP); 3-Br-p-coumaric acid chromophore' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6UMZ _struct_keywords.text 'photoactive yellow protein, SIGNALING PROTEIN' _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PYP_HALHA _struct_ref.pdbx_db_accession P16113 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFK EGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6UMZ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 128 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P16113 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 125 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 125 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6UMZ GLY A 1 ? UNP P16113 ? ? 'expression tag' -2 1 1 6UMZ SER A 2 ? UNP P16113 ? ? 'expression tag' -1 2 1 6UMZ HIS A 3 ? UNP P16113 ? ? 'expression tag' 0 3 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 6450 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 13 ? ALA A 19 ? ASP A 10 ALA A 16 1 ? 7 HELX_P HELX_P2 AA2 ASP A 22 ? ASP A 27 ? ASP A 19 ASP A 24 1 ? 6 HELX_P HELX_P3 AA3 ASN A 46 ? GLY A 54 ? ASN A 43 GLY A 51 1 ? 9 HELX_P HELX_P4 AA4 ASP A 56 ? ILE A 61 ? ASP A 53 ILE A 58 1 ? 6 HELX_P HELX_P5 AA5 ALA A 70 ? ASP A 74 ? ALA A 67 ASP A 71 5 ? 5 HELX_P HELX_P6 AA6 PHE A 78 ? GLY A 89 ? PHE A 75 GLY A 86 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag one _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 72 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id B _struct_conn.ptnr2_label_comp_id QBV _struct_conn.ptnr2_label_seq_id . _struct_conn.ptnr2_label_atom_id C1 _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 69 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id QBV _struct_conn.ptnr2_auth_seq_id 201 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.772 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id QBV _pdbx_modification_feature.label_asym_id B _pdbx_modification_feature.label_seq_id . _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id CYS _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 72 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id QBV _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 201 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id CYS _pdbx_modification_feature.modified_residue_auth_asym_id A _pdbx_modification_feature.modified_residue_auth_seq_id 69 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom C1 _pdbx_modification_feature.modified_residue_id_linking_atom SG _pdbx_modification_feature.modified_residue_id CYS _pdbx_modification_feature.ref_pcm_id 1 _pdbx_modification_feature.ref_comp_id QBV _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Covalent chemical modification' # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 42 ? TYR A 45 ? ILE A 39 TYR A 42 AA1 2 GLY A 32 ? LEU A 36 ? GLY A 29 LEU A 33 AA1 3 TYR A 121 ? ARG A 127 ? TYR A 118 ARG A 124 AA1 4 THR A 106 ? LYS A 114 ? THR A 103 LYS A 111 AA1 5 ASN A 92 ? PHE A 99 ? ASN A 89 PHE A 96 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O LEU A 43 ? O LEU A 40 N GLN A 35 ? N GLN A 32 AA1 2 3 N LEU A 36 ? N LEU A 33 O TYR A 121 ? O TYR A 118 AA1 3 4 O PHE A 124 ? O PHE A 121 N HIS A 111 ? N HIS A 108 AA1 4 5 O VAL A 110 ? O VAL A 107 N PHE A 95 ? N PHE A 92 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id QBV _struct_site.pdbx_auth_seq_id 201 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 11 _struct_site.details 'binding site for residue QBV A 201' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 11 TYR A 45 ? TYR A 42 . ? 1_555 ? 2 AC1 11 GLU A 49 ? GLU A 46 . ? 1_555 ? 3 AC1 11 THR A 53 ? THR A 50 . ? 1_555 ? 4 AC1 11 ARG A 55 ? ARG A 52 . ? 1_555 ? 5 AC1 11 PHE A 65 ? PHE A 62 . ? 1_555 ? 6 AC1 11 VAL A 69 ? VAL A 66 . ? 1_555 ? 7 AC1 11 ALA A 70 ? ALA A 67 . ? 1_555 ? 8 AC1 11 PRO A 71 ? PRO A 68 . ? 1_555 ? 9 AC1 11 CYS A 72 ? CYS A 69 . ? 1_555 ? 10 AC1 11 PHE A 99 ? PHE A 96 . ? 1_555 ? 11 AC1 11 TYR A 101 ? TYR A 98 . ? 1_555 ? # _pdbx_entry_details.entry_id 6UMZ _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A HOH 386 ? ? O A HOH 414 ? ? 2.13 2 1 OD2 A ASP 20 ? ? O A HOH 301 ? ? 2.18 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 HOH _pdbx_validate_symm_contact.auth_seq_id_1 336 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 HOH _pdbx_validate_symm_contact.auth_seq_id_2 420 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 6_664 _pdbx_validate_symm_contact.dist 2.18 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 CG _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 MET _pdbx_validate_rmsd_angle.auth_seq_id_1 109 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 SD _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 MET _pdbx_validate_rmsd_angle.auth_seq_id_2 109 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 CE _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 MET _pdbx_validate_rmsd_angle.auth_seq_id_3 109 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 78.52 _pdbx_validate_rmsd_angle.angle_target_value 100.20 _pdbx_validate_rmsd_angle.angle_deviation -21.68 _pdbx_validate_rmsd_angle.angle_standard_deviation 1.60 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 65 ? ? -109.13 -67.47 2 1 PHE A 75 ? ? -128.17 -75.62 3 1 ASN A 87 ? ? -140.27 29.00 4 1 ASN A 87 ? ? -140.09 28.66 5 1 ASN A 89 ? ? -166.71 88.39 6 1 ASP A 97 ? ? -142.05 12.74 # _pdbx_unobs_or_zero_occ_residues.id 1 _pdbx_unobs_or_zero_occ_residues.PDB_model_num 1 _pdbx_unobs_or_zero_occ_residues.polymer_flag Y _pdbx_unobs_or_zero_occ_residues.occupancy_flag 1 _pdbx_unobs_or_zero_occ_residues.auth_asym_id A _pdbx_unobs_or_zero_occ_residues.auth_comp_id GLY _pdbx_unobs_or_zero_occ_residues.auth_seq_id -2 _pdbx_unobs_or_zero_occ_residues.PDB_ins_code ? _pdbx_unobs_or_zero_occ_residues.label_asym_id A _pdbx_unobs_or_zero_occ_residues.label_comp_id GLY _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 QBV C1 C N N 290 QBV O1 O N N 291 QBV C2 C N N 292 QBV C3 C N N 293 QBV "C1'" C Y N 294 QBV "C2'" C Y N 295 QBV "C3'" C Y N 296 QBV "C4'" C Y N 297 QBV "C5'" C Y N 298 QBV "C6'" C Y N 299 QBV "O4'" O N N 300 QBV BR BR N N 301 QBV O2 O N N 302 QBV H2 H N N 303 QBV H3 H N N 304 QBV "H2'" H N N 305 QBV H1 H N N 306 QBV "H6'" H N N 307 QBV H4 H N N 308 QBV H5 H N N 309 SER N N N N 310 SER CA C N S 311 SER C C N N 312 SER O O N N 313 SER CB C N N 314 SER OG O N N 315 SER OXT O N N 316 SER H H N N 317 SER H2 H N N 318 SER HA H N N 319 SER HB2 H N N 320 SER HB3 H N N 321 SER HG H N N 322 SER HXT H N N 323 THR N N N N 324 THR CA C N S 325 THR C C N N 326 THR O O N N 327 THR CB C N R 328 THR OG1 O N N 329 THR CG2 C N N 330 THR OXT O N N 331 THR H H N N 332 THR H2 H N N 333 THR HA H N N 334 THR HB H N N 335 THR HG1 H N N 336 THR HG21 H N N 337 THR HG22 H N N 338 THR HG23 H N N 339 THR HXT H N N 340 TRP N N N N 341 TRP CA C N S 342 TRP C C N N 343 TRP O O N N 344 TRP CB C N N 345 TRP CG C Y N 346 TRP CD1 C Y N 347 TRP CD2 C Y N 348 TRP NE1 N Y N 349 TRP CE2 C Y N 350 TRP CE3 C Y N 351 TRP CZ2 C Y N 352 TRP CZ3 C Y N 353 TRP CH2 C Y N 354 TRP OXT O N N 355 TRP H H N N 356 TRP H2 H N N 357 TRP HA H N N 358 TRP HB2 H N N 359 TRP HB3 H N N 360 TRP HD1 H N N 361 TRP HE1 H N N 362 TRP HE3 H N N 363 TRP HZ2 H N N 364 TRP HZ3 H N N 365 TRP HH2 H N N 366 TRP HXT H N N 367 TYR N N N N 368 TYR CA C N S 369 TYR C C N N 370 TYR O O N N 371 TYR CB C N N 372 TYR CG C Y N 373 TYR CD1 C Y N 374 TYR CD2 C Y N 375 TYR CE1 C Y N 376 TYR CE2 C Y N 377 TYR CZ C Y N 378 TYR OH O N N 379 TYR OXT O N N 380 TYR H H N N 381 TYR H2 H N N 382 TYR HA H N N 383 TYR HB2 H N N 384 TYR HB3 H N N 385 TYR HD1 H N N 386 TYR HD2 H N N 387 TYR HE1 H N N 388 TYR HE2 H N N 389 TYR HH H N N 390 TYR HXT H N N 391 VAL N N N N 392 VAL CA C N S 393 VAL C C N N 394 VAL O O N N 395 VAL CB C N N 396 VAL CG1 C N N 397 VAL CG2 C N N 398 VAL OXT O N N 399 VAL H H N N 400 VAL H2 H N N 401 VAL HA H N N 402 VAL HB H N N 403 VAL HG11 H N N 404 VAL HG12 H N N 405 VAL HG13 H N N 406 VAL HG21 H N N 407 VAL HG22 H N N 408 VAL HG23 H N N 409 VAL HXT H N N 410 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 QBV O1 C1 doub N N 277 QBV BR "C3'" sing N N 278 QBV "C2'" "C3'" doub Y N 279 QBV "C2'" "C1'" sing Y N 280 QBV C1 C2 sing N N 281 QBV C3 C2 doub N E 282 QBV C3 "C1'" sing N N 283 QBV "C3'" "C4'" sing Y N 284 QBV "C1'" "C6'" doub Y N 285 QBV "C4'" "O4'" sing N N 286 QBV "C4'" "C5'" doub Y N 287 QBV "C6'" "C5'" sing Y N 288 QBV C1 O2 sing N N 289 QBV C2 H2 sing N N 290 QBV C3 H3 sing N N 291 QBV "C2'" "H2'" sing N N 292 QBV "C5'" H1 sing N N 293 QBV "C6'" "H6'" sing N N 294 QBV "O4'" H4 sing N N 295 QBV O2 H5 sing N N 296 SER N CA sing N N 297 SER N H sing N N 298 SER N H2 sing N N 299 SER CA C sing N N 300 SER CA CB sing N N 301 SER CA HA sing N N 302 SER C O doub N N 303 SER C OXT sing N N 304 SER CB OG sing N N 305 SER CB HB2 sing N N 306 SER CB HB3 sing N N 307 SER OG HG sing N N 308 SER OXT HXT sing N N 309 THR N CA sing N N 310 THR N H sing N N 311 THR N H2 sing N N 312 THR CA C sing N N 313 THR CA CB sing N N 314 THR CA HA sing N N 315 THR C O doub N N 316 THR C OXT sing N N 317 THR CB OG1 sing N N 318 THR CB CG2 sing N N 319 THR CB HB sing N N 320 THR OG1 HG1 sing N N 321 THR CG2 HG21 sing N N 322 THR CG2 HG22 sing N N 323 THR CG2 HG23 sing N N 324 THR OXT HXT sing N N 325 TRP N CA sing N N 326 TRP N H sing N N 327 TRP N H2 sing N N 328 TRP CA C sing N N 329 TRP CA CB sing N N 330 TRP CA HA sing N N 331 TRP C O doub N N 332 TRP C OXT sing N N 333 TRP CB CG sing N N 334 TRP CB HB2 sing N N 335 TRP CB HB3 sing N N 336 TRP CG CD1 doub Y N 337 TRP CG CD2 sing Y N 338 TRP CD1 NE1 sing Y N 339 TRP CD1 HD1 sing N N 340 TRP CD2 CE2 doub Y N 341 TRP CD2 CE3 sing Y N 342 TRP NE1 CE2 sing Y N 343 TRP NE1 HE1 sing N N 344 TRP CE2 CZ2 sing Y N 345 TRP CE3 CZ3 doub Y N 346 TRP CE3 HE3 sing N N 347 TRP CZ2 CH2 doub Y N 348 TRP CZ2 HZ2 sing N N 349 TRP CZ3 CH2 sing Y N 350 TRP CZ3 HZ3 sing N N 351 TRP CH2 HH2 sing N N 352 TRP OXT HXT sing N N 353 TYR N CA sing N N 354 TYR N H sing N N 355 TYR N H2 sing N N 356 TYR CA C sing N N 357 TYR CA CB sing N N 358 TYR CA HA sing N N 359 TYR C O doub N N 360 TYR C OXT sing N N 361 TYR CB CG sing N N 362 TYR CB HB2 sing N N 363 TYR CB HB3 sing N N 364 TYR CG CD1 doub Y N 365 TYR CG CD2 sing Y N 366 TYR CD1 CE1 sing Y N 367 TYR CD1 HD1 sing N N 368 TYR CD2 CE2 doub Y N 369 TYR CD2 HD2 sing N N 370 TYR CE1 CZ doub Y N 371 TYR CE1 HE1 sing N N 372 TYR CE2 CZ sing Y N 373 TYR CE2 HE2 sing N N 374 TYR CZ OH sing N N 375 TYR OH HH sing N N 376 TYR OXT HXT sing N N 377 VAL N CA sing N N 378 VAL N H sing N N 379 VAL N H2 sing N N 380 VAL CA C sing N N 381 VAL CA CB sing N N 382 VAL CA HA sing N N 383 VAL C O doub N N 384 VAL C OXT sing N N 385 VAL CB CG1 sing N N 386 VAL CB CG2 sing N N 387 VAL CB HB sing N N 388 VAL CG1 HG11 sing N N 389 VAL CG1 HG12 sing N N 390 VAL CG1 HG13 sing N N 391 VAL CG2 HG21 sing N N 392 VAL CG2 HG22 sing N N 393 VAL CG2 HG23 sing N N 394 VAL OXT HXT sing N N 395 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number 118044 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1NWZ _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 6UMZ _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.015205 _atom_sites.fract_transf_matrix[1][2] 0.008779 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.017557 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.024645 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol BR C H N O S # loop_