data_6UX5 # _entry.id 6UX5 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6UX5 pdb_00006ux5 10.2210/pdb6ux5/pdb WWPDB D_1000245346 ? ? BMRB 30682 ? ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Structure of acrorhagin I from the sea anemone Actinia equina' _pdbx_database_related.db_id 30682 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 6UX5 _pdbx_database_status.recvd_initial_deposition_date 2019-11-06 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Krishnarjuna, B.' 1 0000-0002-4575-0011 'Sunanda, P.' 2 0000-0003-1030-7973 'Norton, R.S.' 3 0000-0001-8893-0584 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Struct.Biol. _citation.journal_id_ASTM JSBIEM _citation.journal_id_CSD 0803 _citation.journal_id_ISSN 1095-8657 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 213 _citation.language ? _citation.page_first 107692 _citation.page_last 107692 _citation.title 'A disulfide-stabilised helical hairpin fold in acrorhagin I: An emerging structural motif in peptide toxins.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.jsb.2020.107692 _citation.pdbx_database_id_PubMed 33387653 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Krishnarjuna, B.' 1 ? primary 'Sunanda, P.' 2 ? primary 'Villegas-Moreno, J.' 3 ? primary 'Csoti, A.' 4 ? primary 'A V Morales, R.' 5 ? primary 'Wai, D.C.C.' 6 ? primary 'Panyi, G.' 7 ? primary 'Prentis, P.' 8 ? primary 'Norton, R.S.' 9 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description U-actitoxin-Aeq5a _entity.formula_weight 5672.312 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'U-AITX-Aeq5a,Acrorhagin I,Acrorhagin-1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code SSTPDGTWVKCRHDCFTKYKSCQMSDSCHDEQSCHQCHVKHTDCVNTGCP _entity_poly.pdbx_seq_one_letter_code_can SSTPDGTWVKCRHDCFTKYKSCQMSDSCHDEQSCHQCHVKHTDCVNTGCP _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 SER n 1 3 THR n 1 4 PRO n 1 5 ASP n 1 6 GLY n 1 7 THR n 1 8 TRP n 1 9 VAL n 1 10 LYS n 1 11 CYS n 1 12 ARG n 1 13 HIS n 1 14 ASP n 1 15 CYS n 1 16 PHE n 1 17 THR n 1 18 LYS n 1 19 TYR n 1 20 LYS n 1 21 SER n 1 22 CYS n 1 23 GLN n 1 24 MET n 1 25 SER n 1 26 ASP n 1 27 SER n 1 28 CYS n 1 29 HIS n 1 30 ASP n 1 31 GLU n 1 32 GLN n 1 33 SER n 1 34 CYS n 1 35 HIS n 1 36 GLN n 1 37 CYS n 1 38 HIS n 1 39 VAL n 1 40 LYS n 1 41 HIS n 1 42 THR n 1 43 ASP n 1 44 CYS n 1 45 VAL n 1 46 ASN n 1 47 THR n 1 48 GLY n 1 49 CYS n 1 50 PRO n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 50 _entity_src_gen.gene_src_common_name 'Beadlet anemone' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue acrorhagi _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Actinia equina' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 6106 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ACR1_ACTEQ _struct_ref.pdbx_db_accession Q3C258 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code SSTPDGTWVKCRHDCFTKYKSCQMSDSCHDEQSCHQCHVKHTDCVNTGCP _struct_ref.pdbx_align_begin 21 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6UX5 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 50 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q3C258 _struct_ref_seq.db_align_beg 21 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 70 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 50 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D DQF-COSY' 1 isotropic 2 1 1 '2D 1H-1H TOCSY' 1 isotropic 3 1 1 '2D 1H-1H NOESY' 1 isotropic 4 1 1 '2D 1H-13C HSQC' 1 isotropic 5 1 1 '2D 1H-15N HSQC' 1 isotropic 6 1 1 '3D HNCO' 1 isotropic 14 1 1 '3D HNCA' 1 isotropic 13 1 1 '3D CBCA(CO)NH' 1 isotropic 12 1 1 '3D HNCACB' 1 isotropic 11 1 1 '3D HBHA(CO)NH' 1 isotropic 10 1 1 '3D 1H-15N NOESY' 1 isotropic 9 1 1 '3D 1H-13C NOESY' 1 isotropic 8 1 1 '3D 1H-13C NOESY aliphatic' 1 isotropic 15 1 1 '3D HCCH-COSY' 1 isotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6 _pdbx_nmr_exptl_sample_conditions.ionic_strength 20 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label acro1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '0.5 mM 13C and 15N acrorhagin I, 95% H2O/5% D2O' _pdbx_nmr_sample_details.solvent_system '95% H2O/5% D2O' _pdbx_nmr_sample_details.label acro1 _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details '0.5 mM peptide in 20 mM sodium phosphate buffer (pH 6) containing 0.01% sodium azide and 5% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.details ? # _pdbx_nmr_refine.entry_id 6UX5 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 4 # _pdbx_nmr_ensemble.entry_id 6UX5 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 6UX5 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 processing TopSpin ? 'Bruker Biospin' 2 'data analysis' 'CcpNmr Analysis' ? CCPN 3 'structure calculation' CYANA ? 'Guntert, Mumenthaler and Wuthrich' 4 refinement 'X-PLOR NIH' ? 'Schwieters, Kuszewski, Tjandra and Clore' # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6UX5 _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 6UX5 _struct.title 'Structure of acrorhagin I from the sea anemone Actinia equina' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6UX5 _struct_keywords.text TOXIN _struct_keywords.pdbx_keywords TOXIN # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 7 ? SER A 25 ? THR A 7 SER A 25 1 ? 19 HELX_P HELX_P2 AA2 ASP A 30 ? CYS A 49 ? ASP A 30 CYS A 49 1 ? 20 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 11 SG ? ? ? 1_555 A CYS 49 SG ? ? A CYS 11 A CYS 49 1_555 ? ? ? ? ? ? ? 2.026 ? ? disulf2 disulf ? ? A CYS 15 SG ? ? ? 1_555 A CYS 44 SG ? ? A CYS 15 A CYS 44 1_555 ? ? ? ? ? ? ? 2.036 ? ? disulf3 disulf ? ? A CYS 22 SG ? ? ? 1_555 A CYS 37 SG ? ? A CYS 22 A CYS 37 1_555 ? ? ? ? ? ? ? 2.029 ? ? disulf4 disulf ? ? A CYS 28 SG ? ? ? 1_555 A CYS 34 SG ? ? A CYS 28 A CYS 34 1_555 ? ? ? ? ? ? ? 2.023 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _atom_sites.entry_id 6UX5 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1 1 SER SER A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 THR 3 3 3 THR THR A . n A 1 4 PRO 4 4 4 PRO PRO A . n A 1 5 ASP 5 5 5 ASP ASP A . n A 1 6 GLY 6 6 6 GLY GLY A . n A 1 7 THR 7 7 7 THR THR A . n A 1 8 TRP 8 8 8 TRP TRP A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 CYS 11 11 11 CYS CYS A . n A 1 12 ARG 12 12 12 ARG ARG A . n A 1 13 HIS 13 13 13 HIS HIS A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 CYS 15 15 15 CYS CYS A . n A 1 16 PHE 16 16 16 PHE PHE A . n A 1 17 THR 17 17 17 THR THR A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 TYR 19 19 19 TYR TYR A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 CYS 22 22 22 CYS CYS A . n A 1 23 GLN 23 23 23 GLN GLN A . n A 1 24 MET 24 24 24 MET MET A . n A 1 25 SER 25 25 25 SER SER A . n A 1 26 ASP 26 26 26 ASP ASP A . n A 1 27 SER 27 27 27 SER SER A . n A 1 28 CYS 28 28 28 CYS CYS A . n A 1 29 HIS 29 29 29 HIS HIS A . n A 1 30 ASP 30 30 30 ASP ASP A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 GLN 32 32 32 GLN GLN A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 CYS 34 34 34 CYS CYS A . n A 1 35 HIS 35 35 35 HIS HIS A . n A 1 36 GLN 36 36 36 GLN GLN A . n A 1 37 CYS 37 37 37 CYS CYS A . n A 1 38 HIS 38 38 38 HIS HIS A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 LYS 40 40 40 LYS LYS A . n A 1 41 HIS 41 41 41 HIS HIS A . n A 1 42 THR 42 42 42 THR THR A . n A 1 43 ASP 43 43 43 ASP ASP A . n A 1 44 CYS 44 44 44 CYS CYS A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 ASN 46 46 46 ASN ASN A . n A 1 47 THR 47 47 47 THR THR A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 CYS 49 49 49 CYS CYS A . n A 1 50 PRO 50 50 50 PRO PRO A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-11-18 2 'Structure model' 1 1 2021-06-02 3 'Structure model' 1 2 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' database_2 4 3 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.journal_volume' 7 2 'Structure model' '_citation.page_first' 8 2 'Structure model' '_citation.page_last' 9 2 'Structure model' '_citation.pdbx_database_id_DOI' 10 2 'Structure model' '_citation.pdbx_database_id_PubMed' 11 2 'Structure model' '_citation.title' 12 2 'Structure model' '_citation.year' 13 3 'Structure model' '_database_2.pdbx_DOI' 14 3 'Structure model' '_database_2.pdbx_database_accession' 15 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' # _pdbx_nmr_exptl_sample.solution_id 1 _pdbx_nmr_exptl_sample.component 'acrorhagin I' _pdbx_nmr_exptl_sample.concentration 0.5 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling '13C and 15N' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A PHE 16 ? ? H A LYS 20 ? ? 1.59 2 1 O A VAL 45 ? ? H A CYS 49 ? ? 1.60 3 10 O A PHE 16 ? ? H A LYS 20 ? ? 1.57 4 10 O A VAL 45 ? ? H A CYS 49 ? ? 1.60 5 11 O A PHE 16 ? ? H A LYS 20 ? ? 1.58 6 11 O A HIS 35 ? ? H A VAL 39 ? ? 1.59 7 12 O A PHE 16 ? ? H A LYS 20 ? ? 1.57 8 12 O A VAL 45 ? ? H A CYS 49 ? ? 1.60 9 13 O A PHE 16 ? ? H A LYS 20 ? ? 1.57 10 14 O A PHE 16 ? ? H A LYS 20 ? ? 1.57 11 14 O A HIS 35 ? ? H A VAL 39 ? ? 1.58 12 15 O A VAL 45 ? ? H A CYS 49 ? ? 1.60 13 17 O A CYS 22 ? ? HG A SER 25 ? ? 1.53 14 19 O A HIS 35 ? ? H A VAL 39 ? ? 1.59 15 19 O A PHE 16 ? ? H A LYS 20 ? ? 1.59 16 20 O A PHE 16 ? ? H A LYS 20 ? ? 1.60 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 5 ? ? -161.88 -134.94 2 2 ASP A 5 ? ? -155.08 -133.85 3 3 ASP A 5 ? ? -156.17 -133.38 4 4 ASP A 5 ? ? -162.82 -133.85 5 5 ASP A 5 ? ? -155.81 -133.00 6 6 ASP A 5 ? ? -162.46 -133.75 7 7 ASP A 5 ? ? -161.93 -133.56 8 8 ASP A 5 ? ? -154.97 -133.88 9 9 ASP A 5 ? ? -162.40 -133.76 10 10 ASP A 5 ? ? -162.47 -133.79 11 11 ASP A 5 ? ? -162.78 -133.70 12 12 ASP A 5 ? ? -161.98 -134.03 13 13 ASP A 5 ? ? -161.33 -134.05 14 14 ASP A 5 ? ? -155.73 -134.09 15 15 ASP A 5 ? ? -162.01 -134.28 16 16 ASP A 5 ? ? -154.93 -138.63 17 17 ASP A 5 ? ? -154.61 -134.72 18 18 ASP A 5 ? ? -161.47 -133.80 19 19 ASP A 5 ? ? -161.36 -133.64 20 20 ASP A 5 ? ? -161.98 -133.79 # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #