data_6UYT # _entry.id 6UYT # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.381 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6UYT pdb_00006uyt 10.2210/pdb6uyt/pdb WWPDB D_1000244133 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB . 4WJQ unspecified PDB . 4WJP unspecified PDB . 4WJO unspecified PDB . 4WJN unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6UYT _pdbx_database_status.recvd_initial_deposition_date 2019-11-14 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Wahba, H.M.' 1 0000-0003-4426-1395 'Gagnon, C.' 2 0000-0002-9433-2270 'Mascle, X.H.' 3 0000-0002-8962-5124 'Lussier-Price, M.' 4 0000-0003-3854-9720 'Cappadocia, L.' 5 0000-0001-7348-1982 'Sakaguchi, K.' 6 0000-0002-8434-4171 'Omichinski, J.G.' 7 0000-0002-3543-1914 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Structure _citation.journal_id_ASTM STRUE6 _citation.journal_id_CSD 2005 _citation.journal_id_ISSN 0969-2126 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 28 _citation.language ? _citation.page_first 157 _citation.page_last 168.e5 _citation.title 'Acetylation of SUMO1 Alters Interactions with the SIMs of PML and Daxx in a Protein-Specific Manner.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.str.2019.11.019 _citation.pdbx_database_id_PubMed 31879127 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Mascle, X.H.' 1 ? primary 'Gagnon, C.' 2 ? primary 'Wahba, H.M.' 3 ? primary 'Lussier-Price, M.' 4 ? primary 'Cappadocia, L.' 5 ? primary 'Sakaguchi, K.' 6 ? primary 'Omichinski, J.G.' 7 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6UYT _cell.details ? _cell.formula_units_Z ? _cell.length_a 38.458 _cell.length_a_esd ? _cell.length_b 46.942 _cell.length_b_esd ? _cell.length_c 62.385 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6UYT _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Small ubiquitin-related modifier 1' 9567.801 1 ? C52A ? ? 2 polymer man 'Protein PML' 3296.901 1 ? E574Y ? ? 3 water nat water 18.015 95 ? ? ? ? # loop_ _entity_name_com.entity_id _entity_name_com.name 1 ;SUMO-1,GAP-modifying protein 1,GMP1,SMT3 homolog 3,Sentrin,Ubiquitin-homology domain protein PIC1,Ubiquitin-like protein SMT3C,Smt3C,Ubiquitin-like protein UBL1 ; 2 'Promyelocytic leukemia protein,RING finger protein 71,Tripartite motif-containing protein 19' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no yes ;GSKEGEYIKLKVIGQDSSEIHFKV(ALY)MTTHLKKLKESYAQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEV YQEQTGG ; ;GSKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYAQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQ TGG ; A ? 2 'polypeptide(L)' no yes 'GSGAGEAEERVVVI(SEP)(SEP)(SEP)ED(SEP)DAENSSSRY' GSGAGEAEERVVVISSSEDSDAENSSSRY B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 LYS n 1 4 GLU n 1 5 GLY n 1 6 GLU n 1 7 TYR n 1 8 ILE n 1 9 LYS n 1 10 LEU n 1 11 LYS n 1 12 VAL n 1 13 ILE n 1 14 GLY n 1 15 GLN n 1 16 ASP n 1 17 SER n 1 18 SER n 1 19 GLU n 1 20 ILE n 1 21 HIS n 1 22 PHE n 1 23 LYS n 1 24 VAL n 1 25 ALY n 1 26 MET n 1 27 THR n 1 28 THR n 1 29 HIS n 1 30 LEU n 1 31 LYS n 1 32 LYS n 1 33 LEU n 1 34 LYS n 1 35 GLU n 1 36 SER n 1 37 TYR n 1 38 ALA n 1 39 GLN n 1 40 ARG n 1 41 GLN n 1 42 GLY n 1 43 VAL n 1 44 PRO n 1 45 MET n 1 46 ASN n 1 47 SER n 1 48 LEU n 1 49 ARG n 1 50 PHE n 1 51 LEU n 1 52 PHE n 1 53 GLU n 1 54 GLY n 1 55 GLN n 1 56 ARG n 1 57 ILE n 1 58 ALA n 1 59 ASP n 1 60 ASN n 1 61 HIS n 1 62 THR n 1 63 PRO n 1 64 LYS n 1 65 GLU n 1 66 LEU n 1 67 GLY n 1 68 MET n 1 69 GLU n 1 70 GLU n 1 71 GLU n 1 72 ASP n 1 73 VAL n 1 74 ILE n 1 75 GLU n 1 76 VAL n 1 77 TYR n 1 78 GLN n 1 79 GLU n 1 80 GLN n 1 81 THR n 1 82 GLY n 1 83 GLY n 2 1 GLY n 2 2 SER n 2 3 GLY n 2 4 ALA n 2 5 GLY n 2 6 GLU n 2 7 ALA n 2 8 GLU n 2 9 GLU n 2 10 ARG n 2 11 VAL n 2 12 VAL n 2 13 VAL n 2 14 ILE n 2 15 SEP n 2 16 SEP n 2 17 SEP n 2 18 GLU n 2 19 ASP n 2 20 SEP n 2 21 ASP n 2 22 ALA n 2 23 GLU n 2 24 ASN n 2 25 SER n 2 26 SER n 2 27 SER n 2 28 ARG n 2 29 TYR n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 83 Human ? 'SUMO1, SMT3C, SMT3H3, UBL1, OK/SW-cl.43' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2 1 sample 'Biological sequence' 1 29 Human ? 'PML, MYL, PP8675, RNF71, TRIM19' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP SUMO1_HUMAN P63165 ? 1 ;KEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTG G ; 17 2 UNP PML_HUMAN P29590 ? 2 SGAGEAEERVVVISSSEDSDAENSSSRE 547 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 6UYT A 3 ? 83 ? P63165 17 ? 97 ? 17 97 2 2 6UYT B 2 ? 29 ? P29590 547 ? 574 ? 2 29 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6UYT GLY A 1 ? UNP P63165 ? ? 'expression tag' 15 1 1 6UYT SER A 2 ? UNP P63165 ? ? 'expression tag' 16 2 1 6UYT ALA A 38 ? UNP P63165 CYS 52 'engineered mutation' 52 3 2 6UYT GLY B 1 ? UNP P29590 ? ? 'expression tag' 1 4 2 6UYT TYR B 29 ? UNP P29590 GLU 574 'engineered mutation' 29 5 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ALY 'L-peptide linking' n 'N(6)-ACETYLLYSINE' ? 'C8 H16 N2 O3' 188.224 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SEP 'L-peptide linking' n PHOSPHOSERINE PHOSPHONOSERINE 'C3 H8 N O6 P' 185.072 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6UYT _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.19 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 43.80 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '100MM SODIUM CACODYLATE PH6.5, 16% PEG3350, 10MM CALCIUM CHLORIDE' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-05-28 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97750 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'CHESS BEAMLINE F1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97750 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline F1 _diffrn_source.pdbx_synchrotron_site CHESS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6UYT _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.662 _reflns.d_resolution_low 24.23 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 13664 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.79 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.0 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 10.28 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.998 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.662 _reflns_shell.d_res_low 1.722 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1279 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.391 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 107.160 _refine.B_iso_mean 31.1326 _refine.B_iso_min 12.740 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6UYT _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.6620 _refine.ls_d_res_low 24.2260 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 13664 _refine.ls_number_reflns_R_free 1367 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.7800 _refine.ls_percent_reflns_R_free 10.0000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1739 _refine.ls_R_factor_R_free 0.2004 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1708 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.360 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 4WJN _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 19.5700 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.1600 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 1.6620 _refine_hist.d_res_low 24.2260 _refine_hist.number_atoms_solvent 95 _refine_hist.number_atoms_total 856 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 92 _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent 38.07 _refine_hist.pdbx_number_atoms_protein 761 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.6620 1.7212 . . 127 1145 95.0000 . . . 0.3066 0.0000 0.2762 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.7212 1.7901 . . 133 1195 98.0000 . . . 0.2931 0.0000 0.2453 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.7901 1.8715 . . 134 1207 98.0000 . . . 0.2662 0.0000 0.2167 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.8715 1.9701 . . 133 1204 99.0000 . . . 0.2585 0.0000 0.1857 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.9701 2.0935 . . 138 1231 99.0000 . . . 0.2155 0.0000 0.1635 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.0935 2.2550 . . 136 1231 99.0000 . . . 0.1740 0.0000 0.1561 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.2550 2.4818 . . 138 1235 99.0000 . . . 0.1786 0.0000 0.1452 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.4818 2.8404 . . 137 1236 100.0000 . . . 0.1910 0.0000 0.1556 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.8404 3.5768 . . 142 1276 100.0000 . . . 0.1870 0.0000 0.1617 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.5768 24.2260 . . 149 1337 100.0000 . . . 0.1866 0.0000 0.1706 . . . . . . . . . . . # _struct.entry_id 6UYT _struct.title 'Crystal structure of K39-acetylated SUMO1 in complex with phosphorylated PML-SIM' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6UYT _struct_keywords.text 'SUMO1, PML, SUMO INTERACTION MOTIF, PHOSPHOSIM, NUCLEAR PROTEIN-PROTEIN BINDING complex' _struct_keywords.pdbx_keywords 'NUCLEAR PROTEIN/PROTEIN BINDING' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LEU A 30 ? GLY A 42 ? LEU A 44 GLY A 56 1 ? 13 HELX_P HELX_P2 AA2 PRO A 44 ? ASN A 46 ? PRO A 58 ASN A 60 5 ? 3 HELX_P HELX_P3 AA3 THR A 62 ? GLY A 67 ? THR A 76 GLY A 81 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A VAL 24 C ? ? ? 1_555 A ALY 25 N ? ? A VAL 38 A ALY 39 1_555 ? ? ? ? ? ? ? 1.318 ? ? covale2 covale both ? A ALY 25 C ? ? ? 1_555 A MET 26 N ? ? A ALY 39 A MET 40 1_555 ? ? ? ? ? ? ? 1.337 ? ? covale3 covale both ? B ILE 14 C ? ? ? 1_555 B SEP 15 N ? ? B ILE 14 B SEP 15 1_555 ? ? ? ? ? ? ? 1.322 ? ? covale4 covale both ? B SEP 15 C ? ? ? 1_555 B SEP 16 N ? ? B SEP 15 B SEP 16 1_555 ? ? ? ? ? ? ? 1.332 ? ? covale5 covale both ? B SEP 16 C ? ? ? 1_555 B SEP 17 N ? ? B SEP 16 B SEP 17 1_555 ? ? ? ? ? ? ? 1.431 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 6 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? parallel AA1 4 5 ? anti-parallel AA1 5 6 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLN A 55 ? ARG A 56 ? GLN A 69 ARG A 70 AA1 2 LEU A 48 ? PHE A 52 ? LEU A 62 PHE A 66 AA1 3 VAL A 73 ? GLN A 78 ? VAL A 87 GLN A 92 AA1 4 ILE A 8 ? ILE A 13 ? ILE A 22 ILE A 27 AA1 5 GLU A 19 ? VAL A 24 ? GLU A 33 VAL A 38 AA1 6 VAL B 11 ? VAL B 13 ? VAL B 11 VAL B 13 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O GLN A 55 ? O GLN A 69 N PHE A 52 ? N PHE A 66 AA1 2 3 N LEU A 51 ? N LEU A 65 O GLU A 75 ? O GLU A 89 AA1 3 4 O ILE A 74 ? O ILE A 88 N ILE A 13 ? N ILE A 27 AA1 4 5 N ILE A 8 ? N ILE A 22 O VAL A 24 ? O VAL A 38 AA1 5 6 N LYS A 23 ? N LYS A 37 O VAL B 12 ? O VAL B 12 # _atom_sites.entry_id 6UYT _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.026002 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.021303 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.016029 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 15 ? ? ? A . n A 1 2 SER 2 16 ? ? ? A . n A 1 3 LYS 3 17 ? ? ? A . n A 1 4 GLU 4 18 ? ? ? A . n A 1 5 GLY 5 19 19 GLY GLY A . n A 1 6 GLU 6 20 20 GLU GLU A . n A 1 7 TYR 7 21 21 TYR TYR A . n A 1 8 ILE 8 22 22 ILE ILE A . n A 1 9 LYS 9 23 23 LYS LYS A . n A 1 10 LEU 10 24 24 LEU LEU A . n A 1 11 LYS 11 25 25 LYS LYS A . n A 1 12 VAL 12 26 26 VAL VAL A . n A 1 13 ILE 13 27 27 ILE ILE A . n A 1 14 GLY 14 28 28 GLY GLY A . n A 1 15 GLN 15 29 29 GLN GLN A . n A 1 16 ASP 16 30 30 ASP ASP A . n A 1 17 SER 17 31 31 SER SER A . n A 1 18 SER 18 32 32 SER SER A . n A 1 19 GLU 19 33 33 GLU GLU A . n A 1 20 ILE 20 34 34 ILE ILE A . n A 1 21 HIS 21 35 35 HIS HIS A . n A 1 22 PHE 22 36 36 PHE PHE A . n A 1 23 LYS 23 37 37 LYS LYS A . n A 1 24 VAL 24 38 38 VAL VAL A . n A 1 25 ALY 25 39 39 ALY ALY A . n A 1 26 MET 26 40 40 MET MET A . n A 1 27 THR 27 41 41 THR THR A . n A 1 28 THR 28 42 42 THR THR A . n A 1 29 HIS 29 43 43 HIS HIS A . n A 1 30 LEU 30 44 44 LEU LEU A . n A 1 31 LYS 31 45 45 LYS LYS A . n A 1 32 LYS 32 46 46 LYS LYS A . n A 1 33 LEU 33 47 47 LEU LEU A . n A 1 34 LYS 34 48 48 LYS LYS A . n A 1 35 GLU 35 49 49 GLU GLU A . n A 1 36 SER 36 50 50 SER SER A . n A 1 37 TYR 37 51 51 TYR TYR A . n A 1 38 ALA 38 52 52 ALA ALA A . n A 1 39 GLN 39 53 53 GLN GLN A . n A 1 40 ARG 40 54 54 ARG ARG A . n A 1 41 GLN 41 55 55 GLN GLN A . n A 1 42 GLY 42 56 56 GLY GLY A . n A 1 43 VAL 43 57 57 VAL VAL A . n A 1 44 PRO 44 58 58 PRO PRO A . n A 1 45 MET 45 59 59 MET MET A . n A 1 46 ASN 46 60 60 ASN ASN A . n A 1 47 SER 47 61 61 SER SER A . n A 1 48 LEU 48 62 62 LEU LEU A . n A 1 49 ARG 49 63 63 ARG ARG A . n A 1 50 PHE 50 64 64 PHE PHE A . n A 1 51 LEU 51 65 65 LEU LEU A . n A 1 52 PHE 52 66 66 PHE PHE A . n A 1 53 GLU 53 67 67 GLU GLU A . n A 1 54 GLY 54 68 68 GLY GLY A . n A 1 55 GLN 55 69 69 GLN GLN A . n A 1 56 ARG 56 70 70 ARG ARG A . n A 1 57 ILE 57 71 71 ILE ILE A . n A 1 58 ALA 58 72 72 ALA ALA A . n A 1 59 ASP 59 73 73 ASP ASP A . n A 1 60 ASN 60 74 74 ASN ASN A . n A 1 61 HIS 61 75 75 HIS HIS A . n A 1 62 THR 62 76 76 THR THR A . n A 1 63 PRO 63 77 77 PRO PRO A . n A 1 64 LYS 64 78 78 LYS LYS A . n A 1 65 GLU 65 79 79 GLU GLU A . n A 1 66 LEU 66 80 80 LEU LEU A . n A 1 67 GLY 67 81 81 GLY GLY A . n A 1 68 MET 68 82 82 MET MET A . n A 1 69 GLU 69 83 83 GLU GLU A . n A 1 70 GLU 70 84 84 GLU GLU A . n A 1 71 GLU 71 85 85 GLU GLU A . n A 1 72 ASP 72 86 86 ASP ASP A . n A 1 73 VAL 73 87 87 VAL VAL A . n A 1 74 ILE 74 88 88 ILE ILE A . n A 1 75 GLU 75 89 89 GLU GLU A . n A 1 76 VAL 76 90 90 VAL VAL A . n A 1 77 TYR 77 91 91 TYR TYR A . n A 1 78 GLN 78 92 92 GLN GLN A . n A 1 79 GLU 79 93 93 GLU GLU A . n A 1 80 GLN 80 94 ? ? ? A . n A 1 81 THR 81 95 ? ? ? A . n A 1 82 GLY 82 96 ? ? ? A . n A 1 83 GLY 83 97 ? ? ? A . n B 2 1 GLY 1 1 ? ? ? B . n B 2 2 SER 2 2 ? ? ? B . n B 2 3 GLY 3 3 ? ? ? B . n B 2 4 ALA 4 4 ? ? ? B . n B 2 5 GLY 5 5 ? ? ? B . n B 2 6 GLU 6 6 ? ? ? B . n B 2 7 ALA 7 7 7 ALA ALA B . n B 2 8 GLU 8 8 8 GLU GLU B . n B 2 9 GLU 9 9 9 GLU GLU B . n B 2 10 ARG 10 10 10 ARG ARG B . n B 2 11 VAL 11 11 11 VAL VAL B . n B 2 12 VAL 12 12 12 VAL VAL B . n B 2 13 VAL 13 13 13 VAL VAL B . n B 2 14 ILE 14 14 14 ILE ILE B . n B 2 15 SEP 15 15 15 SEP SEP B . n B 2 16 SEP 16 16 16 SEP SEP B . n B 2 17 SEP 17 17 17 SEP SEP B . n B 2 18 GLU 18 18 ? ? ? B . n B 2 19 ASP 19 19 ? ? ? B . n B 2 20 SEP 20 20 ? ? ? B . n B 2 21 ASP 21 21 ? ? ? B . n B 2 22 ALA 22 22 ? ? ? B . n B 2 23 GLU 23 23 ? ? ? B . n B 2 24 ASN 24 24 24 ASN ASN B . n B 2 25 SER 25 25 25 SER SER B . n B 2 26 SER 26 26 26 SER SER B . n B 2 27 SER 27 27 27 SER SER B . n B 2 28 ARG 28 28 28 ARG ARG B . n B 2 29 TYR 29 29 29 TYR TYR B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 HOH 1 101 22 HOH HOH A . C 3 HOH 2 102 29 HOH HOH A . C 3 HOH 3 103 84 HOH HOH A . C 3 HOH 4 104 17 HOH HOH A . C 3 HOH 5 105 28 HOH HOH A . C 3 HOH 6 106 49 HOH HOH A . C 3 HOH 7 107 48 HOH HOH A . C 3 HOH 8 108 101 HOH HOH A . C 3 HOH 9 109 18 HOH HOH A . C 3 HOH 10 110 65 HOH HOH A . C 3 HOH 11 111 13 HOH HOH A . C 3 HOH 12 112 52 HOH HOH A . C 3 HOH 13 113 21 HOH HOH A . C 3 HOH 14 114 41 HOH HOH A . C 3 HOH 15 115 50 HOH HOH A . C 3 HOH 16 116 79 HOH HOH A . C 3 HOH 17 117 70 HOH HOH A . C 3 HOH 18 118 23 HOH HOH A . C 3 HOH 19 119 16 HOH HOH A . C 3 HOH 20 120 56 HOH HOH A . C 3 HOH 21 121 43 HOH HOH A . C 3 HOH 22 122 4 HOH HOH A . C 3 HOH 23 123 62 HOH HOH A . C 3 HOH 24 124 8 HOH HOH A . C 3 HOH 25 125 64 HOH HOH A . C 3 HOH 26 126 93 HOH HOH A . C 3 HOH 27 127 1 HOH HOH A . C 3 HOH 28 128 73 HOH HOH A . C 3 HOH 29 129 37 HOH HOH A . C 3 HOH 30 130 10 HOH HOH A . C 3 HOH 31 131 58 HOH HOH A . C 3 HOH 32 132 74 HOH HOH A . C 3 HOH 33 133 98 HOH HOH A . C 3 HOH 34 134 38 HOH HOH A . C 3 HOH 35 135 39 HOH HOH A . C 3 HOH 36 136 27 HOH HOH A . C 3 HOH 37 137 42 HOH HOH A . C 3 HOH 38 138 75 HOH HOH A . C 3 HOH 39 139 69 HOH HOH A . C 3 HOH 40 140 61 HOH HOH A . C 3 HOH 41 141 100 HOH HOH A . C 3 HOH 42 142 76 HOH HOH A . C 3 HOH 43 143 20 HOH HOH A . C 3 HOH 44 144 45 HOH HOH A . C 3 HOH 45 145 24 HOH HOH A . C 3 HOH 46 146 9 HOH HOH A . C 3 HOH 47 147 36 HOH HOH A . C 3 HOH 48 148 2 HOH HOH A . C 3 HOH 49 149 11 HOH HOH A . C 3 HOH 50 150 15 HOH HOH A . C 3 HOH 51 151 5 HOH HOH A . C 3 HOH 52 152 30 HOH HOH A . C 3 HOH 53 153 26 HOH HOH A . C 3 HOH 54 154 40 HOH HOH A . C 3 HOH 55 155 80 HOH HOH A . C 3 HOH 56 156 60 HOH HOH A . C 3 HOH 57 157 78 HOH HOH A . C 3 HOH 58 158 25 HOH HOH A . C 3 HOH 59 159 59 HOH HOH A . C 3 HOH 60 160 83 HOH HOH A . C 3 HOH 61 161 53 HOH HOH A . C 3 HOH 62 162 46 HOH HOH A . C 3 HOH 63 163 81 HOH HOH A . C 3 HOH 64 164 55 HOH HOH A . C 3 HOH 65 165 94 HOH HOH A . C 3 HOH 66 166 72 HOH HOH A . C 3 HOH 67 167 57 HOH HOH A . C 3 HOH 68 168 63 HOH HOH A . C 3 HOH 69 169 87 HOH HOH A . C 3 HOH 70 170 90 HOH HOH A . C 3 HOH 71 171 12 HOH HOH A . C 3 HOH 72 172 51 HOH HOH A . C 3 HOH 73 173 66 HOH HOH A . C 3 HOH 74 174 92 HOH HOH A . C 3 HOH 75 175 67 HOH HOH A . D 3 HOH 1 101 96 HOH HOH B . D 3 HOH 2 102 86 HOH HOH B . D 3 HOH 3 103 71 HOH HOH B . D 3 HOH 4 104 44 HOH HOH B . D 3 HOH 5 105 19 HOH HOH B . D 3 HOH 6 106 3 HOH HOH B . D 3 HOH 7 107 31 HOH HOH B . D 3 HOH 8 108 35 HOH HOH B . D 3 HOH 9 109 54 HOH HOH B . D 3 HOH 10 110 33 HOH HOH B . D 3 HOH 11 111 82 HOH HOH B . D 3 HOH 12 112 32 HOH HOH B . D 3 HOH 13 113 99 HOH HOH B . D 3 HOH 14 114 47 HOH HOH B . D 3 HOH 15 115 85 HOH HOH B . D 3 HOH 16 116 7 HOH HOH B . D 3 HOH 17 117 14 HOH HOH B . D 3 HOH 18 118 91 HOH HOH B . D 3 HOH 19 119 95 HOH HOH B . D 3 HOH 20 120 88 HOH HOH B . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A ALY 25 A ALY 39 ? LYS 'modified residue' 2 B SEP 15 B SEP 15 ? SER 'modified residue' 3 B SEP 16 B SEP 16 ? SER 'modified residue' 4 B SEP 17 B SEP 17 ? SER 'modified residue' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1060 ? 1 MORE -6 ? 1 'SSA (A^2)' 6530 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-11-27 2 'Structure model' 1 1 2020-01-08 3 'Structure model' 1 2 2020-02-19 4 'Structure model' 1 3 2023-10-11 5 'Structure model' 2 0 2023-11-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Author supporting evidence' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Database references' 4 4 'Structure model' 'Data collection' 5 4 'Structure model' 'Database references' 6 4 'Structure model' 'Refinement description' 7 5 'Structure model' 'Atomic model' 8 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 2 'Structure model' pdbx_audit_support 4 3 'Structure model' citation 5 4 'Structure model' chem_comp_atom 6 4 'Structure model' chem_comp_bond 7 4 'Structure model' database_2 8 4 'Structure model' pdbx_initial_refinement_model 9 5 'Structure model' atom_site 10 5 'Structure model' chem_comp_atom 11 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.pdbx_database_id_DOI' 7 2 'Structure model' '_citation.pdbx_database_id_PubMed' 8 2 'Structure model' '_citation.title' 9 2 'Structure model' '_citation.year' 10 2 'Structure model' '_citation_author.identifier_ORCID' 11 2 'Structure model' '_pdbx_audit_support.funding_organization' 12 3 'Structure model' '_citation.journal_volume' 13 3 'Structure model' '_citation.page_first' 14 3 'Structure model' '_citation.page_last' 15 3 'Structure model' '_citation.year' 16 4 'Structure model' '_database_2.pdbx_DOI' 17 4 'Structure model' '_database_2.pdbx_database_accession' 18 5 'Structure model' '_atom_site.auth_atom_id' 19 5 'Structure model' '_atom_site.label_atom_id' 20 5 'Structure model' '_chem_comp_atom.atom_id' 21 5 'Structure model' '_chem_comp_bond.atom_id_2' # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined 8.4111 9.5562 7.6892 0.2286 ? -0.0069 ? -0.0310 ? 0.2203 ? 0.0086 ? 0.2710 ? 0.7878 ? -0.2642 ? -0.3871 ? 0.4171 ? -0.2240 ? 0.6009 ? -0.0725 ? 0.0035 ? 0.1669 ? 0.2114 ? 0.1243 ? -0.4700 ? 0.0386 ? 0.2986 ? 0.0098 ? 2 'X-RAY DIFFRACTION' ? refined 29.9987 28.8558 14.0907 0.4796 ? 0.0537 ? 0.0049 ? 0.7071 ? -0.1186 ? 0.6659 ? 0.0316 ? 0.0194 ? 0.0230 ? 0.0445 ? -0.0023 ? 0.0554 ? 0.2627 ? 0.1999 ? 0.1927 ? -0.0602 ? 0.0821 ? 0.7244 ? 0.1308 ? -0.5298 ? -0.0062 ? 3 'X-RAY DIFFRACTION' ? refined -0.7605 16.7299 6.4160 0.1504 ? -0.0129 ? 0.0057 ? 0.1514 ? 0.0002 ? 0.1451 ? 1.6873 ? -0.3172 ? -0.4183 ? 2.0784 ? 0.2061 ? 0.7738 ? 0.0350 ? 0.0079 ? 0.0693 ? 0.0916 ? -0.0034 ? 0.0360 ? -0.0493 ? 0.0241 ? 0.0000 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? B 7 ? ? B 17 ? ;chain 'B' and (resid 7 through 17 ) ; 2 'X-RAY DIFFRACTION' 2 ? ? B 24 ? ? B 29 ? ;chain 'B' and (resid 24 through 29 ) ; 3 'X-RAY DIFFRACTION' 3 ? ? A 19 ? ? A 93 ? 'chain A' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.14-3260_1496 1 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _pdbx_entry_details.entry_id 6UYT _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HD22 A ASN 74 ? ? O A HOH 101 ? ? 1.36 2 1 O A HOH 135 ? ? O A HOH 161 ? ? 1.87 3 1 O A HOH 106 ? ? O A HOH 125 ? ? 1.90 4 1 O A HOH 160 ? ? O A HOH 169 ? ? 2.15 # _pdbx_validate_rmsd_bond.id 1 _pdbx_validate_rmsd_bond.PDB_model_num 1 _pdbx_validate_rmsd_bond.auth_atom_id_1 CB _pdbx_validate_rmsd_bond.auth_asym_id_1 B _pdbx_validate_rmsd_bond.auth_comp_id_1 SER _pdbx_validate_rmsd_bond.auth_seq_id_1 25 _pdbx_validate_rmsd_bond.PDB_ins_code_1 ? _pdbx_validate_rmsd_bond.label_alt_id_1 ? _pdbx_validate_rmsd_bond.auth_atom_id_2 OG _pdbx_validate_rmsd_bond.auth_asym_id_2 B _pdbx_validate_rmsd_bond.auth_comp_id_2 SER _pdbx_validate_rmsd_bond.auth_seq_id_2 25 _pdbx_validate_rmsd_bond.PDB_ins_code_2 ? _pdbx_validate_rmsd_bond.label_alt_id_2 ? _pdbx_validate_rmsd_bond.bond_value 1.337 _pdbx_validate_rmsd_bond.bond_target_value 1.418 _pdbx_validate_rmsd_bond.bond_deviation -0.081 _pdbx_validate_rmsd_bond.bond_standard_deviation 0.013 _pdbx_validate_rmsd_bond.linker_flag N # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 C _pdbx_validate_rmsd_angle.auth_asym_id_1 B _pdbx_validate_rmsd_angle.auth_comp_id_1 SEP _pdbx_validate_rmsd_angle.auth_seq_id_1 16 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 N _pdbx_validate_rmsd_angle.auth_asym_id_2 B _pdbx_validate_rmsd_angle.auth_comp_id_2 SEP _pdbx_validate_rmsd_angle.auth_seq_id_2 17 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 CA _pdbx_validate_rmsd_angle.auth_asym_id_3 B _pdbx_validate_rmsd_angle.auth_comp_id_3 SEP _pdbx_validate_rmsd_angle.auth_seq_id_3 17 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 105.69 _pdbx_validate_rmsd_angle.angle_target_value 121.70 _pdbx_validate_rmsd_angle.angle_deviation -16.01 _pdbx_validate_rmsd_angle.angle_standard_deviation 2.50 _pdbx_validate_rmsd_angle.linker_flag Y # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 15 ? A GLY 1 2 1 Y 1 A SER 16 ? A SER 2 3 1 Y 1 A LYS 17 ? A LYS 3 4 1 Y 1 A GLU 18 ? A GLU 4 5 1 Y 1 A GLN 94 ? A GLN 80 6 1 Y 1 A THR 95 ? A THR 81 7 1 Y 1 A GLY 96 ? A GLY 82 8 1 Y 1 A GLY 97 ? A GLY 83 9 1 Y 1 B GLY 1 ? B GLY 1 10 1 Y 1 B SER 2 ? B SER 2 11 1 Y 1 B GLY 3 ? B GLY 3 12 1 Y 1 B ALA 4 ? B ALA 4 13 1 Y 1 B GLY 5 ? B GLY 5 14 1 Y 1 B GLU 6 ? B GLU 6 15 1 Y 1 B GLU 18 ? B GLU 18 16 1 Y 1 B ASP 19 ? B ASP 19 17 1 Y 1 B SEP 20 ? B SEP 20 18 1 Y 1 B ASP 21 ? B ASP 21 19 1 Y 1 B ALA 22 ? B ALA 22 20 1 Y 1 B GLU 23 ? B GLU 23 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ALY OH O N N 14 ALY CH C N N 15 ALY CH3 C N N 16 ALY NZ N N N 17 ALY CE C N N 18 ALY CD C N N 19 ALY CG C N N 20 ALY CB C N N 21 ALY CA C N S 22 ALY N N N N 23 ALY C C N N 24 ALY O O N N 25 ALY OXT O N N 26 ALY HH31 H N N 27 ALY HH32 H N N 28 ALY HH33 H N N 29 ALY HZ H N N 30 ALY HE3 H N N 31 ALY HE2 H N N 32 ALY HD3 H N N 33 ALY HD2 H N N 34 ALY HG3 H N N 35 ALY HG2 H N N 36 ALY HB3 H N N 37 ALY HB2 H N N 38 ALY HA H N N 39 ALY H H N N 40 ALY H2 H N N 41 ALY HXT H N N 42 ARG N N N N 43 ARG CA C N S 44 ARG C C N N 45 ARG O O N N 46 ARG CB C N N 47 ARG CG C N N 48 ARG CD C N N 49 ARG NE N N N 50 ARG CZ C N N 51 ARG NH1 N N N 52 ARG NH2 N N N 53 ARG OXT O N N 54 ARG H H N N 55 ARG H2 H N N 56 ARG HA H N N 57 ARG HB2 H N N 58 ARG HB3 H N N 59 ARG HG2 H N N 60 ARG HG3 H N N 61 ARG HD2 H N N 62 ARG HD3 H N N 63 ARG HE H N N 64 ARG HH11 H N N 65 ARG HH12 H N N 66 ARG HH21 H N N 67 ARG HH22 H N N 68 ARG HXT H N N 69 ASN N N N N 70 ASN CA C N S 71 ASN C C N N 72 ASN O O N N 73 ASN CB C N N 74 ASN CG C N N 75 ASN OD1 O N N 76 ASN ND2 N N N 77 ASN OXT O N N 78 ASN H H N N 79 ASN H2 H N N 80 ASN HA H N N 81 ASN HB2 H N N 82 ASN HB3 H N N 83 ASN HD21 H N N 84 ASN HD22 H N N 85 ASN HXT H N N 86 ASP N N N N 87 ASP CA C N S 88 ASP C C N N 89 ASP O O N N 90 ASP CB C N N 91 ASP CG C N N 92 ASP OD1 O N N 93 ASP OD2 O N N 94 ASP OXT O N N 95 ASP H H N N 96 ASP H2 H N N 97 ASP HA H N N 98 ASP HB2 H N N 99 ASP HB3 H N N 100 ASP HD2 H N N 101 ASP HXT H N N 102 CYS N N N N 103 CYS CA C N R 104 CYS C C N N 105 CYS O O N N 106 CYS CB C N N 107 CYS SG S N N 108 CYS OXT O N N 109 CYS H H N N 110 CYS H2 H N N 111 CYS HA H N N 112 CYS HB2 H N N 113 CYS HB3 H N N 114 CYS HG H N N 115 CYS HXT H N N 116 GLN N N N N 117 GLN CA C N S 118 GLN C C N N 119 GLN O O N N 120 GLN CB C N N 121 GLN CG C N N 122 GLN CD C N N 123 GLN OE1 O N N 124 GLN NE2 N N N 125 GLN OXT O N N 126 GLN H H N N 127 GLN H2 H N N 128 GLN HA H N N 129 GLN HB2 H N N 130 GLN HB3 H N N 131 GLN HG2 H N N 132 GLN HG3 H N N 133 GLN HE21 H N N 134 GLN HE22 H N N 135 GLN HXT H N N 136 GLU N N N N 137 GLU CA C N S 138 GLU C C N N 139 GLU O O N N 140 GLU CB C N N 141 GLU CG C N N 142 GLU CD C N N 143 GLU OE1 O N N 144 GLU OE2 O N N 145 GLU OXT O N N 146 GLU H H N N 147 GLU H2 H N N 148 GLU HA H N N 149 GLU HB2 H N N 150 GLU HB3 H N N 151 GLU HG2 H N N 152 GLU HG3 H N N 153 GLU HE2 H N N 154 GLU HXT H N N 155 GLY N N N N 156 GLY CA C N N 157 GLY C C N N 158 GLY O O N N 159 GLY OXT O N N 160 GLY H H N N 161 GLY H2 H N N 162 GLY HA2 H N N 163 GLY HA3 H N N 164 GLY HXT H N N 165 HIS N N N N 166 HIS CA C N S 167 HIS C C N N 168 HIS O O N N 169 HIS CB C N N 170 HIS CG C Y N 171 HIS ND1 N Y N 172 HIS CD2 C Y N 173 HIS CE1 C Y N 174 HIS NE2 N Y N 175 HIS OXT O N N 176 HIS H H N N 177 HIS H2 H N N 178 HIS HA H N N 179 HIS HB2 H N N 180 HIS HB3 H N N 181 HIS HD1 H N N 182 HIS HD2 H N N 183 HIS HE1 H N N 184 HIS HE2 H N N 185 HIS HXT H N N 186 HOH O O N N 187 HOH H1 H N N 188 HOH H2 H N N 189 ILE N N N N 190 ILE CA C N S 191 ILE C C N N 192 ILE O O N N 193 ILE CB C N S 194 ILE CG1 C N N 195 ILE CG2 C N N 196 ILE CD1 C N N 197 ILE OXT O N N 198 ILE H H N N 199 ILE H2 H N N 200 ILE HA H N N 201 ILE HB H N N 202 ILE HG12 H N N 203 ILE HG13 H N N 204 ILE HG21 H N N 205 ILE HG22 H N N 206 ILE HG23 H N N 207 ILE HD11 H N N 208 ILE HD12 H N N 209 ILE HD13 H N N 210 ILE HXT H N N 211 LEU N N N N 212 LEU CA C N S 213 LEU C C N N 214 LEU O O N N 215 LEU CB C N N 216 LEU CG C N N 217 LEU CD1 C N N 218 LEU CD2 C N N 219 LEU OXT O N N 220 LEU H H N N 221 LEU H2 H N N 222 LEU HA H N N 223 LEU HB2 H N N 224 LEU HB3 H N N 225 LEU HG H N N 226 LEU HD11 H N N 227 LEU HD12 H N N 228 LEU HD13 H N N 229 LEU HD21 H N N 230 LEU HD22 H N N 231 LEU HD23 H N N 232 LEU HXT H N N 233 LYS N N N N 234 LYS CA C N S 235 LYS C C N N 236 LYS O O N N 237 LYS CB C N N 238 LYS CG C N N 239 LYS CD C N N 240 LYS CE C N N 241 LYS NZ N N N 242 LYS OXT O N N 243 LYS H H N N 244 LYS H2 H N N 245 LYS HA H N N 246 LYS HB2 H N N 247 LYS HB3 H N N 248 LYS HG2 H N N 249 LYS HG3 H N N 250 LYS HD2 H N N 251 LYS HD3 H N N 252 LYS HE2 H N N 253 LYS HE3 H N N 254 LYS HZ1 H N N 255 LYS HZ2 H N N 256 LYS HZ3 H N N 257 LYS HXT H N N 258 MET N N N N 259 MET CA C N S 260 MET C C N N 261 MET O O N N 262 MET CB C N N 263 MET CG C N N 264 MET SD S N N 265 MET CE C N N 266 MET OXT O N N 267 MET H H N N 268 MET H2 H N N 269 MET HA H N N 270 MET HB2 H N N 271 MET HB3 H N N 272 MET HG2 H N N 273 MET HG3 H N N 274 MET HE1 H N N 275 MET HE2 H N N 276 MET HE3 H N N 277 MET HXT H N N 278 PHE N N N N 279 PHE CA C N S 280 PHE C C N N 281 PHE O O N N 282 PHE CB C N N 283 PHE CG C Y N 284 PHE CD1 C Y N 285 PHE CD2 C Y N 286 PHE CE1 C Y N 287 PHE CE2 C Y N 288 PHE CZ C Y N 289 PHE OXT O N N 290 PHE H H N N 291 PHE H2 H N N 292 PHE HA H N N 293 PHE HB2 H N N 294 PHE HB3 H N N 295 PHE HD1 H N N 296 PHE HD2 H N N 297 PHE HE1 H N N 298 PHE HE2 H N N 299 PHE HZ H N N 300 PHE HXT H N N 301 PRO N N N N 302 PRO CA C N S 303 PRO C C N N 304 PRO O O N N 305 PRO CB C N N 306 PRO CG C N N 307 PRO CD C N N 308 PRO OXT O N N 309 PRO H H N N 310 PRO HA H N N 311 PRO HB2 H N N 312 PRO HB3 H N N 313 PRO HG2 H N N 314 PRO HG3 H N N 315 PRO HD2 H N N 316 PRO HD3 H N N 317 PRO HXT H N N 318 SEP N N N N 319 SEP CA C N S 320 SEP CB C N N 321 SEP OG O N N 322 SEP C C N N 323 SEP O O N N 324 SEP OXT O N N 325 SEP P P N N 326 SEP O1P O N N 327 SEP O2P O N N 328 SEP O3P O N N 329 SEP H H N N 330 SEP H2 H N N 331 SEP HA H N N 332 SEP HB2 H N N 333 SEP HB3 H N N 334 SEP HXT H N N 335 SEP HOP2 H N N 336 SEP HOP3 H N N 337 SER N N N N 338 SER CA C N S 339 SER C C N N 340 SER O O N N 341 SER CB C N N 342 SER OG O N N 343 SER OXT O N N 344 SER H H N N 345 SER H2 H N N 346 SER HA H N N 347 SER HB2 H N N 348 SER HB3 H N N 349 SER HG H N N 350 SER HXT H N N 351 THR N N N N 352 THR CA C N S 353 THR C C N N 354 THR O O N N 355 THR CB C N R 356 THR OG1 O N N 357 THR CG2 C N N 358 THR OXT O N N 359 THR H H N N 360 THR H2 H N N 361 THR HA H N N 362 THR HB H N N 363 THR HG1 H N N 364 THR HG21 H N N 365 THR HG22 H N N 366 THR HG23 H N N 367 THR HXT H N N 368 TYR N N N N 369 TYR CA C N S 370 TYR C C N N 371 TYR O O N N 372 TYR CB C N N 373 TYR CG C Y N 374 TYR CD1 C Y N 375 TYR CD2 C Y N 376 TYR CE1 C Y N 377 TYR CE2 C Y N 378 TYR CZ C Y N 379 TYR OH O N N 380 TYR OXT O N N 381 TYR H H N N 382 TYR H2 H N N 383 TYR HA H N N 384 TYR HB2 H N N 385 TYR HB3 H N N 386 TYR HD1 H N N 387 TYR HD2 H N N 388 TYR HE1 H N N 389 TYR HE2 H N N 390 TYR HH H N N 391 TYR HXT H N N 392 VAL N N N N 393 VAL CA C N S 394 VAL C C N N 395 VAL O O N N 396 VAL CB C N N 397 VAL CG1 C N N 398 VAL CG2 C N N 399 VAL OXT O N N 400 VAL H H N N 401 VAL H2 H N N 402 VAL HA H N N 403 VAL HB H N N 404 VAL HG11 H N N 405 VAL HG12 H N N 406 VAL HG13 H N N 407 VAL HG21 H N N 408 VAL HG22 H N N 409 VAL HG23 H N N 410 VAL HXT H N N 411 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ALY OH CH doub N N 13 ALY CH CH3 sing N N 14 ALY CH NZ sing N N 15 ALY CH3 HH31 sing N N 16 ALY CH3 HH32 sing N N 17 ALY CH3 HH33 sing N N 18 ALY NZ CE sing N N 19 ALY NZ HZ sing N N 20 ALY CE CD sing N N 21 ALY CE HE3 sing N N 22 ALY CE HE2 sing N N 23 ALY CD CG sing N N 24 ALY CD HD3 sing N N 25 ALY CD HD2 sing N N 26 ALY CG CB sing N N 27 ALY CG HG3 sing N N 28 ALY CG HG2 sing N N 29 ALY CB CA sing N N 30 ALY CB HB3 sing N N 31 ALY CB HB2 sing N N 32 ALY CA N sing N N 33 ALY CA C sing N N 34 ALY CA HA sing N N 35 ALY N H sing N N 36 ALY N H2 sing N N 37 ALY C O doub N N 38 ALY C OXT sing N N 39 ALY OXT HXT sing N N 40 ARG N CA sing N N 41 ARG N H sing N N 42 ARG N H2 sing N N 43 ARG CA C sing N N 44 ARG CA CB sing N N 45 ARG CA HA sing N N 46 ARG C O doub N N 47 ARG C OXT sing N N 48 ARG CB CG sing N N 49 ARG CB HB2 sing N N 50 ARG CB HB3 sing N N 51 ARG CG CD sing N N 52 ARG CG HG2 sing N N 53 ARG CG HG3 sing N N 54 ARG CD NE sing N N 55 ARG CD HD2 sing N N 56 ARG CD HD3 sing N N 57 ARG NE CZ sing N N 58 ARG NE HE sing N N 59 ARG CZ NH1 sing N N 60 ARG CZ NH2 doub N N 61 ARG NH1 HH11 sing N N 62 ARG NH1 HH12 sing N N 63 ARG NH2 HH21 sing N N 64 ARG NH2 HH22 sing N N 65 ARG OXT HXT sing N N 66 ASN N CA sing N N 67 ASN N H sing N N 68 ASN N H2 sing N N 69 ASN CA C sing N N 70 ASN CA CB sing N N 71 ASN CA HA sing N N 72 ASN C O doub N N 73 ASN C OXT sing N N 74 ASN CB CG sing N N 75 ASN CB HB2 sing N N 76 ASN CB HB3 sing N N 77 ASN CG OD1 doub N N 78 ASN CG ND2 sing N N 79 ASN ND2 HD21 sing N N 80 ASN ND2 HD22 sing N N 81 ASN OXT HXT sing N N 82 ASP N CA sing N N 83 ASP N H sing N N 84 ASP N H2 sing N N 85 ASP CA C sing N N 86 ASP CA CB sing N N 87 ASP CA HA sing N N 88 ASP C O doub N N 89 ASP C OXT sing N N 90 ASP CB CG sing N N 91 ASP CB HB2 sing N N 92 ASP CB HB3 sing N N 93 ASP CG OD1 doub N N 94 ASP CG OD2 sing N N 95 ASP OD2 HD2 sing N N 96 ASP OXT HXT sing N N 97 CYS N CA sing N N 98 CYS N H sing N N 99 CYS N H2 sing N N 100 CYS CA C sing N N 101 CYS CA CB sing N N 102 CYS CA HA sing N N 103 CYS C O doub N N 104 CYS C OXT sing N N 105 CYS CB SG sing N N 106 CYS CB HB2 sing N N 107 CYS CB HB3 sing N N 108 CYS SG HG sing N N 109 CYS OXT HXT sing N N 110 GLN N CA sing N N 111 GLN N H sing N N 112 GLN N H2 sing N N 113 GLN CA C sing N N 114 GLN CA CB sing N N 115 GLN CA HA sing N N 116 GLN C O doub N N 117 GLN C OXT sing N N 118 GLN CB CG sing N N 119 GLN CB HB2 sing N N 120 GLN CB HB3 sing N N 121 GLN CG CD sing N N 122 GLN CG HG2 sing N N 123 GLN CG HG3 sing N N 124 GLN CD OE1 doub N N 125 GLN CD NE2 sing N N 126 GLN NE2 HE21 sing N N 127 GLN NE2 HE22 sing N N 128 GLN OXT HXT sing N N 129 GLU N CA sing N N 130 GLU N H sing N N 131 GLU N H2 sing N N 132 GLU CA C sing N N 133 GLU CA CB sing N N 134 GLU CA HA sing N N 135 GLU C O doub N N 136 GLU C OXT sing N N 137 GLU CB CG sing N N 138 GLU CB HB2 sing N N 139 GLU CB HB3 sing N N 140 GLU CG CD sing N N 141 GLU CG HG2 sing N N 142 GLU CG HG3 sing N N 143 GLU CD OE1 doub N N 144 GLU CD OE2 sing N N 145 GLU OE2 HE2 sing N N 146 GLU OXT HXT sing N N 147 GLY N CA sing N N 148 GLY N H sing N N 149 GLY N H2 sing N N 150 GLY CA C sing N N 151 GLY CA HA2 sing N N 152 GLY CA HA3 sing N N 153 GLY C O doub N N 154 GLY C OXT sing N N 155 GLY OXT HXT sing N N 156 HIS N CA sing N N 157 HIS N H sing N N 158 HIS N H2 sing N N 159 HIS CA C sing N N 160 HIS CA CB sing N N 161 HIS CA HA sing N N 162 HIS C O doub N N 163 HIS C OXT sing N N 164 HIS CB CG sing N N 165 HIS CB HB2 sing N N 166 HIS CB HB3 sing N N 167 HIS CG ND1 sing Y N 168 HIS CG CD2 doub Y N 169 HIS ND1 CE1 doub Y N 170 HIS ND1 HD1 sing N N 171 HIS CD2 NE2 sing Y N 172 HIS CD2 HD2 sing N N 173 HIS CE1 NE2 sing Y N 174 HIS CE1 HE1 sing N N 175 HIS NE2 HE2 sing N N 176 HIS OXT HXT sing N N 177 HOH O H1 sing N N 178 HOH O H2 sing N N 179 ILE N CA sing N N 180 ILE N H sing N N 181 ILE N H2 sing N N 182 ILE CA C sing N N 183 ILE CA CB sing N N 184 ILE CA HA sing N N 185 ILE C O doub N N 186 ILE C OXT sing N N 187 ILE CB CG1 sing N N 188 ILE CB CG2 sing N N 189 ILE CB HB sing N N 190 ILE CG1 CD1 sing N N 191 ILE CG1 HG12 sing N N 192 ILE CG1 HG13 sing N N 193 ILE CG2 HG21 sing N N 194 ILE CG2 HG22 sing N N 195 ILE CG2 HG23 sing N N 196 ILE CD1 HD11 sing N N 197 ILE CD1 HD12 sing N N 198 ILE CD1 HD13 sing N N 199 ILE OXT HXT sing N N 200 LEU N CA sing N N 201 LEU N H sing N N 202 LEU N H2 sing N N 203 LEU CA C sing N N 204 LEU CA CB sing N N 205 LEU CA HA sing N N 206 LEU C O doub N N 207 LEU C OXT sing N N 208 LEU CB CG sing N N 209 LEU CB HB2 sing N N 210 LEU CB HB3 sing N N 211 LEU CG CD1 sing N N 212 LEU CG CD2 sing N N 213 LEU CG HG sing N N 214 LEU CD1 HD11 sing N N 215 LEU CD1 HD12 sing N N 216 LEU CD1 HD13 sing N N 217 LEU CD2 HD21 sing N N 218 LEU CD2 HD22 sing N N 219 LEU CD2 HD23 sing N N 220 LEU OXT HXT sing N N 221 LYS N CA sing N N 222 LYS N H sing N N 223 LYS N H2 sing N N 224 LYS CA C sing N N 225 LYS CA CB sing N N 226 LYS CA HA sing N N 227 LYS C O doub N N 228 LYS C OXT sing N N 229 LYS CB CG sing N N 230 LYS CB HB2 sing N N 231 LYS CB HB3 sing N N 232 LYS CG CD sing N N 233 LYS CG HG2 sing N N 234 LYS CG HG3 sing N N 235 LYS CD CE sing N N 236 LYS CD HD2 sing N N 237 LYS CD HD3 sing N N 238 LYS CE NZ sing N N 239 LYS CE HE2 sing N N 240 LYS CE HE3 sing N N 241 LYS NZ HZ1 sing N N 242 LYS NZ HZ2 sing N N 243 LYS NZ HZ3 sing N N 244 LYS OXT HXT sing N N 245 MET N CA sing N N 246 MET N H sing N N 247 MET N H2 sing N N 248 MET CA C sing N N 249 MET CA CB sing N N 250 MET CA HA sing N N 251 MET C O doub N N 252 MET C OXT sing N N 253 MET CB CG sing N N 254 MET CB HB2 sing N N 255 MET CB HB3 sing N N 256 MET CG SD sing N N 257 MET CG HG2 sing N N 258 MET CG HG3 sing N N 259 MET SD CE sing N N 260 MET CE HE1 sing N N 261 MET CE HE2 sing N N 262 MET CE HE3 sing N N 263 MET OXT HXT sing N N 264 PHE N CA sing N N 265 PHE N H sing N N 266 PHE N H2 sing N N 267 PHE CA C sing N N 268 PHE CA CB sing N N 269 PHE CA HA sing N N 270 PHE C O doub N N 271 PHE C OXT sing N N 272 PHE CB CG sing N N 273 PHE CB HB2 sing N N 274 PHE CB HB3 sing N N 275 PHE CG CD1 doub Y N 276 PHE CG CD2 sing Y N 277 PHE CD1 CE1 sing Y N 278 PHE CD1 HD1 sing N N 279 PHE CD2 CE2 doub Y N 280 PHE CD2 HD2 sing N N 281 PHE CE1 CZ doub Y N 282 PHE CE1 HE1 sing N N 283 PHE CE2 CZ sing Y N 284 PHE CE2 HE2 sing N N 285 PHE CZ HZ sing N N 286 PHE OXT HXT sing N N 287 PRO N CA sing N N 288 PRO N CD sing N N 289 PRO N H sing N N 290 PRO CA C sing N N 291 PRO CA CB sing N N 292 PRO CA HA sing N N 293 PRO C O doub N N 294 PRO C OXT sing N N 295 PRO CB CG sing N N 296 PRO CB HB2 sing N N 297 PRO CB HB3 sing N N 298 PRO CG CD sing N N 299 PRO CG HG2 sing N N 300 PRO CG HG3 sing N N 301 PRO CD HD2 sing N N 302 PRO CD HD3 sing N N 303 PRO OXT HXT sing N N 304 SEP N CA sing N N 305 SEP N H sing N N 306 SEP N H2 sing N N 307 SEP CA CB sing N N 308 SEP CA C sing N N 309 SEP CA HA sing N N 310 SEP CB OG sing N N 311 SEP CB HB2 sing N N 312 SEP CB HB3 sing N N 313 SEP OG P sing N N 314 SEP C O doub N N 315 SEP C OXT sing N N 316 SEP OXT HXT sing N N 317 SEP P O1P doub N N 318 SEP P O2P sing N N 319 SEP P O3P sing N N 320 SEP O2P HOP2 sing N N 321 SEP O3P HOP3 sing N N 322 SER N CA sing N N 323 SER N H sing N N 324 SER N H2 sing N N 325 SER CA C sing N N 326 SER CA CB sing N N 327 SER CA HA sing N N 328 SER C O doub N N 329 SER C OXT sing N N 330 SER CB OG sing N N 331 SER CB HB2 sing N N 332 SER CB HB3 sing N N 333 SER OG HG sing N N 334 SER OXT HXT sing N N 335 THR N CA sing N N 336 THR N H sing N N 337 THR N H2 sing N N 338 THR CA C sing N N 339 THR CA CB sing N N 340 THR CA HA sing N N 341 THR C O doub N N 342 THR C OXT sing N N 343 THR CB OG1 sing N N 344 THR CB CG2 sing N N 345 THR CB HB sing N N 346 THR OG1 HG1 sing N N 347 THR CG2 HG21 sing N N 348 THR CG2 HG22 sing N N 349 THR CG2 HG23 sing N N 350 THR OXT HXT sing N N 351 TYR N CA sing N N 352 TYR N H sing N N 353 TYR N H2 sing N N 354 TYR CA C sing N N 355 TYR CA CB sing N N 356 TYR CA HA sing N N 357 TYR C O doub N N 358 TYR C OXT sing N N 359 TYR CB CG sing N N 360 TYR CB HB2 sing N N 361 TYR CB HB3 sing N N 362 TYR CG CD1 doub Y N 363 TYR CG CD2 sing Y N 364 TYR CD1 CE1 sing Y N 365 TYR CD1 HD1 sing N N 366 TYR CD2 CE2 doub Y N 367 TYR CD2 HD2 sing N N 368 TYR CE1 CZ doub Y N 369 TYR CE1 HE1 sing N N 370 TYR CE2 CZ sing Y N 371 TYR CE2 HE2 sing N N 372 TYR CZ OH sing N N 373 TYR OH HH sing N N 374 TYR OXT HXT sing N N 375 VAL N CA sing N N 376 VAL N H sing N N 377 VAL N H2 sing N N 378 VAL CA C sing N N 379 VAL CA CB sing N N 380 VAL CA HA sing N N 381 VAL C O doub N N 382 VAL C OXT sing N N 383 VAL CB CG1 sing N N 384 VAL CB CG2 sing N N 385 VAL CB HB sing N N 386 VAL CG1 HG11 sing N N 387 VAL CG1 HG12 sing N N 388 VAL CG1 HG13 sing N N 389 VAL CG2 HG21 sing N N 390 VAL CG2 HG22 sing N N 391 VAL CG2 HG23 sing N N 392 VAL OXT HXT sing N N 393 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Canadian Institutes of Health Research (CIHR)' Canada 74739 1 'Canadian Institutes of Health Research (CIHR)' Canada 130414 2 # loop_ _pdbx_entity_instance_feature.ordinal _pdbx_entity_instance_feature.comp_id _pdbx_entity_instance_feature.asym_id _pdbx_entity_instance_feature.seq_num _pdbx_entity_instance_feature.auth_comp_id _pdbx_entity_instance_feature.auth_asym_id _pdbx_entity_instance_feature.auth_seq_num _pdbx_entity_instance_feature.feature_type _pdbx_entity_instance_feature.details 1 ALY ? ? ALY ? ? 'SUBJECT OF INVESTIGATION' ? 2 SEP ? ? SEP ? ? 'SUBJECT OF INVESTIGATION' ? # _pdbx_entity_nonpoly.entity_id 3 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4WJN _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'isothermal titration calorimetry' _pdbx_struct_assembly_auth_evidence.details ? #