data_6V4H # _entry.id 6V4H # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.342 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 6V4H WWPDB D_1000245732 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6V4H _pdbx_database_status.recvd_initial_deposition_date 2019-11-27 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Seo, H.-S.' 1 ? 'Dhe-Paganon, S.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Structure _citation.journal_id_ASTM STRUE6 _citation.journal_id_CSD 2005 _citation.journal_id_ISSN 0969-2126 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 28 _citation.language ? _citation.page_first 847 _citation.page_last 857.e5 _citation.title 'Identification of a Structural Determinant for Selective Targeting of HDMX.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.str.2020.04.011 _citation.pdbx_database_id_PubMed 32359398 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ben-Nun, Y.' 1 ? primary 'Seo, H.S.' 2 ? primary 'Harvey, E.P.' 3 ? primary 'Hauseman, Z.J.' 4 ? primary 'Wales, T.E.' 5 ? primary 'Newman, C.E.' 6 ? primary 'Cathcart, A.M.' 7 ? primary 'Engen, J.R.' 8 ? primary 'Dhe-Paganon, S.' 9 ? primary 'Walensky, L.D.' 10 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 106.690 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6V4H _cell.details ? _cell.formula_units_Z ? _cell.length_a 67.220 _cell.length_a_esd ? _cell.length_b 30.800 _cell.length_b_esd ? _cell.length_c 68.850 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6V4H _symmetry.cell_setting ? _symmetry.Int_Tables_number 4 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1 21 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Protein Mdm4' 11998.787 2 ? 'L46V, V95L' ? ? 2 polymer syn 'Stapled Peptide LSQETF(0EH)DLWKLL(MK8)EN(NH2)' 2031.394 2 ? ? ? ? 3 water nat water 18.015 172 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Double minute 4 protein,Mdm2-like p53-binding protein,Protein Mdmx,p53-binding protein Mdm4' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;HHHHHHDDDDKRTLPGEGTQVHPRAPLLQILKVAGAQEEVFTVKEVMHYLGQYIMMKQLYDKQRQHIVHCHDDPLGELLE VGSFSVKNPSPLYEMLKRNLVIL ; ;HHHHHHDDDDKRTLPGEGTQVHPRAPLLQILKVAGAQEEVFTVKEVMHYLGQYIMMKQLYDKQRQHIVHCHDDPLGELLE VGSFSVKNPSPLYEMLKRNLVIL ; A,C ? 2 'polypeptide(L)' no yes 'LSQETF(0EH)DLWKLL(MK8)EN(NH2)' LSQETFXDLWKLLLENX B,D ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 HIS n 1 2 HIS n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 ASP n 1 8 ASP n 1 9 ASP n 1 10 ASP n 1 11 LYS n 1 12 ARG n 1 13 THR n 1 14 LEU n 1 15 PRO n 1 16 GLY n 1 17 GLU n 1 18 GLY n 1 19 THR n 1 20 GLN n 1 21 VAL n 1 22 HIS n 1 23 PRO n 1 24 ARG n 1 25 ALA n 1 26 PRO n 1 27 LEU n 1 28 LEU n 1 29 GLN n 1 30 ILE n 1 31 LEU n 1 32 LYS n 1 33 VAL n 1 34 ALA n 1 35 GLY n 1 36 ALA n 1 37 GLN n 1 38 GLU n 1 39 GLU n 1 40 VAL n 1 41 PHE n 1 42 THR n 1 43 VAL n 1 44 LYS n 1 45 GLU n 1 46 VAL n 1 47 MET n 1 48 HIS n 1 49 TYR n 1 50 LEU n 1 51 GLY n 1 52 GLN n 1 53 TYR n 1 54 ILE n 1 55 MET n 1 56 MET n 1 57 LYS n 1 58 GLN n 1 59 LEU n 1 60 TYR n 1 61 ASP n 1 62 LYS n 1 63 GLN n 1 64 ARG n 1 65 GLN n 1 66 HIS n 1 67 ILE n 1 68 VAL n 1 69 HIS n 1 70 CYS n 1 71 HIS n 1 72 ASP n 1 73 ASP n 1 74 PRO n 1 75 LEU n 1 76 GLY n 1 77 GLU n 1 78 LEU n 1 79 LEU n 1 80 GLU n 1 81 VAL n 1 82 GLY n 1 83 SER n 1 84 PHE n 1 85 SER n 1 86 VAL n 1 87 LYS n 1 88 ASN n 1 89 PRO n 1 90 SER n 1 91 PRO n 1 92 LEU n 1 93 TYR n 1 94 GLU n 1 95 MET n 1 96 LEU n 1 97 LYS n 1 98 ARG n 1 99 ASN n 1 100 LEU n 1 101 VAL n 1 102 ILE n 1 103 LEU n 2 1 LEU n 2 2 SER n 2 3 GLN n 2 4 GLU n 2 5 THR n 2 6 PHE n 2 7 0EH n 2 8 ASP n 2 9 LEU n 2 10 TRP n 2 11 LYS n 2 12 LEU n 2 13 LEU n 2 14 MK8 n 2 15 GLU n 2 16 ASN n 2 17 NH2 n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 103 _entity_src_gen.gene_src_common_name Zebrafish _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'mdm4, mdmx' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Danio rerio' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 7955 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 17 _pdbx_entity_src_syn.organism_scientific 'Homo sapiens' _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 9606 _pdbx_entity_src_syn.details ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP MDM4_DANRE Q7ZUW7 ? 1 ;RTLPGEGTQVHPRAPLLQILKVAGAQEEVFTLKEVMHYLGQYIMMKQLYDKQRQHIVHCHDDPLGELLEVGSFSVKNPSP VYEMLKRNLVIL ; 15 2 PDB 6V4H 6V4H ? 2 ? 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 6V4H A 12 ? 103 ? Q7ZUW7 15 ? 106 ? 15 106 2 2 6V4H B 1 ? 17 ? 6V4H 14 ? 30 ? 14 30 3 1 6V4H C 12 ? 103 ? Q7ZUW7 15 ? 106 ? 15 106 4 2 6V4H D 1 ? 17 ? 6V4H 14 ? 30 ? 14 30 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6V4H HIS A 1 ? UNP Q7ZUW7 ? ? 'expression tag' 4 1 1 6V4H HIS A 2 ? UNP Q7ZUW7 ? ? 'expression tag' 5 2 1 6V4H HIS A 3 ? UNP Q7ZUW7 ? ? 'expression tag' 6 3 1 6V4H HIS A 4 ? UNP Q7ZUW7 ? ? 'expression tag' 7 4 1 6V4H HIS A 5 ? UNP Q7ZUW7 ? ? 'expression tag' 8 5 1 6V4H HIS A 6 ? UNP Q7ZUW7 ? ? 'expression tag' 9 6 1 6V4H ASP A 7 ? UNP Q7ZUW7 ? ? 'expression tag' 10 7 1 6V4H ASP A 8 ? UNP Q7ZUW7 ? ? 'expression tag' 11 8 1 6V4H ASP A 9 ? UNP Q7ZUW7 ? ? 'expression tag' 12 9 1 6V4H ASP A 10 ? UNP Q7ZUW7 ? ? 'expression tag' 13 10 1 6V4H LYS A 11 ? UNP Q7ZUW7 ? ? 'expression tag' 14 11 1 6V4H VAL A 43 ? UNP Q7ZUW7 LEU 46 'engineered mutation' 46 12 1 6V4H LEU A 92 ? UNP Q7ZUW7 VAL 95 'engineered mutation' 95 13 3 6V4H HIS C 1 ? UNP Q7ZUW7 ? ? 'expression tag' 4 14 3 6V4H HIS C 2 ? UNP Q7ZUW7 ? ? 'expression tag' 5 15 3 6V4H HIS C 3 ? UNP Q7ZUW7 ? ? 'expression tag' 6 16 3 6V4H HIS C 4 ? UNP Q7ZUW7 ? ? 'expression tag' 7 17 3 6V4H HIS C 5 ? UNP Q7ZUW7 ? ? 'expression tag' 8 18 3 6V4H HIS C 6 ? UNP Q7ZUW7 ? ? 'expression tag' 9 19 3 6V4H ASP C 7 ? UNP Q7ZUW7 ? ? 'expression tag' 10 20 3 6V4H ASP C 8 ? UNP Q7ZUW7 ? ? 'expression tag' 11 21 3 6V4H ASP C 9 ? UNP Q7ZUW7 ? ? 'expression tag' 12 22 3 6V4H ASP C 10 ? UNP Q7ZUW7 ? ? 'expression tag' 13 23 3 6V4H LYS C 11 ? UNP Q7ZUW7 ? ? 'expression tag' 14 24 3 6V4H VAL C 43 ? UNP Q7ZUW7 LEU 46 'engineered mutation' 46 25 3 6V4H LEU C 92 ? UNP Q7ZUW7 VAL 95 'engineered mutation' 95 26 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 0EH 'D-peptide linking' . '(2R)-2-amino-2-methylnonanoic acid' ? 'C10 H21 N O2' 187.279 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MK8 'L-peptide linking' n 2-methyl-L-norleucine ? 'C7 H15 N O2' 145.199 NH2 non-polymer . 'AMINO GROUP' ? 'H2 N' 16.023 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6V4H _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.43 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 49.44 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '100mM Tris-8.0, 24% PEG 3350, 50mM ammonium sulfate' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M-F' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2019-02-08 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9792 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 24-ID-E' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9792 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 24-ID-E _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 20.233 _reflns.entry_id 6V4H _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.530 _reflns.d_resolution_low 65.950 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 40591 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.000 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.400 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 12.200 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.058 _reflns.pdbx_Rpim_I_all 0.031 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 137013 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.530 _reflns_shell.d_res_low 1.560 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.000 _reflns_shell.number_measured_all 5514 _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1881 _reflns_shell.percent_possible_all 92.100 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 2.900 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 1.257 _reflns_shell.pdbx_Rpim_I_all 0.714 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 86.620 _refine.B_iso_mean 33.3238 _refine.B_iso_min 16.710 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6V4H _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.5300 _refine.ls_d_res_low 65.9500 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 40578 _refine.ls_number_reflns_R_free 2009 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.0000 _refine.ls_percent_reflns_R_free 4.9500 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1597 _refine.ls_R_factor_R_free 0.1922 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1580 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.340 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 4N5T _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 20.3500 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.1900 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 1.5300 _refine_hist.d_res_low 65.9500 _refine_hist.number_atoms_solvent 172 _refine_hist.number_atoms_total 1859 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 209 _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent 44.27 _refine_hist.pdbx_number_atoms_protein 1687 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function f_bond_d 0.005 ? ? 1770 'X-RAY DIFFRACTION' ? f_angle_d 0.804 ? ? 2397 'X-RAY DIFFRACTION' ? f_dihedral_angle_d 2.437 ? ? 1804 'X-RAY DIFFRACTION' ? f_chiral_restr 0.052 ? ? 265 'X-RAY DIFFRACTION' ? f_plane_restr 0.005 ? ? 307 'X-RAY DIFFRACTION' ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.5300 1.5683 . . 135 2604 93.0000 . . . 0.3173 0.0000 0.2683 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.5683 1.6107 . . 126 2747 98.0000 . . . 0.2767 0.0000 0.2369 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.6107 1.6581 . . 133 2724 99.0000 . . . 0.2564 0.0000 0.2115 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.6581 1.7116 . . 144 2767 99.0000 . . . 0.2356 0.0000 0.1819 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.7116 1.7728 . . 137 2760 99.0000 . . . 0.2228 0.0000 0.1605 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.7728 1.8438 . . 134 2762 99.0000 . . . 0.1625 0.0000 0.1495 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.8438 1.9277 . . 164 2690 97.0000 . . . 0.1901 0.0000 0.1413 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.9277 2.0294 . . 124 2776 99.0000 . . . 0.2016 0.0000 0.1476 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.0294 2.1565 . . 138 2763 99.0000 . . . 0.1877 0.0000 0.1387 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.1565 2.3230 . . 165 2758 99.0000 . . . 0.1606 0.0000 0.1406 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.3230 2.5568 . . 143 2796 98.0000 . . . 0.1955 0.0000 0.1509 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.5568 2.9268 . . 165 2731 98.0000 . . . 0.1926 0.0000 0.1681 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.9268 3.6874 . . 142 2819 99.0000 . . . 0.1827 0.0000 0.1562 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.6874 65.9500 . . 159 2872 98.0000 . . . 0.1894 0.0000 0.1559 . . . . . . . . . . . # _struct.entry_id 6V4H _struct.title 'Crystal Structure Analysis of Zebra Fish MDMX' _struct.pdbx_descriptor ? _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6V4H _struct_keywords.text 'apoptosis, p53 binding' _struct_keywords.pdbx_keywords APOPTOSIS # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 1 ? D N N 2 ? E N N 3 ? F N N 3 ? G N N 3 ? H N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ARG A 24 ? ALA A 34 ? ARG A 27 ALA A 37 1 ? 11 HELX_P HELX_P2 AA2 VAL A 43 ? GLN A 58 ? VAL A 46 GLN A 61 1 ? 16 HELX_P HELX_P3 AA3 ASP A 73 ? GLU A 80 ? ASP A 76 GLU A 83 1 ? 8 HELX_P HELX_P4 AA4 PRO A 89 ? ASN A 99 ? PRO A 92 ASN A 102 1 ? 11 HELX_P HELX_P5 AA5 THR B 5 ? PHE B 6 ? THR B 18 PHE B 19 5 ? 2 HELX_P HELX_P6 AA6 ASP B 8 ? ASP B 8 ? ASP B 21 ASP B 21 5 ? 1 HELX_P HELX_P7 AA7 LEU B 9 ? ASN B 16 ? LEU B 22 ASN B 29 1 ? 8 HELX_P HELX_P8 AA8 ARG C 24 ? ALA C 34 ? ARG C 27 ALA C 37 1 ? 11 HELX_P HELX_P9 AA9 VAL C 43 ? GLN C 58 ? VAL C 46 GLN C 61 1 ? 16 HELX_P HELX_P10 AB1 ASP C 73 ? GLU C 80 ? ASP C 76 GLU C 83 1 ? 8 HELX_P HELX_P11 AB2 PRO C 89 ? ASN C 99 ? PRO C 92 ASN C 102 1 ? 11 HELX_P HELX_P12 AB3 THR D 5 ? PHE D 6 ? THR D 18 PHE D 19 5 ? 2 HELX_P HELX_P13 AB4 ASP D 8 ? ASP D 8 ? ASP D 21 ASP D 21 5 ? 1 HELX_P HELX_P14 AB5 LEU D 9 ? ASN D 16 ? LEU D 22 ASN D 29 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale one ? B PHE 6 C ? ? ? 1_555 B 0EH 7 NAC ? ? B PHE 19 B 0EH 20 1_555 ? ? ? ? ? ? ? 1.429 ? ? covale2 covale both ? B 0EH 7 CAE ? ? ? 1_555 B ASP 8 N ? ? B 0EH 20 B ASP 21 1_555 ? ? ? ? ? ? ? 1.424 ? ? covale3 covale none ? B 0EH 7 CAT ? ? ? 1_555 B MK8 14 CE ? ? B 0EH 20 B MK8 27 1_555 ? ? ? ? ? ? ? 1.418 ? ? covale4 covale both ? B LEU 13 C ? ? ? 1_555 B MK8 14 N ? ? B LEU 26 B MK8 27 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale5 covale both ? B MK8 14 C ? ? ? 1_555 B GLU 15 N ? ? B MK8 27 B GLU 28 1_555 ? ? ? ? ? ? ? 1.322 ? ? covale6 covale both ? B ASN 16 C ? ? ? 1_555 B NH2 17 N ? ? B ASN 29 B NH2 30 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale7 covale one ? D PHE 6 C ? ? ? 1_555 D 0EH 7 NAC ? ? D PHE 19 D 0EH 20 1_555 ? ? ? ? ? ? ? 1.429 ? ? covale8 covale both ? D 0EH 7 CAE ? ? ? 1_555 D ASP 8 N ? ? D 0EH 20 D ASP 21 1_555 ? ? ? ? ? ? ? 1.422 ? ? covale9 covale none ? D 0EH 7 CAT ? ? ? 1_555 D MK8 14 CE ? ? D 0EH 20 D MK8 27 1_555 ? ? ? ? ? ? ? 1.338 ? ? covale10 covale both ? D LEU 13 C ? ? ? 1_555 D MK8 14 N ? ? D LEU 26 D MK8 27 1_555 ? ? ? ? ? ? ? 1.327 ? ? covale11 covale both ? D MK8 14 C ? ? ? 1_555 D GLU 15 N ? ? D MK8 27 D GLU 28 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale12 covale both ? D ASN 16 C ? ? ? 1_555 D NH2 17 N ? ? D ASN 29 D NH2 30 1_555 ? ? ? ? ? ? ? 1.328 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 3 ? AA2 ? 2 ? AA3 ? 3 ? AA4 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA2 1 2 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA4 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 41 ? THR A 42 ? PHE A 44 THR A 45 AA1 2 GLN A 20 ? PRO A 23 ? GLN A 23 PRO A 26 AA1 3 LEU A 100 ? ILE A 102 ? LEU A 103 ILE A 105 AA2 1 ILE A 67 ? HIS A 69 ? ILE A 70 HIS A 72 AA2 2 SER A 83 ? SER A 85 ? SER A 86 SER A 88 AA3 1 PHE C 41 ? THR C 42 ? PHE C 44 THR C 45 AA3 2 GLN C 20 ? PRO C 23 ? GLN C 23 PRO C 26 AA3 3 LEU C 100 ? ILE C 102 ? LEU C 103 ILE C 105 AA4 1 ILE C 67 ? HIS C 69 ? ILE C 70 HIS C 72 AA4 2 SER C 83 ? SER C 85 ? SER C 86 SER C 88 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O PHE A 41 ? O PHE A 44 N VAL A 21 ? N VAL A 24 AA1 2 3 N HIS A 22 ? N HIS A 25 O VAL A 101 ? O VAL A 104 AA2 1 2 N VAL A 68 ? N VAL A 71 O PHE A 84 ? O PHE A 87 AA3 1 2 O PHE C 41 ? O PHE C 44 N VAL C 21 ? N VAL C 24 AA3 2 3 N HIS C 22 ? N HIS C 25 O VAL C 101 ? O VAL C 104 AA4 1 2 N VAL C 68 ? N VAL C 71 O PHE C 84 ? O PHE C 87 # _atom_sites.entry_id 6V4H _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.014877 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.004460 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.032468 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.015163 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 HIS 1 4 ? ? ? A . n A 1 2 HIS 2 5 ? ? ? A . n A 1 3 HIS 3 6 ? ? ? A . n A 1 4 HIS 4 7 ? ? ? A . n A 1 5 HIS 5 8 ? ? ? A . n A 1 6 HIS 6 9 ? ? ? A . n A 1 7 ASP 7 10 ? ? ? A . n A 1 8 ASP 8 11 ? ? ? A . n A 1 9 ASP 9 12 ? ? ? A . n A 1 10 ASP 10 13 ? ? ? A . n A 1 11 LYS 11 14 ? ? ? A . n A 1 12 ARG 12 15 ? ? ? A . n A 1 13 THR 13 16 ? ? ? A . n A 1 14 LEU 14 17 17 LEU LEU A . n A 1 15 PRO 15 18 18 PRO PRO A . n A 1 16 GLY 16 19 19 GLY GLY A . n A 1 17 GLU 17 20 20 GLU GLU A . n A 1 18 GLY 18 21 21 GLY GLY A . n A 1 19 THR 19 22 22 THR THR A . n A 1 20 GLN 20 23 23 GLN GLN A . n A 1 21 VAL 21 24 24 VAL VAL A . n A 1 22 HIS 22 25 25 HIS HIS A . n A 1 23 PRO 23 26 26 PRO PRO A . n A 1 24 ARG 24 27 27 ARG ARG A . n A 1 25 ALA 25 28 28 ALA ALA A . n A 1 26 PRO 26 29 29 PRO PRO A . n A 1 27 LEU 27 30 30 LEU LEU A . n A 1 28 LEU 28 31 31 LEU LEU A . n A 1 29 GLN 29 32 32 GLN GLN A . n A 1 30 ILE 30 33 33 ILE ILE A . n A 1 31 LEU 31 34 34 LEU LEU A . n A 1 32 LYS 32 35 35 LYS LYS A . n A 1 33 VAL 33 36 36 VAL VAL A . n A 1 34 ALA 34 37 37 ALA ALA A . n A 1 35 GLY 35 38 38 GLY GLY A . n A 1 36 ALA 36 39 39 ALA ALA A . n A 1 37 GLN 37 40 40 GLN GLN A . n A 1 38 GLU 38 41 41 GLU GLU A . n A 1 39 GLU 39 42 42 GLU GLU A . n A 1 40 VAL 40 43 43 VAL VAL A . n A 1 41 PHE 41 44 44 PHE PHE A . n A 1 42 THR 42 45 45 THR THR A . n A 1 43 VAL 43 46 46 VAL VAL A . n A 1 44 LYS 44 47 47 LYS LYS A . n A 1 45 GLU 45 48 48 GLU GLU A . n A 1 46 VAL 46 49 49 VAL VAL A . n A 1 47 MET 47 50 50 MET MET A . n A 1 48 HIS 48 51 51 HIS HIS A . n A 1 49 TYR 49 52 52 TYR TYR A . n A 1 50 LEU 50 53 53 LEU LEU A . n A 1 51 GLY 51 54 54 GLY GLY A . n A 1 52 GLN 52 55 55 GLN GLN A . n A 1 53 TYR 53 56 56 TYR TYR A . n A 1 54 ILE 54 57 57 ILE ILE A . n A 1 55 MET 55 58 58 MET MET A . n A 1 56 MET 56 59 59 MET MET A . n A 1 57 LYS 57 60 60 LYS LYS A . n A 1 58 GLN 58 61 61 GLN GLN A . n A 1 59 LEU 59 62 62 LEU LEU A . n A 1 60 TYR 60 63 63 TYR TYR A . n A 1 61 ASP 61 64 64 ASP ASP A . n A 1 62 LYS 62 65 65 LYS LYS A . n A 1 63 GLN 63 66 66 GLN GLN A . n A 1 64 ARG 64 67 67 ARG ARG A . n A 1 65 GLN 65 68 68 GLN GLN A . n A 1 66 HIS 66 69 69 HIS HIS A . n A 1 67 ILE 67 70 70 ILE ILE A . n A 1 68 VAL 68 71 71 VAL VAL A . n A 1 69 HIS 69 72 72 HIS HIS A . n A 1 70 CYS 70 73 73 CYS CYS A . n A 1 71 HIS 71 74 74 HIS HIS A . n A 1 72 ASP 72 75 75 ASP ASP A . n A 1 73 ASP 73 76 76 ASP ASP A . n A 1 74 PRO 74 77 77 PRO PRO A . n A 1 75 LEU 75 78 78 LEU LEU A . n A 1 76 GLY 76 79 79 GLY GLY A . n A 1 77 GLU 77 80 80 GLU GLU A . n A 1 78 LEU 78 81 81 LEU LEU A . n A 1 79 LEU 79 82 82 LEU LEU A . n A 1 80 GLU 80 83 83 GLU GLU A . n A 1 81 VAL 81 84 84 VAL VAL A . n A 1 82 GLY 82 85 85 GLY GLY A . n A 1 83 SER 83 86 86 SER SER A . n A 1 84 PHE 84 87 87 PHE PHE A . n A 1 85 SER 85 88 88 SER SER A . n A 1 86 VAL 86 89 89 VAL VAL A . n A 1 87 LYS 87 90 90 LYS LYS A . n A 1 88 ASN 88 91 91 ASN ASN A . n A 1 89 PRO 89 92 92 PRO PRO A . n A 1 90 SER 90 93 93 SER SER A . n A 1 91 PRO 91 94 94 PRO PRO A . n A 1 92 LEU 92 95 95 LEU LEU A . n A 1 93 TYR 93 96 96 TYR TYR A . n A 1 94 GLU 94 97 97 GLU GLU A . n A 1 95 MET 95 98 98 MET MET A . n A 1 96 LEU 96 99 99 LEU LEU A . n A 1 97 LYS 97 100 100 LYS LYS A . n A 1 98 ARG 98 101 101 ARG ARG A . n A 1 99 ASN 99 102 102 ASN ASN A . n A 1 100 LEU 100 103 103 LEU LEU A . n A 1 101 VAL 101 104 104 VAL VAL A . n A 1 102 ILE 102 105 105 ILE ILE A . n A 1 103 LEU 103 106 106 LEU LEU A . n B 2 1 LEU 1 14 ? ? ? B . n B 2 2 SER 2 15 ? ? ? B . n B 2 3 GLN 3 16 16 GLN GLN B . n B 2 4 GLU 4 17 17 GLU GLU B . n B 2 5 THR 5 18 18 THR THR B . n B 2 6 PHE 6 19 19 PHE PHE B . n B 2 7 0EH 7 20 20 0EH 0EH B . n B 2 8 ASP 8 21 21 ASP ASP B . n B 2 9 LEU 9 22 22 LEU LEU B . n B 2 10 TRP 10 23 23 TRP TRP B . n B 2 11 LYS 11 24 24 LYS LYS B . n B 2 12 LEU 12 25 25 LEU LEU B . n B 2 13 LEU 13 26 26 LEU LEU B . n B 2 14 MK8 14 27 27 MK8 MK8 B . n B 2 15 GLU 15 28 28 GLU GLU B . n B 2 16 ASN 16 29 29 ASN ASN B . n B 2 17 NH2 17 30 30 NH2 NH2 B . n C 1 1 HIS 1 4 ? ? ? C . n C 1 2 HIS 2 5 ? ? ? C . n C 1 3 HIS 3 6 ? ? ? C . n C 1 4 HIS 4 7 ? ? ? C . n C 1 5 HIS 5 8 ? ? ? C . n C 1 6 HIS 6 9 ? ? ? C . n C 1 7 ASP 7 10 ? ? ? C . n C 1 8 ASP 8 11 ? ? ? C . n C 1 9 ASP 9 12 ? ? ? C . n C 1 10 ASP 10 13 ? ? ? C . n C 1 11 LYS 11 14 ? ? ? C . n C 1 12 ARG 12 15 ? ? ? C . n C 1 13 THR 13 16 ? ? ? C . n C 1 14 LEU 14 17 17 LEU LEU C . n C 1 15 PRO 15 18 18 PRO PRO C . n C 1 16 GLY 16 19 19 GLY GLY C . n C 1 17 GLU 17 20 20 GLU GLU C . n C 1 18 GLY 18 21 21 GLY GLY C . n C 1 19 THR 19 22 22 THR THR C . n C 1 20 GLN 20 23 23 GLN GLN C . n C 1 21 VAL 21 24 24 VAL VAL C . n C 1 22 HIS 22 25 25 HIS HIS C . n C 1 23 PRO 23 26 26 PRO PRO C . n C 1 24 ARG 24 27 27 ARG ARG C . n C 1 25 ALA 25 28 28 ALA ALA C . n C 1 26 PRO 26 29 29 PRO PRO C . n C 1 27 LEU 27 30 30 LEU LEU C . n C 1 28 LEU 28 31 31 LEU LEU C . n C 1 29 GLN 29 32 32 GLN GLN C . n C 1 30 ILE 30 33 33 ILE ILE C . n C 1 31 LEU 31 34 34 LEU LEU C . n C 1 32 LYS 32 35 35 LYS LYS C . n C 1 33 VAL 33 36 36 VAL VAL C . n C 1 34 ALA 34 37 37 ALA ALA C . n C 1 35 GLY 35 38 38 GLY GLY C . n C 1 36 ALA 36 39 39 ALA ALA C . n C 1 37 GLN 37 40 40 GLN GLN C . n C 1 38 GLU 38 41 41 GLU GLU C . n C 1 39 GLU 39 42 42 GLU GLU C . n C 1 40 VAL 40 43 43 VAL VAL C . n C 1 41 PHE 41 44 44 PHE PHE C . n C 1 42 THR 42 45 45 THR THR C . n C 1 43 VAL 43 46 46 VAL VAL C . n C 1 44 LYS 44 47 47 LYS LYS C . n C 1 45 GLU 45 48 48 GLU GLU C . n C 1 46 VAL 46 49 49 VAL VAL C . n C 1 47 MET 47 50 50 MET MET C . n C 1 48 HIS 48 51 51 HIS HIS C . n C 1 49 TYR 49 52 52 TYR TYR C . n C 1 50 LEU 50 53 53 LEU LEU C . n C 1 51 GLY 51 54 54 GLY GLY C . n C 1 52 GLN 52 55 55 GLN GLN C . n C 1 53 TYR 53 56 56 TYR TYR C . n C 1 54 ILE 54 57 57 ILE ILE C . n C 1 55 MET 55 58 58 MET MET C . n C 1 56 MET 56 59 59 MET MET C . n C 1 57 LYS 57 60 60 LYS LYS C . n C 1 58 GLN 58 61 61 GLN GLN C . n C 1 59 LEU 59 62 62 LEU LEU C . n C 1 60 TYR 60 63 63 TYR TYR C . n C 1 61 ASP 61 64 64 ASP ASP C . n C 1 62 LYS 62 65 65 LYS LYS C . n C 1 63 GLN 63 66 66 GLN GLN C . n C 1 64 ARG 64 67 67 ARG ARG C . n C 1 65 GLN 65 68 68 GLN GLN C . n C 1 66 HIS 66 69 69 HIS HIS C . n C 1 67 ILE 67 70 70 ILE ILE C . n C 1 68 VAL 68 71 71 VAL VAL C . n C 1 69 HIS 69 72 72 HIS HIS C . n C 1 70 CYS 70 73 73 CYS CYS C . n C 1 71 HIS 71 74 74 HIS HIS C . n C 1 72 ASP 72 75 75 ASP ASP C . n C 1 73 ASP 73 76 76 ASP ASP C . n C 1 74 PRO 74 77 77 PRO PRO C . n C 1 75 LEU 75 78 78 LEU LEU C . n C 1 76 GLY 76 79 79 GLY GLY C . n C 1 77 GLU 77 80 80 GLU GLU C . n C 1 78 LEU 78 81 81 LEU LEU C . n C 1 79 LEU 79 82 82 LEU LEU C . n C 1 80 GLU 80 83 83 GLU GLU C . n C 1 81 VAL 81 84 84 VAL VAL C . n C 1 82 GLY 82 85 85 GLY GLY C . n C 1 83 SER 83 86 86 SER SER C . n C 1 84 PHE 84 87 87 PHE PHE C . n C 1 85 SER 85 88 88 SER SER C . n C 1 86 VAL 86 89 89 VAL VAL C . n C 1 87 LYS 87 90 90 LYS LYS C . n C 1 88 ASN 88 91 91 ASN ASN C . n C 1 89 PRO 89 92 92 PRO PRO C . n C 1 90 SER 90 93 93 SER SER C . n C 1 91 PRO 91 94 94 PRO PRO C . n C 1 92 LEU 92 95 95 LEU LEU C . n C 1 93 TYR 93 96 96 TYR TYR C . n C 1 94 GLU 94 97 97 GLU GLU C . n C 1 95 MET 95 98 98 MET MET C . n C 1 96 LEU 96 99 99 LEU LEU C . n C 1 97 LYS 97 100 100 LYS LYS C . n C 1 98 ARG 98 101 101 ARG ARG C . n C 1 99 ASN 99 102 102 ASN ASN C . n C 1 100 LEU 100 103 103 LEU LEU C . n C 1 101 VAL 101 104 104 VAL VAL C . n C 1 102 ILE 102 105 105 ILE ILE C . n C 1 103 LEU 103 106 106 LEU LEU C . n D 2 1 LEU 1 14 ? ? ? D . n D 2 2 SER 2 15 ? ? ? D . n D 2 3 GLN 3 16 ? ? ? D . n D 2 4 GLU 4 17 17 GLU GLU D . n D 2 5 THR 5 18 18 THR THR D . n D 2 6 PHE 6 19 19 PHE PHE D . n D 2 7 0EH 7 20 20 0EH 0EH D . n D 2 8 ASP 8 21 21 ASP ASP D . n D 2 9 LEU 9 22 22 LEU LEU D . n D 2 10 TRP 10 23 23 TRP TRP D . n D 2 11 LYS 11 24 24 LYS LYS D . n D 2 12 LEU 12 25 25 LEU LEU D . n D 2 13 LEU 13 26 26 LEU LEU D . n D 2 14 MK8 14 27 27 MK8 MK8 D . n D 2 15 GLU 15 28 28 GLU GLU D . n D 2 16 ASN 16 29 29 ASN ASN D . n D 2 17 NH2 17 30 30 NH2 NH2 D . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code E 3 HOH 1 201 32 HOH HOH A . E 3 HOH 2 202 123 HOH HOH A . E 3 HOH 3 203 119 HOH HOH A . E 3 HOH 4 204 48 HOH HOH A . E 3 HOH 5 205 49 HOH HOH A . E 3 HOH 6 206 10 HOH HOH A . E 3 HOH 7 207 107 HOH HOH A . E 3 HOH 8 208 41 HOH HOH A . E 3 HOH 9 209 43 HOH HOH A . E 3 HOH 10 210 128 HOH HOH A . E 3 HOH 11 211 18 HOH HOH A . E 3 HOH 12 212 132 HOH HOH A . E 3 HOH 13 213 58 HOH HOH A . E 3 HOH 14 214 154 HOH HOH A . E 3 HOH 15 215 71 HOH HOH A . E 3 HOH 16 216 9 HOH HOH A . E 3 HOH 17 217 69 HOH HOH A . E 3 HOH 18 218 6 HOH HOH A . E 3 HOH 19 219 36 HOH HOH A . E 3 HOH 20 220 35 HOH HOH A . E 3 HOH 21 221 96 HOH HOH A . E 3 HOH 22 222 51 HOH HOH A . E 3 HOH 23 223 13 HOH HOH A . E 3 HOH 24 224 37 HOH HOH A . E 3 HOH 25 225 54 HOH HOH A . E 3 HOH 26 226 2 HOH HOH A . E 3 HOH 27 227 157 HOH HOH A . E 3 HOH 28 228 86 HOH HOH A . E 3 HOH 29 229 78 HOH HOH A . E 3 HOH 30 230 101 HOH HOH A . E 3 HOH 31 231 167 HOH HOH A . E 3 HOH 32 232 4 HOH HOH A . E 3 HOH 33 233 22 HOH HOH A . E 3 HOH 34 234 95 HOH HOH A . E 3 HOH 35 235 76 HOH HOH A . E 3 HOH 36 236 87 HOH HOH A . E 3 HOH 37 237 65 HOH HOH A . E 3 HOH 38 238 57 HOH HOH A . E 3 HOH 39 239 39 HOH HOH A . E 3 HOH 40 240 111 HOH HOH A . E 3 HOH 41 241 14 HOH HOH A . E 3 HOH 42 242 20 HOH HOH A . E 3 HOH 43 243 26 HOH HOH A . E 3 HOH 44 244 158 HOH HOH A . E 3 HOH 45 245 94 HOH HOH A . E 3 HOH 46 246 140 HOH HOH A . E 3 HOH 47 247 126 HOH HOH A . E 3 HOH 48 248 97 HOH HOH A . E 3 HOH 49 249 99 HOH HOH A . E 3 HOH 50 250 138 HOH HOH A . E 3 HOH 51 251 170 HOH HOH A . E 3 HOH 52 252 109 HOH HOH A . E 3 HOH 53 253 129 HOH HOH A . E 3 HOH 54 254 90 HOH HOH A . E 3 HOH 55 255 145 HOH HOH A . E 3 HOH 56 256 165 HOH HOH A . E 3 HOH 57 257 56 HOH HOH A . E 3 HOH 58 258 127 HOH HOH A . E 3 HOH 59 259 144 HOH HOH A . E 3 HOH 60 260 122 HOH HOH A . E 3 HOH 61 261 118 HOH HOH A . E 3 HOH 62 262 84 HOH HOH A . E 3 HOH 63 263 143 HOH HOH A . E 3 HOH 64 264 115 HOH HOH A . E 3 HOH 65 265 81 HOH HOH A . E 3 HOH 66 266 77 HOH HOH A . E 3 HOH 67 267 153 HOH HOH A . E 3 HOH 68 268 160 HOH HOH A . F 3 HOH 1 101 149 HOH HOH B . F 3 HOH 2 102 25 HOH HOH B . F 3 HOH 3 103 53 HOH HOH B . F 3 HOH 4 104 24 HOH HOH B . F 3 HOH 5 105 16 HOH HOH B . F 3 HOH 6 106 73 HOH HOH B . F 3 HOH 7 107 125 HOH HOH B . F 3 HOH 8 108 98 HOH HOH B . F 3 HOH 9 109 148 HOH HOH B . F 3 HOH 10 110 169 HOH HOH B . F 3 HOH 11 111 64 HOH HOH B . F 3 HOH 12 112 75 HOH HOH B . G 3 HOH 1 201 134 HOH HOH C . G 3 HOH 2 202 67 HOH HOH C . G 3 HOH 3 203 112 HOH HOH C . G 3 HOH 4 204 147 HOH HOH C . G 3 HOH 5 205 30 HOH HOH C . G 3 HOH 6 206 113 HOH HOH C . G 3 HOH 7 207 68 HOH HOH C . G 3 HOH 8 208 135 HOH HOH C . G 3 HOH 9 209 8 HOH HOH C . G 3 HOH 10 210 61 HOH HOH C . G 3 HOH 11 211 70 HOH HOH C . G 3 HOH 12 212 47 HOH HOH C . G 3 HOH 13 213 44 HOH HOH C . G 3 HOH 14 214 34 HOH HOH C . G 3 HOH 15 215 45 HOH HOH C . G 3 HOH 16 216 3 HOH HOH C . G 3 HOH 17 217 102 HOH HOH C . G 3 HOH 18 218 66 HOH HOH C . G 3 HOH 19 219 19 HOH HOH C . G 3 HOH 20 220 7 HOH HOH C . G 3 HOH 21 221 141 HOH HOH C . G 3 HOH 22 222 159 HOH HOH C . G 3 HOH 23 223 31 HOH HOH C . G 3 HOH 24 224 62 HOH HOH C . G 3 HOH 25 225 121 HOH HOH C . G 3 HOH 26 226 83 HOH HOH C . G 3 HOH 27 227 93 HOH HOH C . G 3 HOH 28 228 42 HOH HOH C . G 3 HOH 29 229 29 HOH HOH C . G 3 HOH 30 230 82 HOH HOH C . G 3 HOH 31 231 91 HOH HOH C . G 3 HOH 32 232 5 HOH HOH C . G 3 HOH 33 233 12 HOH HOH C . G 3 HOH 34 234 172 HOH HOH C . G 3 HOH 35 235 88 HOH HOH C . G 3 HOH 36 236 40 HOH HOH C . G 3 HOH 37 237 1 HOH HOH C . G 3 HOH 38 238 162 HOH HOH C . G 3 HOH 39 239 46 HOH HOH C . G 3 HOH 40 240 124 HOH HOH C . G 3 HOH 41 241 52 HOH HOH C . G 3 HOH 42 242 79 HOH HOH C . G 3 HOH 43 243 17 HOH HOH C . G 3 HOH 44 244 50 HOH HOH C . G 3 HOH 45 245 63 HOH HOH C . G 3 HOH 46 246 23 HOH HOH C . G 3 HOH 47 247 11 HOH HOH C . G 3 HOH 48 248 55 HOH HOH C . G 3 HOH 49 249 27 HOH HOH C . G 3 HOH 50 250 137 HOH HOH C . G 3 HOH 51 251 155 HOH HOH C . G 3 HOH 52 252 168 HOH HOH C . G 3 HOH 53 253 146 HOH HOH C . G 3 HOH 54 254 171 HOH HOH C . G 3 HOH 55 255 110 HOH HOH C . G 3 HOH 56 256 105 HOH HOH C . G 3 HOH 57 257 163 HOH HOH C . G 3 HOH 58 258 136 HOH HOH C . G 3 HOH 59 259 104 HOH HOH C . G 3 HOH 60 260 166 HOH HOH C . G 3 HOH 61 261 139 HOH HOH C . G 3 HOH 62 262 164 HOH HOH C . G 3 HOH 63 263 130 HOH HOH C . G 3 HOH 64 264 142 HOH HOH C . G 3 HOH 65 265 89 HOH HOH C . G 3 HOH 66 266 161 HOH HOH C . G 3 HOH 67 267 59 HOH HOH C . G 3 HOH 68 268 114 HOH HOH C . G 3 HOH 69 269 120 HOH HOH C . G 3 HOH 70 270 131 HOH HOH C . G 3 HOH 71 271 116 HOH HOH C . G 3 HOH 72 272 117 HOH HOH C . G 3 HOH 73 273 108 HOH HOH C . G 3 HOH 74 274 92 HOH HOH C . H 3 HOH 1 101 150 HOH HOH D . H 3 HOH 2 102 38 HOH HOH D . H 3 HOH 3 103 85 HOH HOH D . H 3 HOH 4 104 15 HOH HOH D . H 3 HOH 5 105 33 HOH HOH D . H 3 HOH 6 106 21 HOH HOH D . H 3 HOH 7 107 28 HOH HOH D . H 3 HOH 8 108 156 HOH HOH D . H 3 HOH 9 109 74 HOH HOH D . H 3 HOH 10 110 100 HOH HOH D . H 3 HOH 11 111 106 HOH HOH D . H 3 HOH 12 112 103 HOH HOH D . H 3 HOH 13 113 72 HOH HOH D . H 3 HOH 14 114 80 HOH HOH D . H 3 HOH 15 115 151 HOH HOH D . H 3 HOH 16 116 133 HOH HOH D . H 3 HOH 17 117 60 HOH HOH D . H 3 HOH 18 118 152 HOH HOH D . # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_and_software_defined_assembly PISA dimeric 2 2 author_and_software_defined_assembly PISA dimeric 2 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B,E,F 2 1 C,D,G,H # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1240 ? 1 MORE -9 ? 1 'SSA (A^2)' 5850 ? 2 'ABSA (A^2)' 1230 ? 2 MORE -9 ? 2 'SSA (A^2)' 5690 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-04-22 2 'Structure model' 1 1 2021-05-05 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.journal_volume' 7 2 'Structure model' '_citation.page_first' 8 2 'Structure model' '_citation.page_last' 9 2 'Structure model' '_citation.pdbx_database_id_DOI' 10 2 'Structure model' '_citation.pdbx_database_id_PubMed' 11 2 'Structure model' '_citation.title' 12 2 'Structure model' '_citation.year' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? xia2 ? ? ? . 2 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.14_3260 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _pdbx_entry_details.entry_id 6V4H _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A HOH 255 ? ? O A HOH 259 ? ? 1.98 2 1 OD2 B ASP 21 ? ? O B HOH 101 ? ? 2.00 3 1 N D GLU 17 ? ? O D HOH 101 ? ? 2.06 4 1 O C HOH 235 ? ? O C HOH 258 ? ? 2.07 5 1 O A HOH 244 ? ? O A HOH 249 ? ? 2.13 6 1 O C HOH 234 ? ? O C HOH 260 ? ? 2.15 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 C _pdbx_validate_symm_contact.auth_comp_id_1 HOH _pdbx_validate_symm_contact.auth_seq_id_1 251 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 C _pdbx_validate_symm_contact.auth_comp_id_2 HOH _pdbx_validate_symm_contact.auth_seq_id_2 264 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 1_565 _pdbx_validate_symm_contact.dist 1.84 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 20 ? CG ? A GLU 17 CG 2 1 Y 1 A GLU 20 ? CD ? A GLU 17 CD 3 1 Y 1 A GLU 20 ? OE1 ? A GLU 17 OE1 4 1 Y 1 A GLU 20 ? OE2 ? A GLU 17 OE2 5 1 Y 1 B GLN 16 ? CG ? B GLN 3 CG 6 1 Y 1 B GLN 16 ? CD ? B GLN 3 CD 7 1 Y 1 B GLN 16 ? OE1 ? B GLN 3 OE1 8 1 Y 1 B GLN 16 ? NE2 ? B GLN 3 NE2 9 1 Y 1 C GLU 20 ? CG ? C GLU 17 CG 10 1 Y 1 C GLU 20 ? CD ? C GLU 17 CD 11 1 Y 1 C GLU 20 ? OE1 ? C GLU 17 OE1 12 1 Y 1 C GLU 20 ? OE2 ? C GLU 17 OE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A HIS 4 ? A HIS 1 2 1 Y 1 A HIS 5 ? A HIS 2 3 1 Y 1 A HIS 6 ? A HIS 3 4 1 Y 1 A HIS 7 ? A HIS 4 5 1 Y 1 A HIS 8 ? A HIS 5 6 1 Y 1 A HIS 9 ? A HIS 6 7 1 Y 1 A ASP 10 ? A ASP 7 8 1 Y 1 A ASP 11 ? A ASP 8 9 1 Y 1 A ASP 12 ? A ASP 9 10 1 Y 1 A ASP 13 ? A ASP 10 11 1 Y 1 A LYS 14 ? A LYS 11 12 1 Y 1 A ARG 15 ? A ARG 12 13 1 Y 1 A THR 16 ? A THR 13 14 1 Y 1 B LEU 14 ? B LEU 1 15 1 Y 1 B SER 15 ? B SER 2 16 1 Y 1 C HIS 4 ? C HIS 1 17 1 Y 1 C HIS 5 ? C HIS 2 18 1 Y 1 C HIS 6 ? C HIS 3 19 1 Y 1 C HIS 7 ? C HIS 4 20 1 Y 1 C HIS 8 ? C HIS 5 21 1 Y 1 C HIS 9 ? C HIS 6 22 1 Y 1 C ASP 10 ? C ASP 7 23 1 Y 1 C ASP 11 ? C ASP 8 24 1 Y 1 C ASP 12 ? C ASP 9 25 1 Y 1 C ASP 13 ? C ASP 10 26 1 Y 1 C LYS 14 ? C LYS 11 27 1 Y 1 C ARG 15 ? C ARG 12 28 1 Y 1 C THR 16 ? C THR 13 29 1 Y 1 D LEU 14 ? D LEU 1 30 1 Y 1 D SER 15 ? D SER 2 31 1 Y 1 D GLN 16 ? D GLN 3 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Cancer Institute (NIH/NCI)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_instance_feature.ordinal _pdbx_entity_instance_feature.comp_id _pdbx_entity_instance_feature.asym_id _pdbx_entity_instance_feature.seq_num _pdbx_entity_instance_feature.auth_comp_id _pdbx_entity_instance_feature.auth_asym_id _pdbx_entity_instance_feature.auth_seq_num _pdbx_entity_instance_feature.feature_type _pdbx_entity_instance_feature.details 1 0EH ? ? 0EH ? ? 'SUBJECT OF INVESTIGATION' ? 2 MK8 ? ? MK8 ? ? 'SUBJECT OF INVESTIGATION' ? # _pdbx_entity_nonpoly.entity_id 3 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #