data_6VAS # _entry.id 6VAS # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.381 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6VAS pdb_00006vas 10.2210/pdb6vas/pdb WWPDB D_1000246089 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6VAS _pdbx_database_status.recvd_initial_deposition_date 2019-12-17 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Outlaw, V.K.' 1 0000-0001-7054-4204 'Gellman, S.H.' 2 0000-0001-5617-0058 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Acs Infect Dis.' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2373-8227 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 6 _citation.language ? _citation.page_first 2017 _citation.page_last 2022 _citation.title 'Effects of Single alpha-to-beta Residue Replacements on Recognition of an Extended Segment in a Viral Fusion Protein.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acsinfecdis.0c00385 _citation.pdbx_database_id_PubMed 32692914 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Outlaw, V.K.' 1 0000-0001-7054-4204 primary 'Kreitler, D.F.' 2 ? primary 'Stelitano, D.' 3 ? primary 'Porotto, M.' 4 ? primary 'Moscona, A.' 5 ? primary 'Gellman, S.H.' 6 0000-0001-5617-0058 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 6VAS _cell.details ? _cell.formula_units_Z ? _cell.length_a 50.630 _cell.length_a_esd ? _cell.length_b 50.630 _cell.length_b_esd ? _cell.length_c 76.050 _cell.length_c_esd ? _cell.volume 168828.478 _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6VAS _symmetry.cell_setting ? _symmetry.Int_Tables_number 150 _symmetry.space_group_name_Hall ;P 3 2" ; _symmetry.space_group_name_H-M 'P 3 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer syn 'Fusion glycoprotein F0' 5656.473 2 ? ? ? ? 2 polymer syn 'Fusion glycoprotein F0' 4208.922 2 ? 'I454(beta-3-homoisoleucine), E459V, A463I, D466Q, Q479K, K480I' ? ? 3 water nat water 18.015 43 ? ? ? ? # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no yes '(ACE)QARSDIEKLKEAIRDTNKAVQSVQSSIGNLIVAIKSVQDYVNKEIVPSIAR(NH2)' XQARSDIEKLKEAIRDTNKAVQSVQSSIGNLIVAIKSVQDYVNKEIVPSIARX A,C ? 2 'polypeptide(L)' no yes '(ACE)VALDP(BIL)DISIVLNKIKSQLEESKEWIRRSNKILDSI(NH2)' XVALDPXDISIVLNKIKSQLEESKEWIRRSNKILDSIX B,D ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ACE n 1 2 GLN n 1 3 ALA n 1 4 ARG n 1 5 SER n 1 6 ASP n 1 7 ILE n 1 8 GLU n 1 9 LYS n 1 10 LEU n 1 11 LYS n 1 12 GLU n 1 13 ALA n 1 14 ILE n 1 15 ARG n 1 16 ASP n 1 17 THR n 1 18 ASN n 1 19 LYS n 1 20 ALA n 1 21 VAL n 1 22 GLN n 1 23 SER n 1 24 VAL n 1 25 GLN n 1 26 SER n 1 27 SER n 1 28 ILE n 1 29 GLY n 1 30 ASN n 1 31 LEU n 1 32 ILE n 1 33 VAL n 1 34 ALA n 1 35 ILE n 1 36 LYS n 1 37 SER n 1 38 VAL n 1 39 GLN n 1 40 ASP n 1 41 TYR n 1 42 VAL n 1 43 ASN n 1 44 LYS n 1 45 GLU n 1 46 ILE n 1 47 VAL n 1 48 PRO n 1 49 SER n 1 50 ILE n 1 51 ALA n 1 52 ARG n 1 53 NH2 n 2 1 ACE n 2 2 VAL n 2 3 ALA n 2 4 LEU n 2 5 ASP n 2 6 PRO n 2 7 BIL n 2 8 ASP n 2 9 ILE n 2 10 SER n 2 11 ILE n 2 12 VAL n 2 13 LEU n 2 14 ASN n 2 15 LYS n 2 16 ILE n 2 17 LYS n 2 18 SER n 2 19 GLN n 2 20 LEU n 2 21 GLU n 2 22 GLU n 2 23 SER n 2 24 LYS n 2 25 GLU n 2 26 TRP n 2 27 ILE n 2 28 ARG n 2 29 ARG n 2 30 SER n 2 31 ASN n 2 32 LYS n 2 33 ILE n 2 34 LEU n 2 35 ASP n 2 36 SER n 2 37 ILE n 2 38 NH2 n # loop_ _pdbx_entity_src_syn.entity_id _pdbx_entity_src_syn.pdbx_src_id _pdbx_entity_src_syn.pdbx_alt_source_flag _pdbx_entity_src_syn.pdbx_beg_seq_num _pdbx_entity_src_syn.pdbx_end_seq_num _pdbx_entity_src_syn.organism_scientific _pdbx_entity_src_syn.organism_common_name _pdbx_entity_src_syn.ncbi_taxonomy_id _pdbx_entity_src_syn.details 1 1 sample 1 53 'Human parainfluenza 3 virus (strain Wash/47885/57)' HPIV-3 11217 ? 2 1 sample 1 38 'Human parainfluenza 3 virus (strain Wash/47885/57)' HPIV-3 11217 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP FUS_PI3H4 P06828 ? 1 QARSDIEKLKEAIRDTNKAVQSVQSSIGNLIVAIKSVQDYVNKEIVPSIAR 139 2 UNP FUS_PI3H4 P06828 ? 2 VALDPIDISIELNKAKSDLEESKEWIRRSNQKLDSI 449 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 6VAS A 2 ? 52 ? P06828 139 ? 189 ? 139 189 2 2 6VAS B 2 ? 37 ? P06828 449 ? 484 ? 449 484 3 1 6VAS C 2 ? 52 ? P06828 139 ? 189 ? 139 189 4 2 6VAS D 2 ? 37 ? P06828 449 ? 484 ? 449 484 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6VAS ACE A 1 ? UNP P06828 ? ? acetylation 138 1 1 6VAS NH2 A 53 ? UNP P06828 ? ? amidation 190 2 2 6VAS ACE B 1 ? UNP P06828 ? ? acetylation 448 3 2 6VAS BIL B 7 ? UNP P06828 ILE 454 'engineered mutation' 454 4 2 6VAS VAL B 12 ? UNP P06828 GLU 459 'engineered mutation' 459 5 2 6VAS ILE B 16 ? UNP P06828 ALA 463 'engineered mutation' 463 6 2 6VAS GLN B 19 ? UNP P06828 ASP 466 'engineered mutation' 466 7 2 6VAS LYS B 32 ? UNP P06828 GLN 479 'engineered mutation' 479 8 2 6VAS ILE B 33 ? UNP P06828 LYS 480 'engineered mutation' 480 9 2 6VAS NH2 B 38 ? UNP P06828 ? ? amidation 485 10 3 6VAS ACE C 1 ? UNP P06828 ? ? acetylation 138 11 3 6VAS NH2 C 53 ? UNP P06828 ? ? amidation 190 12 4 6VAS ACE D 1 ? UNP P06828 ? ? acetylation 448 13 4 6VAS BIL D 7 ? UNP P06828 ILE 454 'engineered mutation' 454 14 4 6VAS VAL D 12 ? UNP P06828 GLU 459 'engineered mutation' 459 15 4 6VAS ILE D 16 ? UNP P06828 ALA 463 'engineered mutation' 463 16 4 6VAS GLN D 19 ? UNP P06828 ASP 466 'engineered mutation' 466 17 4 6VAS LYS D 32 ? UNP P06828 GLN 479 'engineered mutation' 479 18 4 6VAS ILE D 33 ? UNP P06828 LYS 480 'engineered mutation' 480 19 4 6VAS NH2 D 38 ? UNP P06828 ? ? amidation 485 20 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ACE non-polymer . 'ACETYL GROUP' ? 'C2 H4 O' 44.053 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 BIL 'L-peptide linking' . '(3R,4S)-3-amino-4-methylhexanoic acid' '(R,S)-beta-3-homoisoleucine' 'C7 H15 N O2' 145.200 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 NH2 non-polymer . 'AMINO GROUP' ? 'H2 N' 16.023 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6VAS _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.43 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 13.75 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;30 mM sodium nitrate, 30 mM dibasic sodium phosphate, 30 mM ammonium sulfate, 100 mM imidazole/MES monohydrate (pH 6.5), 12.5% PEG1000, 12.5% PEG3350, 12.5% 2-methyl-2,4-pentanediol ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'MARMOSAIC 300 mm CCD' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2019-08-02 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97856 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 21-ID-G' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97856 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 21-ID-G _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 22.87 _reflns.entry_id 6VAS _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.49 _reflns.d_resolution_low 28.73 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 18936 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.65 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 21.1 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value 0.105 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 15.96 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.108 _reflns.pdbx_Rpim_I_all 0.0238 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.49 _reflns_shell.d_res_low 1.543 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.63 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1814 _reflns_shell.percent_possible_all 98.53 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 21.7 _reflns_shell.pdbx_Rsym_value 2.045 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 2.094 _reflns_shell.pdbx_Rpim_I_all 0.4476 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.682 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 41.61 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6VAS _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.49 _refine.ls_d_res_low 28.73 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 18929 _refine.ls_number_reflns_R_free 1886 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.65 _refine.ls_percent_reflns_R_free 9.96 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2464 _refine.ls_R_factor_R_free 0.2621 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2448 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.36 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 6NRO _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 26.5046 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.1972 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.49 _refine_hist.d_res_low 28.73 _refine_hist.number_atoms_solvent 43 _refine_hist.number_atoms_total 985 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 942 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0028 ? 943 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.4548 ? 1262 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0310 ? 154 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0014 ? 159 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 18.7498 ? 366 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.49 1.53 . . 136 1242 98.01 . . . 0.3499 . 0.3391 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.53 1.58 . . 143 1300 100.00 . . . 0.3258 . 0.3150 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.58 1.63 . . 145 1294 100.00 . . . 0.2899 . 0.3151 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.63 1.68 . . 142 1298 100.00 . . . 0.3197 . 0.2873 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.68 1.75 . . 145 1298 100.00 . . . 0.3202 . 0.2999 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.75 1.83 . . 144 1285 100.00 . . . 0.2735 . 0.3033 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.83 1.93 . . 142 1298 100.00 . . . 0.2683 . 0.2651 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.93 2.05 . . 143 1314 99.93 . . . 0.3013 . 0.2596 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.05 2.21 . . 141 1317 100.00 . . . 0.2365 . 0.2458 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.21 2.43 . . 148 1321 100.00 . . . 0.2591 . 0.2189 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.43 2.78 . . 153 1326 99.93 . . . 0.2241 . 0.2155 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.78 3.50 . . 144 1349 100.00 . . . 0.2298 . 0.2125 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.50 28.73 . . 160 1401 97.99 . . . 0.2796 . 0.2532 . . . . . . . . . . . # _struct.entry_id 6VAS _struct.title ;Assembly of VIQKI I454(beta-L-homoisoleucine)with human parainfluenza virus type 3 (HPIV3) fusion glycoprotein N-terminal heptad repeat domain ; _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6VAS _struct_keywords.text 'Fusion glycoprotein, six-helix bundle, foldamer, VIRAL PROTEIN' _struct_keywords.pdbx_keywords 'VIRAL PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 1 ? D N N 2 ? E N N 3 ? F N N 3 ? G N N 3 ? H N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLN A 2 ? GLU A 45 ? GLN A 139 GLU A 182 1 ? 44 HELX_P HELX_P2 AA2 ILE B 9 ? SER B 36 ? ILE B 456 SER B 483 1 ? 28 HELX_P HELX_P3 AA3 ASP C 6 ? ILE C 28 ? ASP C 143 ILE C 165 1 ? 23 HELX_P HELX_P4 AA4 LYS D 17 ? SER D 36 ? LYS D 464 SER D 483 1 ? 20 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? B ILE 37 C ? ? ? 1_555 B NH2 38 N ? ? B ILE 484 B NH2 485 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale2 covale both ? D ILE 37 C ? ? ? 1_555 D NH2 38 N ? ? D ILE 484 D NH2 485 1_555 ? ? ? ? ? ? ? 1.330 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _atom_sites.entry_id 6VAS _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.019751 _atom_sites.fract_transf_matrix[1][2] 0.011403 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.022807 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.013149 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? H ? ? 0.51345 0.48472 ? ? 24.73122 6.32584 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ACE 1 138 ? ? ? A . n A 1 2 GLN 2 139 139 GLN GLN A . n A 1 3 ALA 3 140 140 ALA ALA A . n A 1 4 ARG 4 141 141 ARG ARG A . n A 1 5 SER 5 142 142 SER SER A . n A 1 6 ASP 6 143 143 ASP ASP A . n A 1 7 ILE 7 144 144 ILE ILE A . n A 1 8 GLU 8 145 145 GLU GLU A . n A 1 9 LYS 9 146 146 LYS LYS A . n A 1 10 LEU 10 147 147 LEU LEU A . n A 1 11 LYS 11 148 148 LYS LYS A . n A 1 12 GLU 12 149 149 GLU GLU A . n A 1 13 ALA 13 150 150 ALA ALA A . n A 1 14 ILE 14 151 151 ILE ILE A . n A 1 15 ARG 15 152 152 ARG ARG A . n A 1 16 ASP 16 153 153 ASP ASP A . n A 1 17 THR 17 154 154 THR THR A . n A 1 18 ASN 18 155 155 ASN ASN A . n A 1 19 LYS 19 156 156 LYS LYS A . n A 1 20 ALA 20 157 157 ALA ALA A . n A 1 21 VAL 21 158 158 VAL VAL A . n A 1 22 GLN 22 159 159 GLN GLN A . n A 1 23 SER 23 160 160 SER SER A . n A 1 24 VAL 24 161 161 VAL VAL A . n A 1 25 GLN 25 162 162 GLN GLN A . n A 1 26 SER 26 163 163 SER SER A . n A 1 27 SER 27 164 164 SER SER A . n A 1 28 ILE 28 165 165 ILE ILE A . n A 1 29 GLY 29 166 166 GLY GLY A . n A 1 30 ASN 30 167 167 ASN ASN A . n A 1 31 LEU 31 168 168 LEU LEU A . n A 1 32 ILE 32 169 169 ILE ILE A . n A 1 33 VAL 33 170 170 VAL VAL A . n A 1 34 ALA 34 171 171 ALA ALA A . n A 1 35 ILE 35 172 172 ILE ILE A . n A 1 36 LYS 36 173 173 LYS LYS A . n A 1 37 SER 37 174 174 SER SER A . n A 1 38 VAL 38 175 175 VAL VAL A . n A 1 39 GLN 39 176 176 GLN GLN A . n A 1 40 ASP 40 177 177 ASP ASP A . n A 1 41 TYR 41 178 178 TYR TYR A . n A 1 42 VAL 42 179 179 VAL VAL A . n A 1 43 ASN 43 180 180 ASN ASN A . n A 1 44 LYS 44 181 181 LYS LYS A . n A 1 45 GLU 45 182 182 GLU GLU A . n A 1 46 ILE 46 183 ? ? ? A . n A 1 47 VAL 47 184 ? ? ? A . n A 1 48 PRO 48 185 ? ? ? A . n A 1 49 SER 49 186 ? ? ? A . n A 1 50 ILE 50 187 ? ? ? A . n A 1 51 ALA 51 188 ? ? ? A . n A 1 52 ARG 52 189 ? ? ? A . n A 1 53 NH2 53 190 ? ? ? A . n B 2 1 ACE 1 448 ? ? ? B . n B 2 2 VAL 2 449 ? ? ? B . n B 2 3 ALA 3 450 ? ? ? B . n B 2 4 LEU 4 451 ? ? ? B . n B 2 5 ASP 5 452 ? ? ? B . n B 2 6 PRO 6 453 ? ? ? B . n B 2 7 BIL 7 454 ? ? ? B . n B 2 8 ASP 8 455 455 ASP ASP B . n B 2 9 ILE 9 456 456 ILE ILE B . n B 2 10 SER 10 457 457 SER SER B . n B 2 11 ILE 11 458 458 ILE ILE B . n B 2 12 VAL 12 459 459 VAL VAL B . n B 2 13 LEU 13 460 460 LEU LEU B . n B 2 14 ASN 14 461 461 ASN ASN B . n B 2 15 LYS 15 462 462 LYS LYS B . n B 2 16 ILE 16 463 463 ILE ILE B . n B 2 17 LYS 17 464 464 LYS LYS B . n B 2 18 SER 18 465 465 SER SER B . n B 2 19 GLN 19 466 466 GLN GLN B . n B 2 20 LEU 20 467 467 LEU LEU B . n B 2 21 GLU 21 468 468 GLU GLU B . n B 2 22 GLU 22 469 469 GLU GLU B . n B 2 23 SER 23 470 470 SER SER B . n B 2 24 LYS 24 471 471 LYS LYS B . n B 2 25 GLU 25 472 472 GLU GLU B . n B 2 26 TRP 26 473 473 TRP TRP B . n B 2 27 ILE 27 474 474 ILE ILE B . n B 2 28 ARG 28 475 475 ARG ARG B . n B 2 29 ARG 29 476 476 ARG ARG B . n B 2 30 SER 30 477 477 SER SER B . n B 2 31 ASN 31 478 478 ASN ASN B . n B 2 32 LYS 32 479 479 LYS LYS B . n B 2 33 ILE 33 480 480 ILE ILE B . n B 2 34 LEU 34 481 481 LEU LEU B . n B 2 35 ASP 35 482 482 ASP ASP B . n B 2 36 SER 36 483 483 SER SER B . n B 2 37 ILE 37 484 484 ILE ILE B . n B 2 38 NH2 38 485 485 NH2 NH2 B . n C 1 1 ACE 1 138 ? ? ? C . n C 1 2 GLN 2 139 ? ? ? C . n C 1 3 ALA 3 140 ? ? ? C . n C 1 4 ARG 4 141 ? ? ? C . n C 1 5 SER 5 142 142 SER SER C . n C 1 6 ASP 6 143 143 ASP ASP C . n C 1 7 ILE 7 144 144 ILE ILE C . n C 1 8 GLU 8 145 145 GLU GLU C . n C 1 9 LYS 9 146 146 LYS LYS C . n C 1 10 LEU 10 147 147 LEU LEU C . n C 1 11 LYS 11 148 148 LYS LYS C . n C 1 12 GLU 12 149 149 GLU GLU C . n C 1 13 ALA 13 150 150 ALA ALA C . n C 1 14 ILE 14 151 151 ILE ILE C . n C 1 15 ARG 15 152 152 ARG ARG C . n C 1 16 ASP 16 153 153 ASP ASP C . n C 1 17 THR 17 154 154 THR THR C . n C 1 18 ASN 18 155 155 ASN ASN C . n C 1 19 LYS 19 156 156 LYS LYS C . n C 1 20 ALA 20 157 157 ALA ALA C . n C 1 21 VAL 21 158 158 VAL VAL C . n C 1 22 GLN 22 159 159 GLN GLN C . n C 1 23 SER 23 160 160 SER SER C . n C 1 24 VAL 24 161 161 VAL VAL C . n C 1 25 GLN 25 162 162 GLN GLN C . n C 1 26 SER 26 163 163 SER SER C . n C 1 27 SER 27 164 164 SER SER C . n C 1 28 ILE 28 165 165 ILE ILE C . n C 1 29 GLY 29 166 ? ? ? C . n C 1 30 ASN 30 167 ? ? ? C . n C 1 31 LEU 31 168 ? ? ? C . n C 1 32 ILE 32 169 ? ? ? C . n C 1 33 VAL 33 170 ? ? ? C . n C 1 34 ALA 34 171 ? ? ? C . n C 1 35 ILE 35 172 ? ? ? C . n C 1 36 LYS 36 173 ? ? ? C . n C 1 37 SER 37 174 ? ? ? C . n C 1 38 VAL 38 175 ? ? ? C . n C 1 39 GLN 39 176 ? ? ? C . n C 1 40 ASP 40 177 ? ? ? C . n C 1 41 TYR 41 178 ? ? ? C . n C 1 42 VAL 42 179 ? ? ? C . n C 1 43 ASN 43 180 ? ? ? C . n C 1 44 LYS 44 181 ? ? ? C . n C 1 45 GLU 45 182 ? ? ? C . n C 1 46 ILE 46 183 ? ? ? C . n C 1 47 VAL 47 184 ? ? ? C . n C 1 48 PRO 48 185 ? ? ? C . n C 1 49 SER 49 186 ? ? ? C . n C 1 50 ILE 50 187 ? ? ? C . n C 1 51 ALA 51 188 ? ? ? C . n C 1 52 ARG 52 189 ? ? ? C . n C 1 53 NH2 53 190 ? ? ? C . n D 2 1 ACE 1 448 ? ? ? D . n D 2 2 VAL 2 449 ? ? ? D . n D 2 3 ALA 3 450 ? ? ? D . n D 2 4 LEU 4 451 ? ? ? D . n D 2 5 ASP 5 452 ? ? ? D . n D 2 6 PRO 6 453 ? ? ? D . n D 2 7 BIL 7 454 ? ? ? D . n D 2 8 ASP 8 455 ? ? ? D . n D 2 9 ILE 9 456 ? ? ? D . n D 2 10 SER 10 457 ? ? ? D . n D 2 11 ILE 11 458 ? ? ? D . n D 2 12 VAL 12 459 ? ? ? D . n D 2 13 LEU 13 460 ? ? ? D . n D 2 14 ASN 14 461 ? ? ? D . n D 2 15 LYS 15 462 ? ? ? D . n D 2 16 ILE 16 463 463 ILE ILE D . n D 2 17 LYS 17 464 464 LYS LYS D . n D 2 18 SER 18 465 465 SER SER D . n D 2 19 GLN 19 466 466 GLN GLN D . n D 2 20 LEU 20 467 467 LEU LEU D . n D 2 21 GLU 21 468 468 GLU GLU D . n D 2 22 GLU 22 469 469 GLU GLU D . n D 2 23 SER 23 470 470 SER SER D . n D 2 24 LYS 24 471 471 LYS LYS D . n D 2 25 GLU 25 472 472 GLU GLU D . n D 2 26 TRP 26 473 473 TRP TRP D . n D 2 27 ILE 27 474 474 ILE ILE D . n D 2 28 ARG 28 475 475 ARG ARG D . n D 2 29 ARG 29 476 476 ARG ARG D . n D 2 30 SER 30 477 477 SER SER D . n D 2 31 ASN 31 478 478 ASN ASN D . n D 2 32 LYS 32 479 479 LYS LYS D . n D 2 33 ILE 33 480 480 ILE ILE D . n D 2 34 LEU 34 481 481 LEU LEU D . n D 2 35 ASP 35 482 482 ASP ASP D . n D 2 36 SER 36 483 483 SER SER D . n D 2 37 ILE 37 484 484 ILE ILE D . n D 2 38 NH2 38 485 485 NH2 NH2 D . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code E 3 HOH 1 201 10 HOH HOH A . E 3 HOH 2 202 23 HOH HOH A . E 3 HOH 3 203 22 HOH HOH A . E 3 HOH 4 204 1 HOH HOH A . E 3 HOH 5 205 19 HOH HOH A . E 3 HOH 6 206 7 HOH HOH A . E 3 HOH 7 207 18 HOH HOH A . E 3 HOH 8 208 42 HOH HOH A . E 3 HOH 9 209 21 HOH HOH A . E 3 HOH 10 210 52 HOH HOH A . E 3 HOH 11 211 28 HOH HOH A . F 3 HOH 1 501 12 HOH HOH B . F 3 HOH 2 502 17 HOH HOH B . F 3 HOH 3 503 31 HOH HOH B . F 3 HOH 4 504 4 HOH HOH B . F 3 HOH 5 505 16 HOH HOH B . F 3 HOH 6 506 20 HOH HOH B . F 3 HOH 7 507 11 HOH HOH B . F 3 HOH 8 508 14 HOH HOH B . F 3 HOH 9 509 2 HOH HOH B . F 3 HOH 10 510 5 HOH HOH B . F 3 HOH 11 511 49 HOH HOH B . F 3 HOH 12 512 13 HOH HOH B . F 3 HOH 13 513 8 HOH HOH B . F 3 HOH 14 514 25 HOH HOH B . F 3 HOH 15 515 35 HOH HOH B . F 3 HOH 16 516 47 HOH HOH B . F 3 HOH 17 517 38 HOH HOH B . F 3 HOH 18 518 15 HOH HOH B . F 3 HOH 19 519 24 HOH HOH B . F 3 HOH 20 520 48 HOH HOH B . G 3 HOH 1 201 29 HOH HOH C . G 3 HOH 2 202 26 HOH HOH C . G 3 HOH 3 203 6 HOH HOH C . G 3 HOH 4 204 44 HOH HOH C . G 3 HOH 5 205 50 HOH HOH C . G 3 HOH 6 206 51 HOH HOH C . G 3 HOH 7 207 39 HOH HOH C . G 3 HOH 8 208 37 HOH HOH C . H 3 HOH 1 501 43 HOH HOH D . H 3 HOH 2 502 45 HOH HOH D . H 3 HOH 3 503 34 HOH HOH D . H 3 HOH 4 504 27 HOH HOH D . # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_and_software_defined_assembly PISA hexameric 6 2 author_and_software_defined_assembly PISA hexameric 6 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1,2,4 A,B,E,F 2 1,3,5 C,D,G,H # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 12150 ? 1 MORE -90 ? 1 'SSA (A^2)' 10010 ? 2 'ABSA (A^2)' 7770 ? 2 MORE -54 ? 2 'SSA (A^2)' 6700 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_665 -y+1,x-y+1,z -0.5000000000 -0.8660254038 0.0000000000 25.3150000000 0.8660254038 -0.5000000000 0.0000000000 43.8468661936 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 2_555 -y,x-y,z -0.5000000000 -0.8660254038 0.0000000000 0.0000000000 0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 4 'crystal symmetry operation' 3_565 -x+y,-x+1,z -0.5000000000 0.8660254038 0.0000000000 -25.3150000000 -0.8660254038 -0.5000000000 0.0000000000 43.8468661936 0.0000000000 0.0000000000 1.0000000000 0.0000000000 5 'crystal symmetry operation' 3_555 -x+y,-x,z -0.5000000000 0.8660254038 0.0000000000 0.0000000000 -0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-10-21 2 'Structure model' 1 1 2023-10-11 3 'Structure model' 1 2 2023-11-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Refinement description' 4 3 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_initial_refinement_model 5 3 'Structure model' chem_comp_atom 6 3 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_chem_comp_atom.atom_id' 4 3 'Structure model' '_chem_comp_bond.atom_id_1' 5 3 'Structure model' '_chem_comp_bond.atom_id_2' # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -y,x-y,z 3 -x+y,-x,z 4 x-y,-y,-z 5 -x,-x+y,-z 6 y,x,-z # _pdbx_refine_tls.id 1 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x -2.64466390231 _pdbx_refine_tls.origin_y 17.8902543259 _pdbx_refine_tls.origin_z 33.9777944271 _pdbx_refine_tls.T[1][1] 0.15482393656 _pdbx_refine_tls.T[1][1]_esd ? _pdbx_refine_tls.T[1][2] -0.0133284593967 _pdbx_refine_tls.T[1][2]_esd ? _pdbx_refine_tls.T[1][3] -0.0046995702715 _pdbx_refine_tls.T[1][3]_esd ? _pdbx_refine_tls.T[2][2] 0.152849748257 _pdbx_refine_tls.T[2][2]_esd ? _pdbx_refine_tls.T[2][3] 0.0168054037364 _pdbx_refine_tls.T[2][3]_esd ? _pdbx_refine_tls.T[3][3] 0.183830381387 _pdbx_refine_tls.T[3][3]_esd ? _pdbx_refine_tls.L[1][1] 1.46446997115 _pdbx_refine_tls.L[1][1]_esd ? _pdbx_refine_tls.L[1][2] -0.0415154550847 _pdbx_refine_tls.L[1][2]_esd ? _pdbx_refine_tls.L[1][3] 0.00625266365156 _pdbx_refine_tls.L[1][3]_esd ? _pdbx_refine_tls.L[2][2] 2.2748419966 _pdbx_refine_tls.L[2][2]_esd ? _pdbx_refine_tls.L[2][3] 1.16973900029 _pdbx_refine_tls.L[2][3]_esd ? _pdbx_refine_tls.L[3][3] 2.66147625017 _pdbx_refine_tls.L[3][3]_esd ? _pdbx_refine_tls.S[1][1] -0.0475463987339 _pdbx_refine_tls.S[1][1]_esd ? _pdbx_refine_tls.S[1][2] 0.0778345097515 _pdbx_refine_tls.S[1][2]_esd ? _pdbx_refine_tls.S[1][3] -0.261521298978 _pdbx_refine_tls.S[1][3]_esd ? _pdbx_refine_tls.S[2][1] -0.173016572746 _pdbx_refine_tls.S[2][1]_esd ? _pdbx_refine_tls.S[2][2] 0.00962126149397 _pdbx_refine_tls.S[2][2]_esd ? _pdbx_refine_tls.S[2][3] -0.0141644687274 _pdbx_refine_tls.S[2][3]_esd ? _pdbx_refine_tls.S[3][1] 0.263517580287 _pdbx_refine_tls.S[3][1]_esd ? _pdbx_refine_tls.S[3][2] 0.121779451321 _pdbx_refine_tls.S[3][2]_esd ? _pdbx_refine_tls.S[3][3] 0.0419663242892 _pdbx_refine_tls.S[3][3]_esd ? # _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.beg_auth_asym_id ? _pdbx_refine_tls_group.beg_auth_seq_id ? _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id ? _pdbx_refine_tls_group.end_auth_seq_id ? _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details all # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.17.1_3660 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _pdbx_entry_details.entry_id 6VAS _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest N # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLN 139 ? CG ? A GLN 2 CG 2 1 Y 1 A GLN 139 ? CD ? A GLN 2 CD 3 1 Y 1 A GLN 139 ? OE1 ? A GLN 2 OE1 4 1 Y 1 A GLN 139 ? NE2 ? A GLN 2 NE2 5 1 Y 1 A LYS 181 ? CG ? A LYS 44 CG 6 1 Y 1 A LYS 181 ? CD ? A LYS 44 CD 7 1 Y 1 A LYS 181 ? CE ? A LYS 44 CE 8 1 Y 1 A LYS 181 ? NZ ? A LYS 44 NZ 9 1 Y 1 A GLU 182 ? CG ? A GLU 45 CG 10 1 Y 1 A GLU 182 ? CD ? A GLU 45 CD 11 1 Y 1 A GLU 182 ? OE1 ? A GLU 45 OE1 12 1 Y 1 A GLU 182 ? OE2 ? A GLU 45 OE2 13 1 Y 1 C ASP 143 ? CG ? C ASP 6 CG 14 1 Y 1 C ASP 143 ? OD1 ? C ASP 6 OD1 15 1 Y 1 C ASP 143 ? OD2 ? C ASP 6 OD2 16 1 Y 1 D ILE 463 ? CG1 ? D ILE 16 CG1 17 1 Y 1 D ILE 463 ? CG2 ? D ILE 16 CG2 18 1 Y 1 D ILE 463 ? CD1 ? D ILE 16 CD1 19 1 Y 1 D LYS 464 ? CG ? D LYS 17 CG 20 1 Y 1 D LYS 464 ? CD ? D LYS 17 CD 21 1 Y 1 D LYS 464 ? CE ? D LYS 17 CE 22 1 Y 1 D LYS 464 ? NZ ? D LYS 17 NZ 23 1 Y 1 D SER 465 ? OG ? D SER 18 OG # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ACE 138 ? A ACE 1 2 1 Y 1 A ILE 183 ? A ILE 46 3 1 Y 1 A VAL 184 ? A VAL 47 4 1 Y 1 A PRO 185 ? A PRO 48 5 1 Y 1 A SER 186 ? A SER 49 6 1 Y 1 A ILE 187 ? A ILE 50 7 1 Y 1 A ALA 188 ? A ALA 51 8 1 Y 1 A ARG 189 ? A ARG 52 9 1 Y 1 A NH2 190 ? A NH2 53 10 1 Y 1 B ACE 448 ? B ACE 1 11 1 Y 1 B VAL 449 ? B VAL 2 12 1 Y 1 B ALA 450 ? B ALA 3 13 1 Y 1 B LEU 451 ? B LEU 4 14 1 Y 1 B ASP 452 ? B ASP 5 15 1 Y 1 B PRO 453 ? B PRO 6 16 1 Y 1 B BIL 454 ? B BIL 7 17 1 Y 1 C ACE 138 ? C ACE 1 18 1 Y 1 C GLN 139 ? C GLN 2 19 1 Y 1 C ALA 140 ? C ALA 3 20 1 Y 1 C ARG 141 ? C ARG 4 21 1 Y 1 C GLY 166 ? C GLY 29 22 1 Y 1 C ASN 167 ? C ASN 30 23 1 Y 1 C LEU 168 ? C LEU 31 24 1 Y 1 C ILE 169 ? C ILE 32 25 1 Y 1 C VAL 170 ? C VAL 33 26 1 Y 1 C ALA 171 ? C ALA 34 27 1 Y 1 C ILE 172 ? C ILE 35 28 1 Y 1 C LYS 173 ? C LYS 36 29 1 Y 1 C SER 174 ? C SER 37 30 1 Y 1 C VAL 175 ? C VAL 38 31 1 Y 1 C GLN 176 ? C GLN 39 32 1 Y 1 C ASP 177 ? C ASP 40 33 1 Y 1 C TYR 178 ? C TYR 41 34 1 Y 1 C VAL 179 ? C VAL 42 35 1 Y 1 C ASN 180 ? C ASN 43 36 1 Y 1 C LYS 181 ? C LYS 44 37 1 Y 1 C GLU 182 ? C GLU 45 38 1 Y 1 C ILE 183 ? C ILE 46 39 1 Y 1 C VAL 184 ? C VAL 47 40 1 Y 1 C PRO 185 ? C PRO 48 41 1 Y 1 C SER 186 ? C SER 49 42 1 Y 1 C ILE 187 ? C ILE 50 43 1 Y 1 C ALA 188 ? C ALA 51 44 1 Y 1 C ARG 189 ? C ARG 52 45 1 Y 1 C NH2 190 ? C NH2 53 46 1 Y 1 D ACE 448 ? D ACE 1 47 1 Y 1 D VAL 449 ? D VAL 2 48 1 Y 1 D ALA 450 ? D ALA 3 49 1 Y 1 D LEU 451 ? D LEU 4 50 1 Y 1 D ASP 452 ? D ASP 5 51 1 Y 1 D PRO 453 ? D PRO 6 52 1 Y 1 D BIL 454 ? D BIL 7 53 1 Y 1 D ASP 455 ? D ASP 8 54 1 Y 1 D ILE 456 ? D ILE 9 55 1 Y 1 D SER 457 ? D SER 10 56 1 Y 1 D ILE 458 ? D ILE 11 57 1 Y 1 D VAL 459 ? D VAL 12 58 1 Y 1 D LEU 460 ? D LEU 13 59 1 Y 1 D ASN 461 ? D ASN 14 60 1 Y 1 D LYS 462 ? D LYS 15 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ACE C C N N 1 ACE O O N N 2 ACE CH3 C N N 3 ACE H H N N 4 ACE H1 H N N 5 ACE H2 H N N 6 ACE H3 H N N 7 ALA N N N N 8 ALA CA C N S 9 ALA C C N N 10 ALA O O N N 11 ALA CB C N N 12 ALA OXT O N N 13 ALA H H N N 14 ALA H2 H N N 15 ALA HA H N N 16 ALA HB1 H N N 17 ALA HB2 H N N 18 ALA HB3 H N N 19 ALA HXT H N N 20 ARG N N N N 21 ARG CA C N S 22 ARG C C N N 23 ARG O O N N 24 ARG CB C N N 25 ARG CG C N N 26 ARG CD C N N 27 ARG NE N N N 28 ARG CZ C N N 29 ARG NH1 N N N 30 ARG NH2 N N N 31 ARG OXT O N N 32 ARG H H N N 33 ARG H2 H N N 34 ARG HA H N N 35 ARG HB2 H N N 36 ARG HB3 H N N 37 ARG HG2 H N N 38 ARG HG3 H N N 39 ARG HD2 H N N 40 ARG HD3 H N N 41 ARG HE H N N 42 ARG HH11 H N N 43 ARG HH12 H N N 44 ARG HH21 H N N 45 ARG HH22 H N N 46 ARG HXT H N N 47 ASN N N N N 48 ASN CA C N S 49 ASN C C N N 50 ASN O O N N 51 ASN CB C N N 52 ASN CG C N N 53 ASN OD1 O N N 54 ASN ND2 N N N 55 ASN OXT O N N 56 ASN H H N N 57 ASN H2 H N N 58 ASN HA H N N 59 ASN HB2 H N N 60 ASN HB3 H N N 61 ASN HD21 H N N 62 ASN HD22 H N N 63 ASN HXT H N N 64 ASP N N N N 65 ASP CA C N S 66 ASP C C N N 67 ASP O O N N 68 ASP CB C N N 69 ASP CG C N N 70 ASP OD1 O N N 71 ASP OD2 O N N 72 ASP OXT O N N 73 ASP H H N N 74 ASP H2 H N N 75 ASP HA H N N 76 ASP HB2 H N N 77 ASP HB3 H N N 78 ASP HD2 H N N 79 ASP HXT H N N 80 BIL C C N N 81 BIL O O N N 82 BIL CA C N N 83 BIL CB C N R 84 BIL N N N N 85 BIL CG C N S 86 BIL CD2 C N N 87 BIL CD1 C N N 88 BIL CE1 C N N 89 BIL HA H N N 90 BIL HAA H N N 91 BIL HB H N N 92 BIL H H N N 93 BIL HG H N N 94 BIL H3D2 H N N 95 BIL H2D2 H N N 96 BIL H1D2 H N N 97 BIL H1D1 H N N 98 BIL H2D1 H N N 99 BIL H3E1 H N N 100 BIL H2E1 H N N 101 BIL H1E1 H N N 102 BIL OXT O N N 103 BIL H2 H N N 104 BIL HXT H N N 105 GLN N N N N 106 GLN CA C N S 107 GLN C C N N 108 GLN O O N N 109 GLN CB C N N 110 GLN CG C N N 111 GLN CD C N N 112 GLN OE1 O N N 113 GLN NE2 N N N 114 GLN OXT O N N 115 GLN H H N N 116 GLN H2 H N N 117 GLN HA H N N 118 GLN HB2 H N N 119 GLN HB3 H N N 120 GLN HG2 H N N 121 GLN HG3 H N N 122 GLN HE21 H N N 123 GLN HE22 H N N 124 GLN HXT H N N 125 GLU N N N N 126 GLU CA C N S 127 GLU C C N N 128 GLU O O N N 129 GLU CB C N N 130 GLU CG C N N 131 GLU CD C N N 132 GLU OE1 O N N 133 GLU OE2 O N N 134 GLU OXT O N N 135 GLU H H N N 136 GLU H2 H N N 137 GLU HA H N N 138 GLU HB2 H N N 139 GLU HB3 H N N 140 GLU HG2 H N N 141 GLU HG3 H N N 142 GLU HE2 H N N 143 GLU HXT H N N 144 GLY N N N N 145 GLY CA C N N 146 GLY C C N N 147 GLY O O N N 148 GLY OXT O N N 149 GLY H H N N 150 GLY H2 H N N 151 GLY HA2 H N N 152 GLY HA3 H N N 153 GLY HXT H N N 154 HOH O O N N 155 HOH H1 H N N 156 HOH H2 H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 NH2 N N N N 227 NH2 HN1 H N N 228 NH2 HN2 H N N 229 PRO N N N N 230 PRO CA C N S 231 PRO C C N N 232 PRO O O N N 233 PRO CB C N N 234 PRO CG C N N 235 PRO CD C N N 236 PRO OXT O N N 237 PRO H H N N 238 PRO HA H N N 239 PRO HB2 H N N 240 PRO HB3 H N N 241 PRO HG2 H N N 242 PRO HG3 H N N 243 PRO HD2 H N N 244 PRO HD3 H N N 245 PRO HXT H N N 246 SER N N N N 247 SER CA C N S 248 SER C C N N 249 SER O O N N 250 SER CB C N N 251 SER OG O N N 252 SER OXT O N N 253 SER H H N N 254 SER H2 H N N 255 SER HA H N N 256 SER HB2 H N N 257 SER HB3 H N N 258 SER HG H N N 259 SER HXT H N N 260 THR N N N N 261 THR CA C N S 262 THR C C N N 263 THR O O N N 264 THR CB C N R 265 THR OG1 O N N 266 THR CG2 C N N 267 THR OXT O N N 268 THR H H N N 269 THR H2 H N N 270 THR HA H N N 271 THR HB H N N 272 THR HG1 H N N 273 THR HG21 H N N 274 THR HG22 H N N 275 THR HG23 H N N 276 THR HXT H N N 277 TRP N N N N 278 TRP CA C N S 279 TRP C C N N 280 TRP O O N N 281 TRP CB C N N 282 TRP CG C Y N 283 TRP CD1 C Y N 284 TRP CD2 C Y N 285 TRP NE1 N Y N 286 TRP CE2 C Y N 287 TRP CE3 C Y N 288 TRP CZ2 C Y N 289 TRP CZ3 C Y N 290 TRP CH2 C Y N 291 TRP OXT O N N 292 TRP H H N N 293 TRP H2 H N N 294 TRP HA H N N 295 TRP HB2 H N N 296 TRP HB3 H N N 297 TRP HD1 H N N 298 TRP HE1 H N N 299 TRP HE3 H N N 300 TRP HZ2 H N N 301 TRP HZ3 H N N 302 TRP HH2 H N N 303 TRP HXT H N N 304 TYR N N N N 305 TYR CA C N S 306 TYR C C N N 307 TYR O O N N 308 TYR CB C N N 309 TYR CG C Y N 310 TYR CD1 C Y N 311 TYR CD2 C Y N 312 TYR CE1 C Y N 313 TYR CE2 C Y N 314 TYR CZ C Y N 315 TYR OH O N N 316 TYR OXT O N N 317 TYR H H N N 318 TYR H2 H N N 319 TYR HA H N N 320 TYR HB2 H N N 321 TYR HB3 H N N 322 TYR HD1 H N N 323 TYR HD2 H N N 324 TYR HE1 H N N 325 TYR HE2 H N N 326 TYR HH H N N 327 TYR HXT H N N 328 VAL N N N N 329 VAL CA C N S 330 VAL C C N N 331 VAL O O N N 332 VAL CB C N N 333 VAL CG1 C N N 334 VAL CG2 C N N 335 VAL OXT O N N 336 VAL H H N N 337 VAL H2 H N N 338 VAL HA H N N 339 VAL HB H N N 340 VAL HG11 H N N 341 VAL HG12 H N N 342 VAL HG13 H N N 343 VAL HG21 H N N 344 VAL HG22 H N N 345 VAL HG23 H N N 346 VAL HXT H N N 347 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ACE C O doub N N 1 ACE C CH3 sing N N 2 ACE C H sing N N 3 ACE CH3 H1 sing N N 4 ACE CH3 H2 sing N N 5 ACE CH3 H3 sing N N 6 ALA N CA sing N N 7 ALA N H sing N N 8 ALA N H2 sing N N 9 ALA CA C sing N N 10 ALA CA CB sing N N 11 ALA CA HA sing N N 12 ALA C O doub N N 13 ALA C OXT sing N N 14 ALA CB HB1 sing N N 15 ALA CB HB2 sing N N 16 ALA CB HB3 sing N N 17 ALA OXT HXT sing N N 18 ARG N CA sing N N 19 ARG N H sing N N 20 ARG N H2 sing N N 21 ARG CA C sing N N 22 ARG CA CB sing N N 23 ARG CA HA sing N N 24 ARG C O doub N N 25 ARG C OXT sing N N 26 ARG CB CG sing N N 27 ARG CB HB2 sing N N 28 ARG CB HB3 sing N N 29 ARG CG CD sing N N 30 ARG CG HG2 sing N N 31 ARG CG HG3 sing N N 32 ARG CD NE sing N N 33 ARG CD HD2 sing N N 34 ARG CD HD3 sing N N 35 ARG NE CZ sing N N 36 ARG NE HE sing N N 37 ARG CZ NH1 sing N N 38 ARG CZ NH2 doub N N 39 ARG NH1 HH11 sing N N 40 ARG NH1 HH12 sing N N 41 ARG NH2 HH21 sing N N 42 ARG NH2 HH22 sing N N 43 ARG OXT HXT sing N N 44 ASN N CA sing N N 45 ASN N H sing N N 46 ASN N H2 sing N N 47 ASN CA C sing N N 48 ASN CA CB sing N N 49 ASN CA HA sing N N 50 ASN C O doub N N 51 ASN C OXT sing N N 52 ASN CB CG sing N N 53 ASN CB HB2 sing N N 54 ASN CB HB3 sing N N 55 ASN CG OD1 doub N N 56 ASN CG ND2 sing N N 57 ASN ND2 HD21 sing N N 58 ASN ND2 HD22 sing N N 59 ASN OXT HXT sing N N 60 ASP N CA sing N N 61 ASP N H sing N N 62 ASP N H2 sing N N 63 ASP CA C sing N N 64 ASP CA CB sing N N 65 ASP CA HA sing N N 66 ASP C O doub N N 67 ASP C OXT sing N N 68 ASP CB CG sing N N 69 ASP CB HB2 sing N N 70 ASP CB HB3 sing N N 71 ASP CG OD1 doub N N 72 ASP CG OD2 sing N N 73 ASP OD2 HD2 sing N N 74 ASP OXT HXT sing N N 75 BIL C O doub N N 76 BIL C OXT sing N N 77 BIL CA C sing N N 78 BIL CA CB sing N N 79 BIL CA HA sing N N 80 BIL CB HB sing N N 81 BIL N CB sing N N 82 BIL N H2 sing N N 83 BIL CG CB sing N N 84 BIL CG CD1 sing N N 85 BIL CG CD2 sing N N 86 BIL CD2 H1D2 sing N N 87 BIL CD2 H3D2 sing N N 88 BIL CD1 CE1 sing N N 89 BIL CE1 H2E1 sing N N 90 BIL CE1 H3E1 sing N N 91 BIL HAA CA sing N N 92 BIL H N sing N N 93 BIL HG CG sing N N 94 BIL H2D2 CD2 sing N N 95 BIL H1D1 CD1 sing N N 96 BIL H2D1 CD1 sing N N 97 BIL H1E1 CE1 sing N N 98 BIL OXT HXT sing N N 99 GLN N CA sing N N 100 GLN N H sing N N 101 GLN N H2 sing N N 102 GLN CA C sing N N 103 GLN CA CB sing N N 104 GLN CA HA sing N N 105 GLN C O doub N N 106 GLN C OXT sing N N 107 GLN CB CG sing N N 108 GLN CB HB2 sing N N 109 GLN CB HB3 sing N N 110 GLN CG CD sing N N 111 GLN CG HG2 sing N N 112 GLN CG HG3 sing N N 113 GLN CD OE1 doub N N 114 GLN CD NE2 sing N N 115 GLN NE2 HE21 sing N N 116 GLN NE2 HE22 sing N N 117 GLN OXT HXT sing N N 118 GLU N CA sing N N 119 GLU N H sing N N 120 GLU N H2 sing N N 121 GLU CA C sing N N 122 GLU CA CB sing N N 123 GLU CA HA sing N N 124 GLU C O doub N N 125 GLU C OXT sing N N 126 GLU CB CG sing N N 127 GLU CB HB2 sing N N 128 GLU CB HB3 sing N N 129 GLU CG CD sing N N 130 GLU CG HG2 sing N N 131 GLU CG HG3 sing N N 132 GLU CD OE1 doub N N 133 GLU CD OE2 sing N N 134 GLU OE2 HE2 sing N N 135 GLU OXT HXT sing N N 136 GLY N CA sing N N 137 GLY N H sing N N 138 GLY N H2 sing N N 139 GLY CA C sing N N 140 GLY CA HA2 sing N N 141 GLY CA HA3 sing N N 142 GLY C O doub N N 143 GLY C OXT sing N N 144 GLY OXT HXT sing N N 145 HOH O H1 sing N N 146 HOH O H2 sing N N 147 ILE N CA sing N N 148 ILE N H sing N N 149 ILE N H2 sing N N 150 ILE CA C sing N N 151 ILE CA CB sing N N 152 ILE CA HA sing N N 153 ILE C O doub N N 154 ILE C OXT sing N N 155 ILE CB CG1 sing N N 156 ILE CB CG2 sing N N 157 ILE CB HB sing N N 158 ILE CG1 CD1 sing N N 159 ILE CG1 HG12 sing N N 160 ILE CG1 HG13 sing N N 161 ILE CG2 HG21 sing N N 162 ILE CG2 HG22 sing N N 163 ILE CG2 HG23 sing N N 164 ILE CD1 HD11 sing N N 165 ILE CD1 HD12 sing N N 166 ILE CD1 HD13 sing N N 167 ILE OXT HXT sing N N 168 LEU N CA sing N N 169 LEU N H sing N N 170 LEU N H2 sing N N 171 LEU CA C sing N N 172 LEU CA CB sing N N 173 LEU CA HA sing N N 174 LEU C O doub N N 175 LEU C OXT sing N N 176 LEU CB CG sing N N 177 LEU CB HB2 sing N N 178 LEU CB HB3 sing N N 179 LEU CG CD1 sing N N 180 LEU CG CD2 sing N N 181 LEU CG HG sing N N 182 LEU CD1 HD11 sing N N 183 LEU CD1 HD12 sing N N 184 LEU CD1 HD13 sing N N 185 LEU CD2 HD21 sing N N 186 LEU CD2 HD22 sing N N 187 LEU CD2 HD23 sing N N 188 LEU OXT HXT sing N N 189 LYS N CA sing N N 190 LYS N H sing N N 191 LYS N H2 sing N N 192 LYS CA C sing N N 193 LYS CA CB sing N N 194 LYS CA HA sing N N 195 LYS C O doub N N 196 LYS C OXT sing N N 197 LYS CB CG sing N N 198 LYS CB HB2 sing N N 199 LYS CB HB3 sing N N 200 LYS CG CD sing N N 201 LYS CG HG2 sing N N 202 LYS CG HG3 sing N N 203 LYS CD CE sing N N 204 LYS CD HD2 sing N N 205 LYS CD HD3 sing N N 206 LYS CE NZ sing N N 207 LYS CE HE2 sing N N 208 LYS CE HE3 sing N N 209 LYS NZ HZ1 sing N N 210 LYS NZ HZ2 sing N N 211 LYS NZ HZ3 sing N N 212 LYS OXT HXT sing N N 213 NH2 N HN1 sing N N 214 NH2 N HN2 sing N N 215 PRO N CA sing N N 216 PRO N CD sing N N 217 PRO N H sing N N 218 PRO CA C sing N N 219 PRO CA CB sing N N 220 PRO CA HA sing N N 221 PRO C O doub N N 222 PRO C OXT sing N N 223 PRO CB CG sing N N 224 PRO CB HB2 sing N N 225 PRO CB HB3 sing N N 226 PRO CG CD sing N N 227 PRO CG HG2 sing N N 228 PRO CG HG3 sing N N 229 PRO CD HD2 sing N N 230 PRO CD HD3 sing N N 231 PRO OXT HXT sing N N 232 SER N CA sing N N 233 SER N H sing N N 234 SER N H2 sing N N 235 SER CA C sing N N 236 SER CA CB sing N N 237 SER CA HA sing N N 238 SER C O doub N N 239 SER C OXT sing N N 240 SER CB OG sing N N 241 SER CB HB2 sing N N 242 SER CB HB3 sing N N 243 SER OG HG sing N N 244 SER OXT HXT sing N N 245 THR N CA sing N N 246 THR N H sing N N 247 THR N H2 sing N N 248 THR CA C sing N N 249 THR CA CB sing N N 250 THR CA HA sing N N 251 THR C O doub N N 252 THR C OXT sing N N 253 THR CB OG1 sing N N 254 THR CB CG2 sing N N 255 THR CB HB sing N N 256 THR OG1 HG1 sing N N 257 THR CG2 HG21 sing N N 258 THR CG2 HG22 sing N N 259 THR CG2 HG23 sing N N 260 THR OXT HXT sing N N 261 TRP N CA sing N N 262 TRP N H sing N N 263 TRP N H2 sing N N 264 TRP CA C sing N N 265 TRP CA CB sing N N 266 TRP CA HA sing N N 267 TRP C O doub N N 268 TRP C OXT sing N N 269 TRP CB CG sing N N 270 TRP CB HB2 sing N N 271 TRP CB HB3 sing N N 272 TRP CG CD1 doub Y N 273 TRP CG CD2 sing Y N 274 TRP CD1 NE1 sing Y N 275 TRP CD1 HD1 sing N N 276 TRP CD2 CE2 doub Y N 277 TRP CD2 CE3 sing Y N 278 TRP NE1 CE2 sing Y N 279 TRP NE1 HE1 sing N N 280 TRP CE2 CZ2 sing Y N 281 TRP CE3 CZ3 doub Y N 282 TRP CE3 HE3 sing N N 283 TRP CZ2 CH2 doub Y N 284 TRP CZ2 HZ2 sing N N 285 TRP CZ3 CH2 sing Y N 286 TRP CZ3 HZ3 sing N N 287 TRP CH2 HH2 sing N N 288 TRP OXT HXT sing N N 289 TYR N CA sing N N 290 TYR N H sing N N 291 TYR N H2 sing N N 292 TYR CA C sing N N 293 TYR CA CB sing N N 294 TYR CA HA sing N N 295 TYR C O doub N N 296 TYR C OXT sing N N 297 TYR CB CG sing N N 298 TYR CB HB2 sing N N 299 TYR CB HB3 sing N N 300 TYR CG CD1 doub Y N 301 TYR CG CD2 sing Y N 302 TYR CD1 CE1 sing Y N 303 TYR CD1 HD1 sing N N 304 TYR CD2 CE2 doub Y N 305 TYR CD2 HD2 sing N N 306 TYR CE1 CZ doub Y N 307 TYR CE1 HE1 sing N N 308 TYR CE2 CZ sing Y N 309 TYR CE2 HE2 sing N N 310 TYR CZ OH sing N N 311 TYR OH HH sing N N 312 TYR OXT HXT sing N N 313 VAL N CA sing N N 314 VAL N H sing N N 315 VAL N H2 sing N N 316 VAL CA C sing N N 317 VAL CA CB sing N N 318 VAL CA HA sing N N 319 VAL C O doub N N 320 VAL C OXT sing N N 321 VAL CB CG1 sing N N 322 VAL CB CG2 sing N N 323 VAL CB HB sing N N 324 VAL CG1 HG11 sing N N 325 VAL CG1 HG12 sing N N 326 VAL CG1 HG13 sing N N 327 VAL CG2 HG21 sing N N 328 VAL CG2 HG22 sing N N 329 VAL CG2 HG23 sing N N 330 VAL OXT HXT sing N N 331 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' 1F32GM122263 1 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' 'United States' 1R01AI114736 2 # _pdbx_entity_nonpoly.entity_id 3 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 6NRO _pdbx_initial_refinement_model.details ? # loop_ _pdbx_struct_assembly_auth_evidence.id _pdbx_struct_assembly_auth_evidence.assembly_id _pdbx_struct_assembly_auth_evidence.experimental_support _pdbx_struct_assembly_auth_evidence.details 1 1 'assay for oligomerization' 'Formation of helical assemblies determined by circular dichroism spectroscopy.' 2 2 'assay for oligomerization' 'Formation of helical assemblies determined by circular dichroism spectroscopy.' # _space_group.name_H-M_alt 'P 3 2 1' _space_group.name_Hall ;P 3 2" ; _space_group.IT_number 150 _space_group.crystal_system trigonal _space_group.id 1 #