data_6VDZ # _entry.id 6VDZ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6VDZ pdb_00006vdz 10.2210/pdb6vdz/pdb WWPDB D_1000246248 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB . 6VDP unspecified PDB . 6VDQ unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6VDZ _pdbx_database_status.recvd_initial_deposition_date 2019-12-27 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Shin, I.' 1 0000-0001-8111-8948 'Liu, A.' 2 0000-0002-4182-8176 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Chem Sci' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2041-6520 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 12 _citation.language ? _citation.page_first 3984 _citation.page_last 3998 _citation.title ;A novel catalytic heme cofactor in SfmD with a single thioether bond and a bis -His ligand set revealed by a de novo crystal structural and spectroscopic study. ; _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1039/d0sc06369j _citation.pdbx_database_id_PubMed 34163669 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Shin, I.' 1 0000-0001-8111-8948 primary 'Davis, I.' 2 0000-0002-1566-4972 primary 'Nieves-Merced, K.' 3 ? primary 'Wang, Y.' 4 0000-0003-0378-2469 primary 'McHardy, S.' 5 0000-0003-0070-4924 primary 'Liu, A.' 6 0000-0002-4182-8176 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 6VDZ _cell.details ? _cell.formula_units_Z ? _cell.length_a 59.883 _cell.length_a_esd ? _cell.length_b 59.883 _cell.length_b_esd ? _cell.length_c 160.744 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6VDZ _symmetry.cell_setting ? _symmetry.Int_Tables_number 152 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 31 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man '3-methyl-L-tyrosine peroxygenase' 38232.902 1 1.11.2.5 ? ? ? 2 non-polymer syn 'HEME C' 618.503 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MTAPADTVHPAGQPDYVAQVATVPFRLGRPEELPGTLDELRAAVSARAGEAVRGLNRPGARTDLAALLAATERTRAALAP VGAGPVGDDPSESEANRDNDLAFGIVRTRGPVAELLVDAALAALAGILEVAVDRGSDLEDAAWQRFIGGFDALLGWLADP HSAPRPATVPGAGPAGPPVHQDALRRWVRGHHVFMVLAQGCALATACLRDSAARGDLPGAEASAAAAEALMRGCQGALLY AGDANREQYNEQIRPTLMPPVAPPKMSGLHWRDHEVLIKELAGSRDAWEWLSAQGSERPATFRAALAETYDSHIGVCGHF VGDQSPSLLAAQGSTRSAVGVIGQFRKIRLSALPEQPATQQGEPS ; _entity_poly.pdbx_seq_one_letter_code_can ;MTAPADTVHPAGQPDYVAQVATVPFRLGRPEELPGTLDELRAAVSARAGEAVRGLNRPGARTDLAALLAATERTRAALAP VGAGPVGDDPSESEANRDNDLAFGIVRTRGPVAELLVDAALAALAGILEVAVDRGSDLEDAAWQRFIGGFDALLGWLADP HSAPRPATVPGAGPAGPPVHQDALRRWVRGHHVFMVLAQGCALATACLRDSAARGDLPGAEASAAAAEALMRGCQGALLY AGDANREQYNEQIRPTLMPPVAPPKMSGLHWRDHEVLIKELAGSRDAWEWLSAQGSERPATFRAALAETYDSHIGVCGHF VGDQSPSLLAAQGSTRSAVGVIGQFRKIRLSALPEQPATQQGEPS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 THR n 1 3 ALA n 1 4 PRO n 1 5 ALA n 1 6 ASP n 1 7 THR n 1 8 VAL n 1 9 HIS n 1 10 PRO n 1 11 ALA n 1 12 GLY n 1 13 GLN n 1 14 PRO n 1 15 ASP n 1 16 TYR n 1 17 VAL n 1 18 ALA n 1 19 GLN n 1 20 VAL n 1 21 ALA n 1 22 THR n 1 23 VAL n 1 24 PRO n 1 25 PHE n 1 26 ARG n 1 27 LEU n 1 28 GLY n 1 29 ARG n 1 30 PRO n 1 31 GLU n 1 32 GLU n 1 33 LEU n 1 34 PRO n 1 35 GLY n 1 36 THR n 1 37 LEU n 1 38 ASP n 1 39 GLU n 1 40 LEU n 1 41 ARG n 1 42 ALA n 1 43 ALA n 1 44 VAL n 1 45 SER n 1 46 ALA n 1 47 ARG n 1 48 ALA n 1 49 GLY n 1 50 GLU n 1 51 ALA n 1 52 VAL n 1 53 ARG n 1 54 GLY n 1 55 LEU n 1 56 ASN n 1 57 ARG n 1 58 PRO n 1 59 GLY n 1 60 ALA n 1 61 ARG n 1 62 THR n 1 63 ASP n 1 64 LEU n 1 65 ALA n 1 66 ALA n 1 67 LEU n 1 68 LEU n 1 69 ALA n 1 70 ALA n 1 71 THR n 1 72 GLU n 1 73 ARG n 1 74 THR n 1 75 ARG n 1 76 ALA n 1 77 ALA n 1 78 LEU n 1 79 ALA n 1 80 PRO n 1 81 VAL n 1 82 GLY n 1 83 ALA n 1 84 GLY n 1 85 PRO n 1 86 VAL n 1 87 GLY n 1 88 ASP n 1 89 ASP n 1 90 PRO n 1 91 SER n 1 92 GLU n 1 93 SER n 1 94 GLU n 1 95 ALA n 1 96 ASN n 1 97 ARG n 1 98 ASP n 1 99 ASN n 1 100 ASP n 1 101 LEU n 1 102 ALA n 1 103 PHE n 1 104 GLY n 1 105 ILE n 1 106 VAL n 1 107 ARG n 1 108 THR n 1 109 ARG n 1 110 GLY n 1 111 PRO n 1 112 VAL n 1 113 ALA n 1 114 GLU n 1 115 LEU n 1 116 LEU n 1 117 VAL n 1 118 ASP n 1 119 ALA n 1 120 ALA n 1 121 LEU n 1 122 ALA n 1 123 ALA n 1 124 LEU n 1 125 ALA n 1 126 GLY n 1 127 ILE n 1 128 LEU n 1 129 GLU n 1 130 VAL n 1 131 ALA n 1 132 VAL n 1 133 ASP n 1 134 ARG n 1 135 GLY n 1 136 SER n 1 137 ASP n 1 138 LEU n 1 139 GLU n 1 140 ASP n 1 141 ALA n 1 142 ALA n 1 143 TRP n 1 144 GLN n 1 145 ARG n 1 146 PHE n 1 147 ILE n 1 148 GLY n 1 149 GLY n 1 150 PHE n 1 151 ASP n 1 152 ALA n 1 153 LEU n 1 154 LEU n 1 155 GLY n 1 156 TRP n 1 157 LEU n 1 158 ALA n 1 159 ASP n 1 160 PRO n 1 161 HIS n 1 162 SER n 1 163 ALA n 1 164 PRO n 1 165 ARG n 1 166 PRO n 1 167 ALA n 1 168 THR n 1 169 VAL n 1 170 PRO n 1 171 GLY n 1 172 ALA n 1 173 GLY n 1 174 PRO n 1 175 ALA n 1 176 GLY n 1 177 PRO n 1 178 PRO n 1 179 VAL n 1 180 HIS n 1 181 GLN n 1 182 ASP n 1 183 ALA n 1 184 LEU n 1 185 ARG n 1 186 ARG n 1 187 TRP n 1 188 VAL n 1 189 ARG n 1 190 GLY n 1 191 HIS n 1 192 HIS n 1 193 VAL n 1 194 PHE n 1 195 MET n 1 196 VAL n 1 197 LEU n 1 198 ALA n 1 199 GLN n 1 200 GLY n 1 201 CYS n 1 202 ALA n 1 203 LEU n 1 204 ALA n 1 205 THR n 1 206 ALA n 1 207 CYS n 1 208 LEU n 1 209 ARG n 1 210 ASP n 1 211 SER n 1 212 ALA n 1 213 ALA n 1 214 ARG n 1 215 GLY n 1 216 ASP n 1 217 LEU n 1 218 PRO n 1 219 GLY n 1 220 ALA n 1 221 GLU n 1 222 ALA n 1 223 SER n 1 224 ALA n 1 225 ALA n 1 226 ALA n 1 227 ALA n 1 228 GLU n 1 229 ALA n 1 230 LEU n 1 231 MET n 1 232 ARG n 1 233 GLY n 1 234 CYS n 1 235 GLN n 1 236 GLY n 1 237 ALA n 1 238 LEU n 1 239 LEU n 1 240 TYR n 1 241 ALA n 1 242 GLY n 1 243 ASP n 1 244 ALA n 1 245 ASN n 1 246 ARG n 1 247 GLU n 1 248 GLN n 1 249 TYR n 1 250 ASN n 1 251 GLU n 1 252 GLN n 1 253 ILE n 1 254 ARG n 1 255 PRO n 1 256 THR n 1 257 LEU n 1 258 MET n 1 259 PRO n 1 260 PRO n 1 261 VAL n 1 262 ALA n 1 263 PRO n 1 264 PRO n 1 265 LYS n 1 266 MET n 1 267 SER n 1 268 GLY n 1 269 LEU n 1 270 HIS n 1 271 TRP n 1 272 ARG n 1 273 ASP n 1 274 HIS n 1 275 GLU n 1 276 VAL n 1 277 LEU n 1 278 ILE n 1 279 LYS n 1 280 GLU n 1 281 LEU n 1 282 ALA n 1 283 GLY n 1 284 SER n 1 285 ARG n 1 286 ASP n 1 287 ALA n 1 288 TRP n 1 289 GLU n 1 290 TRP n 1 291 LEU n 1 292 SER n 1 293 ALA n 1 294 GLN n 1 295 GLY n 1 296 SER n 1 297 GLU n 1 298 ARG n 1 299 PRO n 1 300 ALA n 1 301 THR n 1 302 PHE n 1 303 ARG n 1 304 ALA n 1 305 ALA n 1 306 LEU n 1 307 ALA n 1 308 GLU n 1 309 THR n 1 310 TYR n 1 311 ASP n 1 312 SER n 1 313 HIS n 1 314 ILE n 1 315 GLY n 1 316 VAL n 1 317 CYS n 1 318 GLY n 1 319 HIS n 1 320 PHE n 1 321 VAL n 1 322 GLY n 1 323 ASP n 1 324 GLN n 1 325 SER n 1 326 PRO n 1 327 SER n 1 328 LEU n 1 329 LEU n 1 330 ALA n 1 331 ALA n 1 332 GLN n 1 333 GLY n 1 334 SER n 1 335 THR n 1 336 ARG n 1 337 SER n 1 338 ALA n 1 339 VAL n 1 340 GLY n 1 341 VAL n 1 342 ILE n 1 343 GLY n 1 344 GLN n 1 345 PHE n 1 346 ARG n 1 347 LYS n 1 348 ILE n 1 349 ARG n 1 350 LEU n 1 351 SER n 1 352 ALA n 1 353 LEU n 1 354 PRO n 1 355 GLU n 1 356 GLN n 1 357 PRO n 1 358 ALA n 1 359 THR n 1 360 GLN n 1 361 GLN n 1 362 GLY n 1 363 GLU n 1 364 PRO n 1 365 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 365 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene sfmD _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Streptomyces lavendulae' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1914 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SFMD_STRLA _struct_ref.pdbx_db_accession B0CN28 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MTAPADTVHPAGQPDYVAQVATVPFRLGRPEELPGTLDELRAAVSARAGEAVRGLNRPGARTDLAALLAATERTRAALAP VGAGPVGDDPSESEANRDNDLAFGIVRTRGPVAELLVDAALAALAGILEVAVDRGSDLEDAAWQRFIGGFDALLGWLADP HSAPRPATVPGAGPAGPPVHQDALRRWVRGHHVFMVLAQGCALATACLRDSAARGDLPGAEASAAAAEALMRGCQGALLY AGDANREQYNEQIRPTLMPPVAPPKMSGLHWRDHEVLIKELAGSRDAWEWLSAQGSERPATFRAALAETYDSHIGVCGHF VGDQSPSLLAAQGSTRSAVGVIGQFRKIRLSALPEQPATQQGEPS ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6VDZ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 365 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession B0CN28 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 365 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 365 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HEC non-polymer . 'HEME C' ? 'C34 H34 Fe N4 O4' 618.503 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6VDZ _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.18 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 43.48 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 295 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M Tris pH 8.5, 0.2 M magnesium chloride, 30% PEG 4000' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2019-12-18 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9795 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRL BEAMLINE BL9-2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9795 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL9-2 _diffrn_source.pdbx_synchrotron_site SSRL # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6VDZ _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.950 _reflns.d_resolution_low 50.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 7467 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.000 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 7.800 _reflns.pdbx_Rmerge_I_obs 0.082 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 8.100 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 1.028 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.088 _reflns.pdbx_Rpim_I_all 0.030 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 58396 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split 2.950 3.000 ? ? ? ? ? ? 372 99.500 ? ? ? ? 1.510 ? ? ? ? ? ? ? ? 8.000 ? 0.723 ? ? 1.606 0.534 ? 1 1 0.919 ? ? 3.000 3.060 ? ? ? ? ? ? 350 98.600 ? ? ? ? 1.333 ? ? ? ? ? ? ? ? 8.200 ? 0.770 ? ? 1.417 0.470 ? 2 1 0.887 ? ? 3.060 3.110 ? ? ? ? ? ? 357 98.900 ? ? ? ? 0.984 ? ? ? ? ? ? ? ? 8.000 ? 0.778 ? ? 1.050 0.356 ? 3 1 0.891 ? ? 3.110 3.180 ? ? ? ? ? ? 370 100.000 ? ? ? ? 0.864 ? ? ? ? ? ? ? ? 7.500 ? 0.816 ? ? 0.925 0.322 ? 4 1 0.877 ? ? 3.180 3.250 ? ? ? ? ? ? 355 98.300 ? ? ? ? 0.904 ? ? ? ? ? ? ? ? 6.600 ? 0.822 ? ? 0.977 0.361 ? 5 1 0.857 ? ? 3.250 3.320 ? ? ? ? ? ? 373 98.900 ? ? ? ? 0.592 ? ? ? ? ? ? ? ? 7.800 ? 0.840 ? ? 0.631 0.214 ? 6 1 0.944 ? ? 3.320 3.410 ? ? ? ? ? ? 346 98.900 ? ? ? ? 0.455 ? ? ? ? ? ? ? ? 8.900 ? 0.774 ? ? 0.481 0.153 ? 7 1 0.963 ? ? 3.410 3.500 ? ? ? ? ? ? 378 100.000 ? ? ? ? 0.318 ? ? ? ? ? ? ? ? 8.100 ? 0.889 ? ? 0.338 0.112 ? 8 1 0.984 ? ? 3.500 3.600 ? ? ? ? ? ? 364 98.100 ? ? ? ? 0.220 ? ? ? ? ? ? ? ? 8.400 ? 0.866 ? ? 0.234 0.076 ? 9 1 0.989 ? ? 3.600 3.720 ? ? ? ? ? ? 371 99.500 ? ? ? ? 0.181 ? ? ? ? ? ? ? ? 8.100 ? 0.986 ? ? 0.193 0.065 ? 10 1 0.994 ? ? 3.720 3.850 ? ? ? ? ? ? 371 99.500 ? ? ? ? 0.159 ? ? ? ? ? ? ? ? 8.200 ? 0.979 ? ? 0.169 0.056 ? 11 1 0.995 ? ? 3.850 4.000 ? ? ? ? ? ? 368 99.500 ? ? ? ? 0.124 ? ? ? ? ? ? ? ? 7.700 ? 1.179 ? ? 0.132 0.045 ? 12 1 0.993 ? ? 4.000 4.190 ? ? ? ? ? ? 374 99.200 ? ? ? ? 0.105 ? ? ? ? ? ? ? ? 8.300 ? 1.139 ? ? 0.112 0.037 ? 13 1 0.996 ? ? 4.190 4.410 ? ? ? ? ? ? 367 98.100 ? ? ? ? 0.083 ? ? ? ? ? ? ? ? 7.500 ? 1.261 ? ? 0.089 0.031 ? 14 1 0.996 ? ? 4.410 4.680 ? ? ? ? ? ? 376 99.500 ? ? ? ? 0.071 ? ? ? ? ? ? ? ? 6.700 ? 1.231 ? ? 0.077 0.029 ? 15 1 0.997 ? ? 4.680 5.040 ? ? ? ? ? ? 372 97.100 ? ? ? ? 0.069 ? ? ? ? ? ? ? ? 7.300 ? 1.361 ? ? 0.074 0.026 ? 16 1 0.996 ? ? 5.040 5.550 ? ? ? ? ? ? 375 98.400 ? ? ? ? 0.064 ? ? ? ? ? ? ? ? 7.900 ? 1.196 ? ? 0.069 0.023 ? 17 1 0.996 ? ? 5.550 6.350 ? ? ? ? ? ? 381 98.400 ? ? ? ? 0.061 ? ? ? ? ? ? ? ? 7.900 ? 1.107 ? ? 0.065 0.022 ? 18 1 0.997 ? ? 6.350 8.000 ? ? ? ? ? ? 405 100.000 ? ? ? ? 0.053 ? ? ? ? ? ? ? ? 7.600 ? 1.156 ? ? 0.057 0.021 ? 19 1 0.997 ? ? 8.000 50.000 ? ? ? ? ? ? 442 99.100 ? ? ? ? 0.057 ? ? ? ? ? ? ? ? 7.800 ? 1.619 ? ? 0.061 0.021 ? 20 1 0.997 ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 138.130 _refine.B_iso_mean 106.9007 _refine.B_iso_min 96.710 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6VDZ _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.9500 _refine.ls_d_res_low 49.3600 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 7411 _refine.ls_number_reflns_R_free 744 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.6800 _refine.ls_percent_reflns_R_free 10.0400 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2663 _refine.ls_R_factor_R_free 0.3254 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2599 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.330 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 6VDP _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 39.0300 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.5400 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.9500 _refine_hist.d_res_low 49.3600 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 2284 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 303 _refine_hist.pdbx_B_iso_mean_ligand 111.83 _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 2241 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 43 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.9500 3.1800 1444 . 146 1298 99.0000 . . . 0.4270 0.0000 0.3771 . . . . . . . 5 . . . 'X-RAY DIFFRACTION' 3.1800 3.5000 1448 . 141 1307 99.0000 . . . 0.4439 0.0000 0.3503 . . . . . . . 5 . . . 'X-RAY DIFFRACTION' 3.5000 4.0000 1460 . 147 1313 99.0000 . . . 0.3658 0.0000 0.3174 . . . . . . . 5 . . . 'X-RAY DIFFRACTION' 4.0100 5.0500 1474 . 148 1326 98.0000 . . . 0.3294 0.0000 0.2748 . . . . . . . 5 . . . 'X-RAY DIFFRACTION' 5.0500 49.3600 1585 . 162 1423 99.0000 . . . 0.2839 0.0000 0.2112 . . . . . . . 5 . . . # _struct.entry_id 6VDZ _struct.title 'Crystal structure of reduced SfmD by soaking with sodium hydrosulfite' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6VDZ _struct_keywords.text 'Hydroxylase, Histidine-ligated heme, OXIDOREDUCTASE' _struct_keywords.pdbx_keywords OXIDOREDUCTASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ARG A 29 ? LEU A 33 ? ARG A 29 LEU A 33 5 ? 5 HELX_P HELX_P2 AA2 THR A 36 ? ASN A 56 ? THR A 36 ASN A 56 1 ? 21 HELX_P HELX_P3 AA3 ASP A 63 ? LEU A 78 ? ASP A 63 LEU A 78 1 ? 16 HELX_P HELX_P4 AA4 SER A 93 ? PHE A 103 ? SER A 93 PHE A 103 1 ? 11 HELX_P HELX_P5 AA5 PRO A 111 ? GLY A 135 ? PRO A 111 GLY A 135 1 ? 25 HELX_P HELX_P6 AA6 ALA A 141 ? ASP A 159 ? ALA A 141 ASP A 159 1 ? 19 HELX_P HELX_P7 AA7 GLN A 181 ? ARG A 214 ? GLN A 181 ARG A 214 1 ? 34 HELX_P HELX_P8 AA8 ASP A 216 ? GLN A 252 ? ASP A 216 GLN A 252 1 ? 37 HELX_P HELX_P9 AA9 TRP A 271 ? ALA A 282 ? TRP A 271 ALA A 282 1 ? 12 HELX_P HELX_P10 AB1 SER A 284 ? GLN A 294 ? SER A 284 GLN A 294 1 ? 11 HELX_P HELX_P11 AB2 GLU A 297 ? SER A 312 ? GLU A 297 SER A 312 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale none ? A CYS 317 SG ? ? ? 1_555 B HEC . CAC ? ? A CYS 317 A HEC 401 1_555 ? ? ? ? ? ? ? 1.806 ? ? metalc1 metalc ? ? A HIS 274 NE2 ? ? ? 1_555 B HEC . FE ? ? A HIS 274 A HEC 401 1_555 ? ? ? ? ? ? ? 2.618 ? ? metalc2 metalc ? ? A HIS 313 NE2 ? ? ? 1_555 B HEC . FE ? ? A HIS 313 A HEC 401 1_555 ? ? ? ? ? ? ? 2.561 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id VAL _struct_mon_prot_cis.label_seq_id 23 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id VAL _struct_mon_prot_cis.auth_seq_id 23 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 24 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 24 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -2.09 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id AA1 _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 25 ? LEU A 27 ? PHE A 25 LEU A 27 AA1 2 ILE A 105 ? ARG A 107 ? ILE A 105 ARG A 107 # _pdbx_struct_sheet_hbond.sheet_id AA1 _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id PHE _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 25 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id PHE _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 25 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id VAL _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 106 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id VAL _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 106 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id HEC _struct_site.pdbx_auth_seq_id 401 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 16 _struct_site.details 'binding site for residue HEC A 401' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 16 HIS A 180 ? HIS A 180 . ? 6_445 ? 2 AC1 16 PHE A 194 ? PHE A 194 . ? 1_555 ? 3 AC1 16 CYS A 234 ? CYS A 234 . ? 1_555 ? 4 AC1 16 THR A 256 ? THR A 256 . ? 6_445 ? 5 AC1 16 LEU A 257 ? LEU A 257 . ? 6_445 ? 6 AC1 16 MET A 258 ? MET A 258 . ? 6_445 ? 7 AC1 16 MET A 266 ? MET A 266 . ? 1_555 ? 8 AC1 16 GLY A 268 ? GLY A 268 . ? 1_555 ? 9 AC1 16 TRP A 271 ? TRP A 271 . ? 1_555 ? 10 AC1 16 HIS A 274 ? HIS A 274 . ? 1_555 ? 11 AC1 16 LEU A 281 ? LEU A 281 . ? 1_555 ? 12 AC1 16 TYR A 310 ? TYR A 310 . ? 1_555 ? 13 AC1 16 HIS A 313 ? HIS A 313 . ? 1_555 ? 14 AC1 16 CYS A 317 ? CYS A 317 . ? 1_555 ? 15 AC1 16 HIS A 319 ? HIS A 319 . ? 1_555 ? 16 AC1 16 PHE A 320 ? PHE A 320 . ? 1_555 ? # _atom_sites.entry_id 6VDZ _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.016699 _atom_sites.fract_transf_matrix[1][2] 0.009641 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.019283 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006221 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C FE N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 THR 2 2 ? ? ? A . n A 1 3 ALA 3 3 ? ? ? A . n A 1 4 PRO 4 4 ? ? ? A . n A 1 5 ALA 5 5 ? ? ? A . n A 1 6 ASP 6 6 ? ? ? A . n A 1 7 THR 7 7 ? ? ? A . n A 1 8 VAL 8 8 ? ? ? A . n A 1 9 HIS 9 9 ? ? ? A . n A 1 10 PRO 10 10 ? ? ? A . n A 1 11 ALA 11 11 ? ? ? A . n A 1 12 GLY 12 12 ? ? ? A . n A 1 13 GLN 13 13 ? ? ? A . n A 1 14 PRO 14 14 ? ? ? A . n A 1 15 ASP 15 15 ? ? ? A . n A 1 16 TYR 16 16 ? ? ? A . n A 1 17 VAL 17 17 ? ? ? A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 GLN 19 19 19 GLN GLN A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 THR 22 22 22 THR THR A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 PRO 24 24 24 PRO PRO A . n A 1 25 PHE 25 25 25 PHE PHE A . n A 1 26 ARG 26 26 26 ARG ARG A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 ARG 29 29 29 ARG ARG A . n A 1 30 PRO 30 30 30 PRO PRO A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 PRO 34 34 34 PRO PRO A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 THR 36 36 36 THR THR A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 ASP 38 38 38 ASP ASP A . n A 1 39 GLU 39 39 39 GLU GLU A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 ARG 41 41 41 ARG ARG A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 ARG 47 47 47 ARG ARG A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 GLY 49 49 49 GLY GLY A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 ALA 51 51 51 ALA ALA A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 ARG 53 53 53 ARG ARG A . n A 1 54 GLY 54 54 54 GLY GLY A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 ASN 56 56 56 ASN ASN A . n A 1 57 ARG 57 57 57 ARG ARG A . n A 1 58 PRO 58 58 58 PRO PRO A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 ALA 60 60 60 ALA ALA A . n A 1 61 ARG 61 61 61 ARG ARG A . n A 1 62 THR 62 62 62 THR THR A . n A 1 63 ASP 63 63 63 ASP ASP A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 ALA 66 66 66 ALA ALA A . n A 1 67 LEU 67 67 67 LEU LEU A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 ALA 70 70 70 ALA ALA A . n A 1 71 THR 71 71 71 THR THR A . n A 1 72 GLU 72 72 72 GLU GLU A . n A 1 73 ARG 73 73 73 ARG ARG A . n A 1 74 THR 74 74 74 THR THR A . n A 1 75 ARG 75 75 75 ARG ARG A . n A 1 76 ALA 76 76 76 ALA ALA A . n A 1 77 ALA 77 77 77 ALA ALA A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 ALA 79 79 79 ALA ALA A . n A 1 80 PRO 80 80 80 PRO PRO A . n A 1 81 VAL 81 81 81 VAL VAL A . n A 1 82 GLY 82 82 82 GLY GLY A . n A 1 83 ALA 83 83 83 ALA ALA A . n A 1 84 GLY 84 84 84 GLY GLY A . n A 1 85 PRO 85 85 85 PRO PRO A . n A 1 86 VAL 86 86 86 VAL VAL A . n A 1 87 GLY 87 87 87 GLY GLY A . n A 1 88 ASP 88 88 88 ASP ASP A . n A 1 89 ASP 89 89 89 ASP ASP A . n A 1 90 PRO 90 90 90 PRO PRO A . n A 1 91 SER 91 91 91 SER SER A . n A 1 92 GLU 92 92 92 GLU GLU A . n A 1 93 SER 93 93 93 SER SER A . n A 1 94 GLU 94 94 94 GLU GLU A . n A 1 95 ALA 95 95 95 ALA ALA A . n A 1 96 ASN 96 96 96 ASN ASN A . n A 1 97 ARG 97 97 97 ARG ARG A . n A 1 98 ASP 98 98 98 ASP ASP A . n A 1 99 ASN 99 99 99 ASN ASN A . n A 1 100 ASP 100 100 100 ASP ASP A . n A 1 101 LEU 101 101 101 LEU LEU A . n A 1 102 ALA 102 102 102 ALA ALA A . n A 1 103 PHE 103 103 103 PHE PHE A . n A 1 104 GLY 104 104 104 GLY GLY A . n A 1 105 ILE 105 105 105 ILE ILE A . n A 1 106 VAL 106 106 106 VAL VAL A . n A 1 107 ARG 107 107 107 ARG ARG A . n A 1 108 THR 108 108 108 THR THR A . n A 1 109 ARG 109 109 109 ARG ARG A . n A 1 110 GLY 110 110 110 GLY GLY A . n A 1 111 PRO 111 111 111 PRO PRO A . n A 1 112 VAL 112 112 112 VAL VAL A . n A 1 113 ALA 113 113 113 ALA ALA A . n A 1 114 GLU 114 114 114 GLU GLU A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 LEU 116 116 116 LEU LEU A . n A 1 117 VAL 117 117 117 VAL VAL A . n A 1 118 ASP 118 118 118 ASP ASP A . n A 1 119 ALA 119 119 119 ALA ALA A . n A 1 120 ALA 120 120 120 ALA ALA A . n A 1 121 LEU 121 121 121 LEU LEU A . n A 1 122 ALA 122 122 122 ALA ALA A . n A 1 123 ALA 123 123 123 ALA ALA A . n A 1 124 LEU 124 124 124 LEU LEU A . n A 1 125 ALA 125 125 125 ALA ALA A . n A 1 126 GLY 126 126 126 GLY GLY A . n A 1 127 ILE 127 127 127 ILE ILE A . n A 1 128 LEU 128 128 128 LEU LEU A . n A 1 129 GLU 129 129 129 GLU GLU A . n A 1 130 VAL 130 130 130 VAL VAL A . n A 1 131 ALA 131 131 131 ALA ALA A . n A 1 132 VAL 132 132 132 VAL VAL A . n A 1 133 ASP 133 133 133 ASP ASP A . n A 1 134 ARG 134 134 134 ARG ARG A . n A 1 135 GLY 135 135 135 GLY GLY A . n A 1 136 SER 136 136 136 SER SER A . n A 1 137 ASP 137 137 137 ASP ASP A . n A 1 138 LEU 138 138 138 LEU LEU A . n A 1 139 GLU 139 139 139 GLU GLU A . n A 1 140 ASP 140 140 140 ASP ASP A . n A 1 141 ALA 141 141 141 ALA ALA A . n A 1 142 ALA 142 142 142 ALA ALA A . n A 1 143 TRP 143 143 143 TRP TRP A . n A 1 144 GLN 144 144 144 GLN GLN A . n A 1 145 ARG 145 145 145 ARG ARG A . n A 1 146 PHE 146 146 146 PHE PHE A . n A 1 147 ILE 147 147 147 ILE ILE A . n A 1 148 GLY 148 148 148 GLY GLY A . n A 1 149 GLY 149 149 149 GLY GLY A . n A 1 150 PHE 150 150 150 PHE PHE A . n A 1 151 ASP 151 151 151 ASP ASP A . n A 1 152 ALA 152 152 152 ALA ALA A . n A 1 153 LEU 153 153 153 LEU LEU A . n A 1 154 LEU 154 154 154 LEU LEU A . n A 1 155 GLY 155 155 155 GLY GLY A . n A 1 156 TRP 156 156 156 TRP TRP A . n A 1 157 LEU 157 157 157 LEU LEU A . n A 1 158 ALA 158 158 158 ALA ALA A . n A 1 159 ASP 159 159 159 ASP ASP A . n A 1 160 PRO 160 160 160 PRO PRO A . n A 1 161 HIS 161 161 161 HIS HIS A . n A 1 162 SER 162 162 162 SER SER A . n A 1 163 ALA 163 163 163 ALA ALA A . n A 1 164 PRO 164 164 164 PRO PRO A . n A 1 165 ARG 165 165 165 ARG ARG A . n A 1 166 PRO 166 166 166 PRO PRO A . n A 1 167 ALA 167 167 167 ALA ALA A . n A 1 168 THR 168 168 168 THR THR A . n A 1 169 VAL 169 169 169 VAL VAL A . n A 1 170 PRO 170 170 170 PRO PRO A . n A 1 171 GLY 171 171 171 GLY GLY A . n A 1 172 ALA 172 172 172 ALA ALA A . n A 1 173 GLY 173 173 173 GLY GLY A . n A 1 174 PRO 174 174 174 PRO PRO A . n A 1 175 ALA 175 175 175 ALA ALA A . n A 1 176 GLY 176 176 176 GLY GLY A . n A 1 177 PRO 177 177 177 PRO PRO A . n A 1 178 PRO 178 178 178 PRO PRO A . n A 1 179 VAL 179 179 179 VAL VAL A . n A 1 180 HIS 180 180 180 HIS HIS A . n A 1 181 GLN 181 181 181 GLN GLN A . n A 1 182 ASP 182 182 182 ASP ASP A . n A 1 183 ALA 183 183 183 ALA ALA A . n A 1 184 LEU 184 184 184 LEU LEU A . n A 1 185 ARG 185 185 185 ARG ARG A . n A 1 186 ARG 186 186 186 ARG ARG A . n A 1 187 TRP 187 187 187 TRP TRP A . n A 1 188 VAL 188 188 188 VAL VAL A . n A 1 189 ARG 189 189 189 ARG ARG A . n A 1 190 GLY 190 190 190 GLY GLY A . n A 1 191 HIS 191 191 191 HIS HIS A . n A 1 192 HIS 192 192 192 HIS HIS A . n A 1 193 VAL 193 193 193 VAL VAL A . n A 1 194 PHE 194 194 194 PHE PHE A . n A 1 195 MET 195 195 195 MET MET A . n A 1 196 VAL 196 196 196 VAL VAL A . n A 1 197 LEU 197 197 197 LEU LEU A . n A 1 198 ALA 198 198 198 ALA ALA A . n A 1 199 GLN 199 199 199 GLN GLN A . n A 1 200 GLY 200 200 200 GLY GLY A . n A 1 201 CYS 201 201 201 CYS CYS A . n A 1 202 ALA 202 202 202 ALA ALA A . n A 1 203 LEU 203 203 203 LEU LEU A . n A 1 204 ALA 204 204 204 ALA ALA A . n A 1 205 THR 205 205 205 THR THR A . n A 1 206 ALA 206 206 206 ALA ALA A . n A 1 207 CYS 207 207 207 CYS CYS A . n A 1 208 LEU 208 208 208 LEU LEU A . n A 1 209 ARG 209 209 209 ARG ARG A . n A 1 210 ASP 210 210 210 ASP ASP A . n A 1 211 SER 211 211 211 SER SER A . n A 1 212 ALA 212 212 212 ALA ALA A . n A 1 213 ALA 213 213 213 ALA ALA A . n A 1 214 ARG 214 214 214 ARG ARG A . n A 1 215 GLY 215 215 215 GLY GLY A . n A 1 216 ASP 216 216 216 ASP ASP A . n A 1 217 LEU 217 217 217 LEU LEU A . n A 1 218 PRO 218 218 218 PRO PRO A . n A 1 219 GLY 219 219 219 GLY GLY A . n A 1 220 ALA 220 220 220 ALA ALA A . n A 1 221 GLU 221 221 221 GLU GLU A . n A 1 222 ALA 222 222 222 ALA ALA A . n A 1 223 SER 223 223 223 SER SER A . n A 1 224 ALA 224 224 224 ALA ALA A . n A 1 225 ALA 225 225 225 ALA ALA A . n A 1 226 ALA 226 226 226 ALA ALA A . n A 1 227 ALA 227 227 227 ALA ALA A . n A 1 228 GLU 228 228 228 GLU GLU A . n A 1 229 ALA 229 229 229 ALA ALA A . n A 1 230 LEU 230 230 230 LEU LEU A . n A 1 231 MET 231 231 231 MET MET A . n A 1 232 ARG 232 232 232 ARG ARG A . n A 1 233 GLY 233 233 233 GLY GLY A . n A 1 234 CYS 234 234 234 CYS CYS A . n A 1 235 GLN 235 235 235 GLN GLN A . n A 1 236 GLY 236 236 236 GLY GLY A . n A 1 237 ALA 237 237 237 ALA ALA A . n A 1 238 LEU 238 238 238 LEU LEU A . n A 1 239 LEU 239 239 239 LEU LEU A . n A 1 240 TYR 240 240 240 TYR TYR A . n A 1 241 ALA 241 241 241 ALA ALA A . n A 1 242 GLY 242 242 242 GLY GLY A . n A 1 243 ASP 243 243 243 ASP ASP A . n A 1 244 ALA 244 244 244 ALA ALA A . n A 1 245 ASN 245 245 245 ASN ASN A . n A 1 246 ARG 246 246 246 ARG ARG A . n A 1 247 GLU 247 247 247 GLU GLU A . n A 1 248 GLN 248 248 248 GLN GLN A . n A 1 249 TYR 249 249 249 TYR TYR A . n A 1 250 ASN 250 250 250 ASN ASN A . n A 1 251 GLU 251 251 251 GLU GLU A . n A 1 252 GLN 252 252 252 GLN GLN A . n A 1 253 ILE 253 253 253 ILE ILE A . n A 1 254 ARG 254 254 254 ARG ARG A . n A 1 255 PRO 255 255 255 PRO PRO A . n A 1 256 THR 256 256 256 THR THR A . n A 1 257 LEU 257 257 257 LEU LEU A . n A 1 258 MET 258 258 258 MET MET A . n A 1 259 PRO 259 259 259 PRO PRO A . n A 1 260 PRO 260 260 260 PRO PRO A . n A 1 261 VAL 261 261 261 VAL VAL A . n A 1 262 ALA 262 262 262 ALA ALA A . n A 1 263 PRO 263 263 263 PRO PRO A . n A 1 264 PRO 264 264 264 PRO PRO A . n A 1 265 LYS 265 265 265 LYS LYS A . n A 1 266 MET 266 266 266 MET MET A . n A 1 267 SER 267 267 267 SER SER A . n A 1 268 GLY 268 268 268 GLY GLY A . n A 1 269 LEU 269 269 269 LEU LEU A . n A 1 270 HIS 270 270 270 HIS HIS A . n A 1 271 TRP 271 271 271 TRP TRP A . n A 1 272 ARG 272 272 272 ARG ARG A . n A 1 273 ASP 273 273 273 ASP ASP A . n A 1 274 HIS 274 274 274 HIS HIS A . n A 1 275 GLU 275 275 275 GLU GLU A . n A 1 276 VAL 276 276 276 VAL VAL A . n A 1 277 LEU 277 277 277 LEU LEU A . n A 1 278 ILE 278 278 278 ILE ILE A . n A 1 279 LYS 279 279 279 LYS LYS A . n A 1 280 GLU 280 280 280 GLU GLU A . n A 1 281 LEU 281 281 281 LEU LEU A . n A 1 282 ALA 282 282 282 ALA ALA A . n A 1 283 GLY 283 283 283 GLY GLY A . n A 1 284 SER 284 284 284 SER SER A . n A 1 285 ARG 285 285 285 ARG ARG A . n A 1 286 ASP 286 286 286 ASP ASP A . n A 1 287 ALA 287 287 287 ALA ALA A . n A 1 288 TRP 288 288 288 TRP TRP A . n A 1 289 GLU 289 289 289 GLU GLU A . n A 1 290 TRP 290 290 290 TRP TRP A . n A 1 291 LEU 291 291 291 LEU LEU A . n A 1 292 SER 292 292 292 SER SER A . n A 1 293 ALA 293 293 293 ALA ALA A . n A 1 294 GLN 294 294 294 GLN GLN A . n A 1 295 GLY 295 295 295 GLY GLY A . n A 1 296 SER 296 296 296 SER SER A . n A 1 297 GLU 297 297 297 GLU GLU A . n A 1 298 ARG 298 298 298 ARG ARG A . n A 1 299 PRO 299 299 299 PRO PRO A . n A 1 300 ALA 300 300 300 ALA ALA A . n A 1 301 THR 301 301 301 THR THR A . n A 1 302 PHE 302 302 302 PHE PHE A . n A 1 303 ARG 303 303 303 ARG ARG A . n A 1 304 ALA 304 304 304 ALA ALA A . n A 1 305 ALA 305 305 305 ALA ALA A . n A 1 306 LEU 306 306 306 LEU LEU A . n A 1 307 ALA 307 307 307 ALA ALA A . n A 1 308 GLU 308 308 308 GLU GLU A . n A 1 309 THR 309 309 309 THR THR A . n A 1 310 TYR 310 310 310 TYR TYR A . n A 1 311 ASP 311 311 311 ASP ASP A . n A 1 312 SER 312 312 312 SER SER A . n A 1 313 HIS 313 313 313 HIS HIS A . n A 1 314 ILE 314 314 314 ILE ILE A . n A 1 315 GLY 315 315 315 GLY GLY A . n A 1 316 VAL 316 316 316 VAL VAL A . n A 1 317 CYS 317 317 317 CYS CYS A . n A 1 318 GLY 318 318 318 GLY GLY A . n A 1 319 HIS 319 319 319 HIS HIS A . n A 1 320 PHE 320 320 320 PHE PHE A . n A 1 321 VAL 321 321 ? ? ? A . n A 1 322 GLY 322 322 ? ? ? A . n A 1 323 ASP 323 323 ? ? ? A . n A 1 324 GLN 324 324 ? ? ? A . n A 1 325 SER 325 325 ? ? ? A . n A 1 326 PRO 326 326 ? ? ? A . n A 1 327 SER 327 327 ? ? ? A . n A 1 328 LEU 328 328 ? ? ? A . n A 1 329 LEU 329 329 ? ? ? A . n A 1 330 ALA 330 330 ? ? ? A . n A 1 331 ALA 331 331 ? ? ? A . n A 1 332 GLN 332 332 ? ? ? A . n A 1 333 GLY 333 333 ? ? ? A . n A 1 334 SER 334 334 ? ? ? A . n A 1 335 THR 335 335 ? ? ? A . n A 1 336 ARG 336 336 ? ? ? A . n A 1 337 SER 337 337 ? ? ? A . n A 1 338 ALA 338 338 ? ? ? A . n A 1 339 VAL 339 339 ? ? ? A . n A 1 340 GLY 340 340 ? ? ? A . n A 1 341 VAL 341 341 ? ? ? A . n A 1 342 ILE 342 342 ? ? ? A . n A 1 343 GLY 343 343 ? ? ? A . n A 1 344 GLN 344 344 ? ? ? A . n A 1 345 PHE 345 345 ? ? ? A . n A 1 346 ARG 346 346 ? ? ? A . n A 1 347 LYS 347 347 ? ? ? A . n A 1 348 ILE 348 348 ? ? ? A . n A 1 349 ARG 349 349 ? ? ? A . n A 1 350 LEU 350 350 ? ? ? A . n A 1 351 SER 351 351 ? ? ? A . n A 1 352 ALA 352 352 ? ? ? A . n A 1 353 LEU 353 353 ? ? ? A . n A 1 354 PRO 354 354 ? ? ? A . n A 1 355 GLU 355 355 ? ? ? A . n A 1 356 GLN 356 356 ? ? ? A . n A 1 357 PRO 357 357 ? ? ? A . n A 1 358 ALA 358 358 ? ? ? A . n A 1 359 THR 359 359 ? ? ? A . n A 1 360 GLN 360 360 ? ? ? A . n A 1 361 GLN 361 361 ? ? ? A . n A 1 362 GLY 362 362 ? ? ? A . n A 1 363 GLU 363 363 ? ? ? A . n A 1 364 PRO 364 364 ? ? ? A . n A 1 365 SER 365 365 ? ? ? A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id HEC _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 401 _pdbx_nonpoly_scheme.auth_seq_num 1 _pdbx_nonpoly_scheme.pdb_mon_id HEC _pdbx_nonpoly_scheme.auth_mon_id HEC _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 274 ? A HIS 274 ? 1_555 FE ? B HEC . ? A HEC 401 ? 1_555 NA ? B HEC . ? A HEC 401 ? 1_555 83.4 ? 2 NE2 ? A HIS 274 ? A HIS 274 ? 1_555 FE ? B HEC . ? A HEC 401 ? 1_555 NB ? B HEC . ? A HEC 401 ? 1_555 109.6 ? 3 NA ? B HEC . ? A HEC 401 ? 1_555 FE ? B HEC . ? A HEC 401 ? 1_555 NB ? B HEC . ? A HEC 401 ? 1_555 91.6 ? 4 NE2 ? A HIS 274 ? A HIS 274 ? 1_555 FE ? B HEC . ? A HEC 401 ? 1_555 NC ? B HEC . ? A HEC 401 ? 1_555 102.4 ? 5 NA ? B HEC . ? A HEC 401 ? 1_555 FE ? B HEC . ? A HEC 401 ? 1_555 NC ? B HEC . ? A HEC 401 ? 1_555 174.1 ? 6 NB ? B HEC . ? A HEC 401 ? 1_555 FE ? B HEC . ? A HEC 401 ? 1_555 NC ? B HEC . ? A HEC 401 ? 1_555 85.8 ? 7 NE2 ? A HIS 274 ? A HIS 274 ? 1_555 FE ? B HEC . ? A HEC 401 ? 1_555 ND ? B HEC . ? A HEC 401 ? 1_555 77.2 ? 8 NA ? B HEC . ? A HEC 401 ? 1_555 FE ? B HEC . ? A HEC 401 ? 1_555 ND ? B HEC . ? A HEC 401 ? 1_555 88.3 ? 9 NB ? B HEC . ? A HEC 401 ? 1_555 FE ? B HEC . ? A HEC 401 ? 1_555 ND ? B HEC . ? A HEC 401 ? 1_555 173.1 ? 10 NC ? B HEC . ? A HEC 401 ? 1_555 FE ? B HEC . ? A HEC 401 ? 1_555 ND ? B HEC . ? A HEC 401 ? 1_555 93.6 ? 11 NE2 ? A HIS 274 ? A HIS 274 ? 1_555 FE ? B HEC . ? A HEC 401 ? 1_555 NE2 ? A HIS 313 ? A HIS 313 ? 1_555 174.0 ? 12 NA ? B HEC . ? A HEC 401 ? 1_555 FE ? B HEC . ? A HEC 401 ? 1_555 NE2 ? A HIS 313 ? A HIS 313 ? 1_555 94.2 ? 13 NB ? B HEC . ? A HEC 401 ? 1_555 FE ? B HEC . ? A HEC 401 ? 1_555 NE2 ? A HIS 313 ? A HIS 313 ? 1_555 64.8 ? 14 NC ? B HEC . ? A HEC 401 ? 1_555 FE ? B HEC . ? A HEC 401 ? 1_555 NE2 ? A HIS 313 ? A HIS 313 ? 1_555 79.9 ? 15 ND ? B HEC . ? A HEC 401 ? 1_555 FE ? B HEC . ? A HEC 401 ? 1_555 NE2 ? A HIS 313 ? A HIS 313 ? 1_555 108.2 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-03-10 2 'Structure model' 1 1 2021-07-14 3 'Structure model' 1 2 2023-10-11 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' database_2 6 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_id_ISSN' 2 2 'Structure model' '_citation.journal_volume' 3 2 'Structure model' '_citation.page_first' 4 2 'Structure model' '_citation.page_last' 5 2 'Structure model' '_citation.pdbx_database_id_DOI' 6 2 'Structure model' '_citation.pdbx_database_id_PubMed' 7 2 'Structure model' '_citation.title' 8 2 'Structure model' '_citation_author.identifier_ORCID' 9 3 'Structure model' '_database_2.pdbx_DOI' 10 3 'Structure model' '_database_2.pdbx_database_accession' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? DENZO ? ? ? . 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALEPACK ? ? ? . 2 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.17.1-3660 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 5 # _pdbx_entry_details.entry_id 6VDZ _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN A 19 ? ? 66.13 -6.64 2 1 ALA A 83 ? ? -88.20 33.26 3 1 PRO A 111 ? ? -61.27 96.66 4 1 PRO A 160 ? ? -65.64 1.16 5 1 PRO A 178 ? ? -59.39 97.53 6 1 VAL A 316 ? ? -123.22 -56.31 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A THR 2 ? A THR 2 3 1 Y 1 A ALA 3 ? A ALA 3 4 1 Y 1 A PRO 4 ? A PRO 4 5 1 Y 1 A ALA 5 ? A ALA 5 6 1 Y 1 A ASP 6 ? A ASP 6 7 1 Y 1 A THR 7 ? A THR 7 8 1 Y 1 A VAL 8 ? A VAL 8 9 1 Y 1 A HIS 9 ? A HIS 9 10 1 Y 1 A PRO 10 ? A PRO 10 11 1 Y 1 A ALA 11 ? A ALA 11 12 1 Y 1 A GLY 12 ? A GLY 12 13 1 Y 1 A GLN 13 ? A GLN 13 14 1 Y 1 A PRO 14 ? A PRO 14 15 1 Y 1 A ASP 15 ? A ASP 15 16 1 Y 1 A TYR 16 ? A TYR 16 17 1 Y 1 A VAL 17 ? A VAL 17 18 1 Y 1 A VAL 321 ? A VAL 321 19 1 Y 1 A GLY 322 ? A GLY 322 20 1 Y 1 A ASP 323 ? A ASP 323 21 1 Y 1 A GLN 324 ? A GLN 324 22 1 Y 1 A SER 325 ? A SER 325 23 1 Y 1 A PRO 326 ? A PRO 326 24 1 Y 1 A SER 327 ? A SER 327 25 1 Y 1 A LEU 328 ? A LEU 328 26 1 Y 1 A LEU 329 ? A LEU 329 27 1 Y 1 A ALA 330 ? A ALA 330 28 1 Y 1 A ALA 331 ? A ALA 331 29 1 Y 1 A GLN 332 ? A GLN 332 30 1 Y 1 A GLY 333 ? A GLY 333 31 1 Y 1 A SER 334 ? A SER 334 32 1 Y 1 A THR 335 ? A THR 335 33 1 Y 1 A ARG 336 ? A ARG 336 34 1 Y 1 A SER 337 ? A SER 337 35 1 Y 1 A ALA 338 ? A ALA 338 36 1 Y 1 A VAL 339 ? A VAL 339 37 1 Y 1 A GLY 340 ? A GLY 340 38 1 Y 1 A VAL 341 ? A VAL 341 39 1 Y 1 A ILE 342 ? A ILE 342 40 1 Y 1 A GLY 343 ? A GLY 343 41 1 Y 1 A GLN 344 ? A GLN 344 42 1 Y 1 A PHE 345 ? A PHE 345 43 1 Y 1 A ARG 346 ? A ARG 346 44 1 Y 1 A LYS 347 ? A LYS 347 45 1 Y 1 A ILE 348 ? A ILE 348 46 1 Y 1 A ARG 349 ? A ARG 349 47 1 Y 1 A LEU 350 ? A LEU 350 48 1 Y 1 A SER 351 ? A SER 351 49 1 Y 1 A ALA 352 ? A ALA 352 50 1 Y 1 A LEU 353 ? A LEU 353 51 1 Y 1 A PRO 354 ? A PRO 354 52 1 Y 1 A GLU 355 ? A GLU 355 53 1 Y 1 A GLN 356 ? A GLN 356 54 1 Y 1 A PRO 357 ? A PRO 357 55 1 Y 1 A ALA 358 ? A ALA 358 56 1 Y 1 A THR 359 ? A THR 359 57 1 Y 1 A GLN 360 ? A GLN 360 58 1 Y 1 A GLN 361 ? A GLN 361 59 1 Y 1 A GLY 362 ? A GLY 362 60 1 Y 1 A GLU 363 ? A GLU 363 61 1 Y 1 A PRO 364 ? A PRO 364 62 1 Y 1 A SER 365 ? A SER 365 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HEC FE FE N N 137 HEC CHA C N N 138 HEC CHB C N N 139 HEC CHC C N N 140 HEC CHD C N N 141 HEC NA N Y N 142 HEC C1A C Y N 143 HEC C2A C Y N 144 HEC C3A C Y N 145 HEC C4A C Y N 146 HEC CMA C N N 147 HEC CAA C N N 148 HEC CBA C N N 149 HEC CGA C N N 150 HEC O1A O N N 151 HEC O2A O N N 152 HEC NB N Y N 153 HEC C1B C Y N 154 HEC C2B C Y N 155 HEC C3B C Y N 156 HEC C4B C Y N 157 HEC CMB C N N 158 HEC CAB C N N 159 HEC CBB C N N 160 HEC NC N Y N 161 HEC C1C C Y N 162 HEC C2C C Y N 163 HEC C3C C Y N 164 HEC C4C C Y N 165 HEC CMC C N N 166 HEC CAC C N N 167 HEC CBC C N N 168 HEC ND N Y N 169 HEC C1D C Y N 170 HEC C2D C Y N 171 HEC C3D C Y N 172 HEC C4D C Y N 173 HEC CMD C N N 174 HEC CAD C N N 175 HEC CBD C N N 176 HEC CGD C N N 177 HEC O1D O N N 178 HEC O2D O N N 179 HEC HHA H N N 180 HEC HHB H N N 181 HEC HHC H N N 182 HEC HHD H N N 183 HEC HMA1 H N N 184 HEC HMA2 H N N 185 HEC HMA3 H N N 186 HEC HAA1 H N N 187 HEC HAA2 H N N 188 HEC HBA1 H N N 189 HEC HBA2 H N N 190 HEC H2A H N N 191 HEC HMB1 H N N 192 HEC HMB2 H N N 193 HEC HMB3 H N N 194 HEC HAB H N N 195 HEC HBB1 H N N 196 HEC HBB2 H N N 197 HEC HBB3 H N N 198 HEC HMC1 H N N 199 HEC HMC2 H N N 200 HEC HMC3 H N N 201 HEC HAC H N N 202 HEC HBC1 H N N 203 HEC HBC2 H N N 204 HEC HBC3 H N N 205 HEC HMD1 H N N 206 HEC HMD2 H N N 207 HEC HMD3 H N N 208 HEC HAD1 H N N 209 HEC HAD2 H N N 210 HEC HBD1 H N N 211 HEC HBD2 H N N 212 HEC H2D H N N 213 HIS N N N N 214 HIS CA C N S 215 HIS C C N N 216 HIS O O N N 217 HIS CB C N N 218 HIS CG C Y N 219 HIS ND1 N Y N 220 HIS CD2 C Y N 221 HIS CE1 C Y N 222 HIS NE2 N Y N 223 HIS OXT O N N 224 HIS H H N N 225 HIS H2 H N N 226 HIS HA H N N 227 HIS HB2 H N N 228 HIS HB3 H N N 229 HIS HD1 H N N 230 HIS HD2 H N N 231 HIS HE1 H N N 232 HIS HE2 H N N 233 HIS HXT H N N 234 ILE N N N N 235 ILE CA C N S 236 ILE C C N N 237 ILE O O N N 238 ILE CB C N S 239 ILE CG1 C N N 240 ILE CG2 C N N 241 ILE CD1 C N N 242 ILE OXT O N N 243 ILE H H N N 244 ILE H2 H N N 245 ILE HA H N N 246 ILE HB H N N 247 ILE HG12 H N N 248 ILE HG13 H N N 249 ILE HG21 H N N 250 ILE HG22 H N N 251 ILE HG23 H N N 252 ILE HD11 H N N 253 ILE HD12 H N N 254 ILE HD13 H N N 255 ILE HXT H N N 256 LEU N N N N 257 LEU CA C N S 258 LEU C C N N 259 LEU O O N N 260 LEU CB C N N 261 LEU CG C N N 262 LEU CD1 C N N 263 LEU CD2 C N N 264 LEU OXT O N N 265 LEU H H N N 266 LEU H2 H N N 267 LEU HA H N N 268 LEU HB2 H N N 269 LEU HB3 H N N 270 LEU HG H N N 271 LEU HD11 H N N 272 LEU HD12 H N N 273 LEU HD13 H N N 274 LEU HD21 H N N 275 LEU HD22 H N N 276 LEU HD23 H N N 277 LEU HXT H N N 278 LYS N N N N 279 LYS CA C N S 280 LYS C C N N 281 LYS O O N N 282 LYS CB C N N 283 LYS CG C N N 284 LYS CD C N N 285 LYS CE C N N 286 LYS NZ N N N 287 LYS OXT O N N 288 LYS H H N N 289 LYS H2 H N N 290 LYS HA H N N 291 LYS HB2 H N N 292 LYS HB3 H N N 293 LYS HG2 H N N 294 LYS HG3 H N N 295 LYS HD2 H N N 296 LYS HD3 H N N 297 LYS HE2 H N N 298 LYS HE3 H N N 299 LYS HZ1 H N N 300 LYS HZ2 H N N 301 LYS HZ3 H N N 302 LYS HXT H N N 303 MET N N N N 304 MET CA C N S 305 MET C C N N 306 MET O O N N 307 MET CB C N N 308 MET CG C N N 309 MET SD S N N 310 MET CE C N N 311 MET OXT O N N 312 MET H H N N 313 MET H2 H N N 314 MET HA H N N 315 MET HB2 H N N 316 MET HB3 H N N 317 MET HG2 H N N 318 MET HG3 H N N 319 MET HE1 H N N 320 MET HE2 H N N 321 MET HE3 H N N 322 MET HXT H N N 323 PHE N N N N 324 PHE CA C N S 325 PHE C C N N 326 PHE O O N N 327 PHE CB C N N 328 PHE CG C Y N 329 PHE CD1 C Y N 330 PHE CD2 C Y N 331 PHE CE1 C Y N 332 PHE CE2 C Y N 333 PHE CZ C Y N 334 PHE OXT O N N 335 PHE H H N N 336 PHE H2 H N N 337 PHE HA H N N 338 PHE HB2 H N N 339 PHE HB3 H N N 340 PHE HD1 H N N 341 PHE HD2 H N N 342 PHE HE1 H N N 343 PHE HE2 H N N 344 PHE HZ H N N 345 PHE HXT H N N 346 PRO N N N N 347 PRO CA C N S 348 PRO C C N N 349 PRO O O N N 350 PRO CB C N N 351 PRO CG C N N 352 PRO CD C N N 353 PRO OXT O N N 354 PRO H H N N 355 PRO HA H N N 356 PRO HB2 H N N 357 PRO HB3 H N N 358 PRO HG2 H N N 359 PRO HG3 H N N 360 PRO HD2 H N N 361 PRO HD3 H N N 362 PRO HXT H N N 363 SER N N N N 364 SER CA C N S 365 SER C C N N 366 SER O O N N 367 SER CB C N N 368 SER OG O N N 369 SER OXT O N N 370 SER H H N N 371 SER H2 H N N 372 SER HA H N N 373 SER HB2 H N N 374 SER HB3 H N N 375 SER HG H N N 376 SER HXT H N N 377 THR N N N N 378 THR CA C N S 379 THR C C N N 380 THR O O N N 381 THR CB C N R 382 THR OG1 O N N 383 THR CG2 C N N 384 THR OXT O N N 385 THR H H N N 386 THR H2 H N N 387 THR HA H N N 388 THR HB H N N 389 THR HG1 H N N 390 THR HG21 H N N 391 THR HG22 H N N 392 THR HG23 H N N 393 THR HXT H N N 394 TRP N N N N 395 TRP CA C N S 396 TRP C C N N 397 TRP O O N N 398 TRP CB C N N 399 TRP CG C Y N 400 TRP CD1 C Y N 401 TRP CD2 C Y N 402 TRP NE1 N Y N 403 TRP CE2 C Y N 404 TRP CE3 C Y N 405 TRP CZ2 C Y N 406 TRP CZ3 C Y N 407 TRP CH2 C Y N 408 TRP OXT O N N 409 TRP H H N N 410 TRP H2 H N N 411 TRP HA H N N 412 TRP HB2 H N N 413 TRP HB3 H N N 414 TRP HD1 H N N 415 TRP HE1 H N N 416 TRP HE3 H N N 417 TRP HZ2 H N N 418 TRP HZ3 H N N 419 TRP HH2 H N N 420 TRP HXT H N N 421 TYR N N N N 422 TYR CA C N S 423 TYR C C N N 424 TYR O O N N 425 TYR CB C N N 426 TYR CG C Y N 427 TYR CD1 C Y N 428 TYR CD2 C Y N 429 TYR CE1 C Y N 430 TYR CE2 C Y N 431 TYR CZ C Y N 432 TYR OH O N N 433 TYR OXT O N N 434 TYR H H N N 435 TYR H2 H N N 436 TYR HA H N N 437 TYR HB2 H N N 438 TYR HB3 H N N 439 TYR HD1 H N N 440 TYR HD2 H N N 441 TYR HE1 H N N 442 TYR HE2 H N N 443 TYR HH H N N 444 TYR HXT H N N 445 VAL N N N N 446 VAL CA C N S 447 VAL C C N N 448 VAL O O N N 449 VAL CB C N N 450 VAL CG1 C N N 451 VAL CG2 C N N 452 VAL OXT O N N 453 VAL H H N N 454 VAL H2 H N N 455 VAL HA H N N 456 VAL HB H N N 457 VAL HG11 H N N 458 VAL HG12 H N N 459 VAL HG13 H N N 460 VAL HG21 H N N 461 VAL HG22 H N N 462 VAL HG23 H N N 463 VAL HXT H N N 464 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HEC FE NA sing N N 129 HEC FE NB sing N N 130 HEC FE NC sing N N 131 HEC FE ND sing N N 132 HEC CHA C1A doub N N 133 HEC CHA C4D sing N N 134 HEC CHA HHA sing N N 135 HEC CHB C4A doub N N 136 HEC CHB C1B sing N N 137 HEC CHB HHB sing N N 138 HEC CHC C4B doub N N 139 HEC CHC C1C sing N N 140 HEC CHC HHC sing N N 141 HEC CHD C4C doub N N 142 HEC CHD C1D sing N N 143 HEC CHD HHD sing N N 144 HEC NA C1A sing Y N 145 HEC NA C4A sing Y N 146 HEC C1A C2A sing Y N 147 HEC C2A C3A doub Y N 148 HEC C2A CAA sing N N 149 HEC C3A C4A sing Y N 150 HEC C3A CMA sing N N 151 HEC CMA HMA1 sing N N 152 HEC CMA HMA2 sing N N 153 HEC CMA HMA3 sing N N 154 HEC CAA CBA sing N N 155 HEC CAA HAA1 sing N N 156 HEC CAA HAA2 sing N N 157 HEC CBA CGA sing N N 158 HEC CBA HBA1 sing N N 159 HEC CBA HBA2 sing N N 160 HEC CGA O1A doub N N 161 HEC CGA O2A sing N N 162 HEC O2A H2A sing N N 163 HEC NB C1B sing Y N 164 HEC NB C4B sing Y N 165 HEC C1B C2B doub Y N 166 HEC C2B C3B sing Y N 167 HEC C2B CMB sing N N 168 HEC C3B C4B sing Y N 169 HEC C3B CAB doub N E 170 HEC CMB HMB1 sing N N 171 HEC CMB HMB2 sing N N 172 HEC CMB HMB3 sing N N 173 HEC CAB CBB sing N N 174 HEC CAB HAB sing N N 175 HEC CBB HBB1 sing N N 176 HEC CBB HBB2 sing N N 177 HEC CBB HBB3 sing N N 178 HEC NC C1C sing Y N 179 HEC NC C4C sing Y N 180 HEC C1C C2C doub Y N 181 HEC C2C C3C sing Y N 182 HEC C2C CMC sing N N 183 HEC C3C C4C sing Y N 184 HEC C3C CAC doub N E 185 HEC CMC HMC1 sing N N 186 HEC CMC HMC2 sing N N 187 HEC CMC HMC3 sing N N 188 HEC CAC CBC sing N N 189 HEC CAC HAC sing N N 190 HEC CBC HBC1 sing N N 191 HEC CBC HBC2 sing N N 192 HEC CBC HBC3 sing N N 193 HEC ND C1D sing Y N 194 HEC ND C4D sing Y N 195 HEC C1D C2D doub Y N 196 HEC C2D C3D sing Y N 197 HEC C2D CMD sing N N 198 HEC C3D C4D doub Y N 199 HEC C3D CAD sing N N 200 HEC CMD HMD1 sing N N 201 HEC CMD HMD2 sing N N 202 HEC CMD HMD3 sing N N 203 HEC CAD CBD sing N N 204 HEC CAD HAD1 sing N N 205 HEC CAD HAD2 sing N N 206 HEC CBD CGD sing N N 207 HEC CBD HBD1 sing N N 208 HEC CBD HBD2 sing N N 209 HEC CGD O1D doub N N 210 HEC CGD O2D sing N N 211 HEC O2D H2D sing N N 212 HIS N CA sing N N 213 HIS N H sing N N 214 HIS N H2 sing N N 215 HIS CA C sing N N 216 HIS CA CB sing N N 217 HIS CA HA sing N N 218 HIS C O doub N N 219 HIS C OXT sing N N 220 HIS CB CG sing N N 221 HIS CB HB2 sing N N 222 HIS CB HB3 sing N N 223 HIS CG ND1 sing Y N 224 HIS CG CD2 doub Y N 225 HIS ND1 CE1 doub Y N 226 HIS ND1 HD1 sing N N 227 HIS CD2 NE2 sing Y N 228 HIS CD2 HD2 sing N N 229 HIS CE1 NE2 sing Y N 230 HIS CE1 HE1 sing N N 231 HIS NE2 HE2 sing N N 232 HIS OXT HXT sing N N 233 ILE N CA sing N N 234 ILE N H sing N N 235 ILE N H2 sing N N 236 ILE CA C sing N N 237 ILE CA CB sing N N 238 ILE CA HA sing N N 239 ILE C O doub N N 240 ILE C OXT sing N N 241 ILE CB CG1 sing N N 242 ILE CB CG2 sing N N 243 ILE CB HB sing N N 244 ILE CG1 CD1 sing N N 245 ILE CG1 HG12 sing N N 246 ILE CG1 HG13 sing N N 247 ILE CG2 HG21 sing N N 248 ILE CG2 HG22 sing N N 249 ILE CG2 HG23 sing N N 250 ILE CD1 HD11 sing N N 251 ILE CD1 HD12 sing N N 252 ILE CD1 HD13 sing N N 253 ILE OXT HXT sing N N 254 LEU N CA sing N N 255 LEU N H sing N N 256 LEU N H2 sing N N 257 LEU CA C sing N N 258 LEU CA CB sing N N 259 LEU CA HA sing N N 260 LEU C O doub N N 261 LEU C OXT sing N N 262 LEU CB CG sing N N 263 LEU CB HB2 sing N N 264 LEU CB HB3 sing N N 265 LEU CG CD1 sing N N 266 LEU CG CD2 sing N N 267 LEU CG HG sing N N 268 LEU CD1 HD11 sing N N 269 LEU CD1 HD12 sing N N 270 LEU CD1 HD13 sing N N 271 LEU CD2 HD21 sing N N 272 LEU CD2 HD22 sing N N 273 LEU CD2 HD23 sing N N 274 LEU OXT HXT sing N N 275 LYS N CA sing N N 276 LYS N H sing N N 277 LYS N H2 sing N N 278 LYS CA C sing N N 279 LYS CA CB sing N N 280 LYS CA HA sing N N 281 LYS C O doub N N 282 LYS C OXT sing N N 283 LYS CB CG sing N N 284 LYS CB HB2 sing N N 285 LYS CB HB3 sing N N 286 LYS CG CD sing N N 287 LYS CG HG2 sing N N 288 LYS CG HG3 sing N N 289 LYS CD CE sing N N 290 LYS CD HD2 sing N N 291 LYS CD HD3 sing N N 292 LYS CE NZ sing N N 293 LYS CE HE2 sing N N 294 LYS CE HE3 sing N N 295 LYS NZ HZ1 sing N N 296 LYS NZ HZ2 sing N N 297 LYS NZ HZ3 sing N N 298 LYS OXT HXT sing N N 299 MET N CA sing N N 300 MET N H sing N N 301 MET N H2 sing N N 302 MET CA C sing N N 303 MET CA CB sing N N 304 MET CA HA sing N N 305 MET C O doub N N 306 MET C OXT sing N N 307 MET CB CG sing N N 308 MET CB HB2 sing N N 309 MET CB HB3 sing N N 310 MET CG SD sing N N 311 MET CG HG2 sing N N 312 MET CG HG3 sing N N 313 MET SD CE sing N N 314 MET CE HE1 sing N N 315 MET CE HE2 sing N N 316 MET CE HE3 sing N N 317 MET OXT HXT sing N N 318 PHE N CA sing N N 319 PHE N H sing N N 320 PHE N H2 sing N N 321 PHE CA C sing N N 322 PHE CA CB sing N N 323 PHE CA HA sing N N 324 PHE C O doub N N 325 PHE C OXT sing N N 326 PHE CB CG sing N N 327 PHE CB HB2 sing N N 328 PHE CB HB3 sing N N 329 PHE CG CD1 doub Y N 330 PHE CG CD2 sing Y N 331 PHE CD1 CE1 sing Y N 332 PHE CD1 HD1 sing N N 333 PHE CD2 CE2 doub Y N 334 PHE CD2 HD2 sing N N 335 PHE CE1 CZ doub Y N 336 PHE CE1 HE1 sing N N 337 PHE CE2 CZ sing Y N 338 PHE CE2 HE2 sing N N 339 PHE CZ HZ sing N N 340 PHE OXT HXT sing N N 341 PRO N CA sing N N 342 PRO N CD sing N N 343 PRO N H sing N N 344 PRO CA C sing N N 345 PRO CA CB sing N N 346 PRO CA HA sing N N 347 PRO C O doub N N 348 PRO C OXT sing N N 349 PRO CB CG sing N N 350 PRO CB HB2 sing N N 351 PRO CB HB3 sing N N 352 PRO CG CD sing N N 353 PRO CG HG2 sing N N 354 PRO CG HG3 sing N N 355 PRO CD HD2 sing N N 356 PRO CD HD3 sing N N 357 PRO OXT HXT sing N N 358 SER N CA sing N N 359 SER N H sing N N 360 SER N H2 sing N N 361 SER CA C sing N N 362 SER CA CB sing N N 363 SER CA HA sing N N 364 SER C O doub N N 365 SER C OXT sing N N 366 SER CB OG sing N N 367 SER CB HB2 sing N N 368 SER CB HB3 sing N N 369 SER OG HG sing N N 370 SER OXT HXT sing N N 371 THR N CA sing N N 372 THR N H sing N N 373 THR N H2 sing N N 374 THR CA C sing N N 375 THR CA CB sing N N 376 THR CA HA sing N N 377 THR C O doub N N 378 THR C OXT sing N N 379 THR CB OG1 sing N N 380 THR CB CG2 sing N N 381 THR CB HB sing N N 382 THR OG1 HG1 sing N N 383 THR CG2 HG21 sing N N 384 THR CG2 HG22 sing N N 385 THR CG2 HG23 sing N N 386 THR OXT HXT sing N N 387 TRP N CA sing N N 388 TRP N H sing N N 389 TRP N H2 sing N N 390 TRP CA C sing N N 391 TRP CA CB sing N N 392 TRP CA HA sing N N 393 TRP C O doub N N 394 TRP C OXT sing N N 395 TRP CB CG sing N N 396 TRP CB HB2 sing N N 397 TRP CB HB3 sing N N 398 TRP CG CD1 doub Y N 399 TRP CG CD2 sing Y N 400 TRP CD1 NE1 sing Y N 401 TRP CD1 HD1 sing N N 402 TRP CD2 CE2 doub Y N 403 TRP CD2 CE3 sing Y N 404 TRP NE1 CE2 sing Y N 405 TRP NE1 HE1 sing N N 406 TRP CE2 CZ2 sing Y N 407 TRP CE3 CZ3 doub Y N 408 TRP CE3 HE3 sing N N 409 TRP CZ2 CH2 doub Y N 410 TRP CZ2 HZ2 sing N N 411 TRP CZ3 CH2 sing Y N 412 TRP CZ3 HZ3 sing N N 413 TRP CH2 HH2 sing N N 414 TRP OXT HXT sing N N 415 TYR N CA sing N N 416 TYR N H sing N N 417 TYR N H2 sing N N 418 TYR CA C sing N N 419 TYR CA CB sing N N 420 TYR CA HA sing N N 421 TYR C O doub N N 422 TYR C OXT sing N N 423 TYR CB CG sing N N 424 TYR CB HB2 sing N N 425 TYR CB HB3 sing N N 426 TYR CG CD1 doub Y N 427 TYR CG CD2 sing Y N 428 TYR CD1 CE1 sing Y N 429 TYR CD1 HD1 sing N N 430 TYR CD2 CE2 doub Y N 431 TYR CD2 HD2 sing N N 432 TYR CE1 CZ doub Y N 433 TYR CE1 HE1 sing N N 434 TYR CE2 CZ sing Y N 435 TYR CE2 HE2 sing N N 436 TYR CZ OH sing N N 437 TYR OH HH sing N N 438 TYR OXT HXT sing N N 439 VAL N CA sing N N 440 VAL N H sing N N 441 VAL N H2 sing N N 442 VAL CA C sing N N 443 VAL CA CB sing N N 444 VAL CA HA sing N N 445 VAL C O doub N N 446 VAL C OXT sing N N 447 VAL CB CG1 sing N N 448 VAL CB CG2 sing N N 449 VAL CB HB sing N N 450 VAL CG1 HG11 sing N N 451 VAL CG1 HG12 sing N N 452 VAL CG1 HG13 sing N N 453 VAL CG2 HG21 sing N N 454 VAL CG2 HG22 sing N N 455 VAL CG2 HG23 sing N N 456 VAL OXT HXT sing N N 457 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id HEC _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id HEC _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'HEME C' _pdbx_entity_nonpoly.comp_id HEC # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 6VDP _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #