data_6VEH # _entry.id 6VEH # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.389 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6VEH pdb_00006veh 10.2210/pdb6veh/pdb WWPDB D_1000245178 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-08-05 2 'Structure model' 1 1 2020-08-19 3 'Structure model' 1 2 2024-04-03 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' database_2 6 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.pdbx_database_id_DOI' 7 2 'Structure model' '_citation.pdbx_database_id_PubMed' 8 2 'Structure model' '_citation.title' 9 2 'Structure model' '_citation.year' 10 3 'Structure model' '_database_2.pdbx_DOI' 11 3 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6VEH _pdbx_database_status.recvd_initial_deposition_date 2020-01-02 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Bick, M.J.' 1 0000-0002-9585-859X 'Ueda, G.' 2 0000-0002-9792-7149 'Baker, D.' 3 0000-0001-7896-6217 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Elife _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2050-084X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 9 _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Tailored design of protein nanoparticle scaffolds for multivalent presentation of viral glycoprotein antigens.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.7554/eLife.57659 _citation.pdbx_database_id_PubMed 32748788 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ueda, G.' 1 0000-0002-9792-7149 primary 'Antanasijevic, A.' 2 0000-0001-9452-8954 primary 'Fallas, J.A.' 3 ? primary 'Sheffler, W.' 4 ? primary 'Copps, J.' 5 ? primary 'Ellis, D.' 6 ? primary 'Hutchinson, G.B.' 7 ? primary 'Moyer, A.' 8 ? primary 'Yasmeen, A.' 9 ? primary 'Tsybovsky, Y.' 10 ? primary 'Park, Y.J.' 11 ? primary 'Bick, M.J.' 12 0000-0002-9585-859X primary 'Sankaran, B.' 13 ? primary 'Gillespie, R.A.' 14 ? primary 'Brouwer, P.J.' 15 0000-0002-2902-7739 primary 'Zwart, P.H.' 16 ? primary 'Veesler, D.' 17 0000-0002-6019-8675 primary 'Kanekiyo, M.' 18 ? primary 'Graham, B.S.' 19 0000-0001-8112-0853 primary 'Sanders, R.W.' 20 ? primary 'Moore, J.P.' 21 ? primary 'Klasse, P.J.' 22 0000-0001-8222-278X primary 'Ward, A.B.' 23 0000-0001-7153-3769 primary 'King, N.P.' 24 ? primary 'Baker, D.' 25 0000-0001-7896-6217 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'HEAT repeat domain-containing protein' 21022.387 1 ? ? ? ? 2 water nat water 18.015 25 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(FME)TDPMKVILYIAMLELEKYIMRAAAAYALGKIGDERAVEPLIKALKDEDAIVRAAAADALGQIGDERAVEPLIKAL KDEDGAVRVSAAVALGQIGDERAVEPLIKALKDEDAVVRVAAAIALGLIGDERAVEPLIKALKDEKGKVREAAALALGAI GGERVRAAMEKLAETGTGFARKVAVNYLETHKLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MTDPMKVILYIAMLELEKYIMRAAAAYALGKIGDERAVEPLIKALKDEDAIVRAAAADALGQIGDERAVEPLIKALKDED GAVRVSAAVALGQIGDERAVEPLIKALKDEDAVVRVAAAIALGLIGDERAVEPLIKALKDEKGKVREAAALALGAIGGER VRAAMEKLAETGTGFARKVAVNYLETHKLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 FME n 1 2 THR n 1 3 ASP n 1 4 PRO n 1 5 MET n 1 6 LYS n 1 7 VAL n 1 8 ILE n 1 9 LEU n 1 10 TYR n 1 11 ILE n 1 12 ALA n 1 13 MET n 1 14 LEU n 1 15 GLU n 1 16 LEU n 1 17 GLU n 1 18 LYS n 1 19 TYR n 1 20 ILE n 1 21 MET n 1 22 ARG n 1 23 ALA n 1 24 ALA n 1 25 ALA n 1 26 ALA n 1 27 TYR n 1 28 ALA n 1 29 LEU n 1 30 GLY n 1 31 LYS n 1 32 ILE n 1 33 GLY n 1 34 ASP n 1 35 GLU n 1 36 ARG n 1 37 ALA n 1 38 VAL n 1 39 GLU n 1 40 PRO n 1 41 LEU n 1 42 ILE n 1 43 LYS n 1 44 ALA n 1 45 LEU n 1 46 LYS n 1 47 ASP n 1 48 GLU n 1 49 ASP n 1 50 ALA n 1 51 ILE n 1 52 VAL n 1 53 ARG n 1 54 ALA n 1 55 ALA n 1 56 ALA n 1 57 ALA n 1 58 ASP n 1 59 ALA n 1 60 LEU n 1 61 GLY n 1 62 GLN n 1 63 ILE n 1 64 GLY n 1 65 ASP n 1 66 GLU n 1 67 ARG n 1 68 ALA n 1 69 VAL n 1 70 GLU n 1 71 PRO n 1 72 LEU n 1 73 ILE n 1 74 LYS n 1 75 ALA n 1 76 LEU n 1 77 LYS n 1 78 ASP n 1 79 GLU n 1 80 ASP n 1 81 GLY n 1 82 ALA n 1 83 VAL n 1 84 ARG n 1 85 VAL n 1 86 SER n 1 87 ALA n 1 88 ALA n 1 89 VAL n 1 90 ALA n 1 91 LEU n 1 92 GLY n 1 93 GLN n 1 94 ILE n 1 95 GLY n 1 96 ASP n 1 97 GLU n 1 98 ARG n 1 99 ALA n 1 100 VAL n 1 101 GLU n 1 102 PRO n 1 103 LEU n 1 104 ILE n 1 105 LYS n 1 106 ALA n 1 107 LEU n 1 108 LYS n 1 109 ASP n 1 110 GLU n 1 111 ASP n 1 112 ALA n 1 113 VAL n 1 114 VAL n 1 115 ARG n 1 116 VAL n 1 117 ALA n 1 118 ALA n 1 119 ALA n 1 120 ILE n 1 121 ALA n 1 122 LEU n 1 123 GLY n 1 124 LEU n 1 125 ILE n 1 126 GLY n 1 127 ASP n 1 128 GLU n 1 129 ARG n 1 130 ALA n 1 131 VAL n 1 132 GLU n 1 133 PRO n 1 134 LEU n 1 135 ILE n 1 136 LYS n 1 137 ALA n 1 138 LEU n 1 139 LYS n 1 140 ASP n 1 141 GLU n 1 142 LYS n 1 143 GLY n 1 144 LYS n 1 145 VAL n 1 146 ARG n 1 147 GLU n 1 148 ALA n 1 149 ALA n 1 150 ALA n 1 151 LEU n 1 152 ALA n 1 153 LEU n 1 154 GLY n 1 155 ALA n 1 156 ILE n 1 157 GLY n 1 158 GLY n 1 159 GLU n 1 160 ARG n 1 161 VAL n 1 162 ARG n 1 163 ALA n 1 164 ALA n 1 165 MET n 1 166 GLU n 1 167 LYS n 1 168 LEU n 1 169 ALA n 1 170 GLU n 1 171 THR n 1 172 GLY n 1 173 THR n 1 174 GLY n 1 175 PHE n 1 176 ALA n 1 177 ARG n 1 178 LYS n 1 179 VAL n 1 180 ALA n 1 181 VAL n 1 182 ASN n 1 183 TYR n 1 184 LEU n 1 185 GLU n 1 186 THR n 1 187 HIS n 1 188 LYS n 1 189 LEU n 1 190 GLU n 1 191 HIS n 1 192 HIS n 1 193 HIS n 1 194 HIS n 1 195 HIS n 1 196 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 196 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'synthetic construct' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 32630 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 FME 'L-peptide linking' n N-FORMYLMETHIONINE ? 'C6 H11 N O3 S' 177.221 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 FME 1 1 1 FME FME A . n A 1 2 THR 2 2 2 THR THR A . n A 1 3 ASP 3 3 3 ASP ASP A . n A 1 4 PRO 4 4 4 PRO PRO A . n A 1 5 MET 5 5 5 MET MET A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 ILE 8 8 8 ILE ILE A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 TYR 10 10 10 TYR TYR A . n A 1 11 ILE 11 11 11 ILE ILE A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 MET 13 13 13 MET MET A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 TYR 19 19 19 TYR TYR A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 MET 21 21 21 MET MET A . n A 1 22 ARG 22 22 22 ARG ARG A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 TYR 27 27 27 TYR TYR A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 ILE 32 32 32 ILE ILE A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 ASP 34 34 34 ASP ASP A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 ARG 36 36 36 ARG ARG A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 GLU 39 39 39 GLU GLU A . n A 1 40 PRO 40 40 40 PRO PRO A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 ILE 42 42 42 ILE ILE A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 ASP 47 47 47 ASP ASP A . n A 1 48 GLU 48 48 48 GLU GLU A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 ILE 51 51 51 ILE ILE A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 ARG 53 53 53 ARG ARG A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 ALA 55 55 55 ALA ALA A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 ALA 59 59 59 ALA ALA A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 GLY 61 61 61 GLY GLY A . n A 1 62 GLN 62 62 62 GLN GLN A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 GLY 64 64 64 GLY GLY A . n A 1 65 ASP 65 65 65 ASP ASP A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 ARG 67 67 67 ARG ARG A . n A 1 68 ALA 68 68 68 ALA ALA A . n A 1 69 VAL 69 69 69 VAL VAL A . n A 1 70 GLU 70 70 70 GLU GLU A . n A 1 71 PRO 71 71 71 PRO PRO A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 ILE 73 73 73 ILE ILE A . n A 1 74 LYS 74 74 74 LYS LYS A . n A 1 75 ALA 75 75 75 ALA ALA A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 LYS 77 77 77 LYS LYS A . n A 1 78 ASP 78 78 78 ASP ASP A . n A 1 79 GLU 79 79 79 GLU GLU A . n A 1 80 ASP 80 80 80 ASP ASP A . n A 1 81 GLY 81 81 81 GLY GLY A . n A 1 82 ALA 82 82 82 ALA ALA A . n A 1 83 VAL 83 83 83 VAL VAL A . n A 1 84 ARG 84 84 84 ARG ARG A . n A 1 85 VAL 85 85 85 VAL VAL A . n A 1 86 SER 86 86 86 SER SER A . n A 1 87 ALA 87 87 87 ALA ALA A . n A 1 88 ALA 88 88 88 ALA ALA A . n A 1 89 VAL 89 89 89 VAL VAL A . n A 1 90 ALA 90 90 90 ALA ALA A . n A 1 91 LEU 91 91 91 LEU LEU A . n A 1 92 GLY 92 92 92 GLY GLY A . n A 1 93 GLN 93 93 93 GLN GLN A . n A 1 94 ILE 94 94 94 ILE ILE A . n A 1 95 GLY 95 95 95 GLY GLY A . n A 1 96 ASP 96 96 96 ASP ASP A . n A 1 97 GLU 97 97 97 GLU GLU A . n A 1 98 ARG 98 98 98 ARG ARG A . n A 1 99 ALA 99 99 99 ALA ALA A . n A 1 100 VAL 100 100 100 VAL VAL A . n A 1 101 GLU 101 101 101 GLU GLU A . n A 1 102 PRO 102 102 102 PRO PRO A . n A 1 103 LEU 103 103 103 LEU LEU A . n A 1 104 ILE 104 104 104 ILE ILE A . n A 1 105 LYS 105 105 105 LYS LYS A . n A 1 106 ALA 106 106 106 ALA ALA A . n A 1 107 LEU 107 107 107 LEU LEU A . n A 1 108 LYS 108 108 108 LYS LYS A . n A 1 109 ASP 109 109 109 ASP ASP A . n A 1 110 GLU 110 110 110 GLU GLU A . n A 1 111 ASP 111 111 111 ASP ASP A . n A 1 112 ALA 112 112 112 ALA ALA A . n A 1 113 VAL 113 113 113 VAL VAL A . n A 1 114 VAL 114 114 114 VAL VAL A . n A 1 115 ARG 115 115 115 ARG ARG A . n A 1 116 VAL 116 116 116 VAL VAL A . n A 1 117 ALA 117 117 117 ALA ALA A . n A 1 118 ALA 118 118 118 ALA ALA A . n A 1 119 ALA 119 119 119 ALA ALA A . n A 1 120 ILE 120 120 120 ILE ILE A . n A 1 121 ALA 121 121 121 ALA ALA A . n A 1 122 LEU 122 122 122 LEU LEU A . n A 1 123 GLY 123 123 123 GLY GLY A . n A 1 124 LEU 124 124 124 LEU LEU A . n A 1 125 ILE 125 125 125 ILE ILE A . n A 1 126 GLY 126 126 126 GLY GLY A . n A 1 127 ASP 127 127 127 ASP ASP A . n A 1 128 GLU 128 128 128 GLU GLU A . n A 1 129 ARG 129 129 129 ARG ARG A . n A 1 130 ALA 130 130 130 ALA ALA A . n A 1 131 VAL 131 131 131 VAL VAL A . n A 1 132 GLU 132 132 132 GLU GLU A . n A 1 133 PRO 133 133 133 PRO PRO A . n A 1 134 LEU 134 134 134 LEU LEU A . n A 1 135 ILE 135 135 135 ILE ILE A . n A 1 136 LYS 136 136 136 LYS LYS A . n A 1 137 ALA 137 137 137 ALA ALA A . n A 1 138 LEU 138 138 138 LEU LEU A . n A 1 139 LYS 139 139 139 LYS LYS A . n A 1 140 ASP 140 140 140 ASP ASP A . n A 1 141 GLU 141 141 141 GLU GLU A . n A 1 142 LYS 142 142 142 LYS LYS A . n A 1 143 GLY 143 143 143 GLY GLY A . n A 1 144 LYS 144 144 144 LYS LYS A . n A 1 145 VAL 145 145 145 VAL VAL A . n A 1 146 ARG 146 146 146 ARG ARG A . n A 1 147 GLU 147 147 147 GLU GLU A . n A 1 148 ALA 148 148 148 ALA ALA A . n A 1 149 ALA 149 149 149 ALA ALA A . n A 1 150 ALA 150 150 150 ALA ALA A . n A 1 151 LEU 151 151 151 LEU LEU A . n A 1 152 ALA 152 152 152 ALA ALA A . n A 1 153 LEU 153 153 153 LEU LEU A . n A 1 154 GLY 154 154 154 GLY GLY A . n A 1 155 ALA 155 155 155 ALA ALA A . n A 1 156 ILE 156 156 156 ILE ILE A . n A 1 157 GLY 157 157 157 GLY GLY A . n A 1 158 GLY 158 158 158 GLY GLY A . n A 1 159 GLU 159 159 159 GLU GLU A . n A 1 160 ARG 160 160 160 ARG ARG A . n A 1 161 VAL 161 161 161 VAL VAL A . n A 1 162 ARG 162 162 162 ARG ARG A . n A 1 163 ALA 163 163 163 ALA ALA A . n A 1 164 ALA 164 164 164 ALA ALA A . n A 1 165 MET 165 165 165 MET MET A . n A 1 166 GLU 166 166 ? ? ? A . n A 1 167 LYS 167 167 ? ? ? A . n A 1 168 LEU 168 168 ? ? ? A . n A 1 169 ALA 169 169 ? ? ? A . n A 1 170 GLU 170 170 ? ? ? A . n A 1 171 THR 171 171 ? ? ? A . n A 1 172 GLY 172 172 ? ? ? A . n A 1 173 THR 173 173 ? ? ? A . n A 1 174 GLY 174 174 ? ? ? A . n A 1 175 PHE 175 175 175 PHE PHE A . n A 1 176 ALA 176 176 176 ALA ALA A . n A 1 177 ARG 177 177 177 ARG ARG A . n A 1 178 LYS 178 178 178 LYS LYS A . n A 1 179 VAL 179 179 179 VAL VAL A . n A 1 180 ALA 180 180 180 ALA ALA A . n A 1 181 VAL 181 181 181 VAL VAL A . n A 1 182 ASN 182 182 182 ASN ASN A . n A 1 183 TYR 183 183 183 TYR TYR A . n A 1 184 LEU 184 184 184 LEU LEU A . n A 1 185 GLU 185 185 185 GLU GLU A . n A 1 186 THR 186 186 186 THR THR A . n A 1 187 HIS 187 187 187 HIS HIS A . n A 1 188 LYS 188 188 188 LYS LYS A . n A 1 189 LEU 189 189 189 LEU LEU A . n A 1 190 GLU 190 190 ? ? ? A . n A 1 191 HIS 191 191 ? ? ? A . n A 1 192 HIS 192 192 ? ? ? A . n A 1 193 HIS 193 193 ? ? ? A . n A 1 194 HIS 194 194 ? ? ? A . n A 1 195 HIS 195 195 ? ? ? A . n A 1 196 HIS 196 196 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 201 6 HOH HOH A . B 2 HOH 2 202 5 HOH HOH A . B 2 HOH 3 203 17 HOH HOH A . B 2 HOH 4 204 4 HOH HOH A . B 2 HOH 5 205 12 HOH HOH A . B 2 HOH 6 206 9 HOH HOH A . B 2 HOH 7 207 8 HOH HOH A . B 2 HOH 8 208 1 HOH HOH A . B 2 HOH 9 209 3 HOH HOH A . B 2 HOH 10 210 25 HOH HOH A . B 2 HOH 11 211 13 HOH HOH A . B 2 HOH 12 212 22 HOH HOH A . B 2 HOH 13 213 2 HOH HOH A . B 2 HOH 14 214 7 HOH HOH A . B 2 HOH 15 215 10 HOH HOH A . B 2 HOH 16 216 19 HOH HOH A . B 2 HOH 17 217 23 HOH HOH A . B 2 HOH 18 218 20 HOH HOH A . B 2 HOH 19 219 15 HOH HOH A . B 2 HOH 20 220 24 HOH HOH A . B 2 HOH 21 221 16 HOH HOH A . B 2 HOH 22 222 11 HOH HOH A . B 2 HOH 23 223 21 HOH HOH A . B 2 HOH 24 224 14 HOH HOH A . B 2 HOH 25 225 18 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 17 ? CG ? A GLU 17 CG 2 1 Y 1 A GLU 17 ? CD ? A GLU 17 CD 3 1 Y 1 A GLU 17 ? OE1 ? A GLU 17 OE1 4 1 Y 1 A GLU 17 ? OE2 ? A GLU 17 OE2 5 1 Y 1 A LYS 31 ? CD ? A LYS 31 CD 6 1 Y 1 A LYS 31 ? CE ? A LYS 31 CE 7 1 Y 1 A LYS 31 ? NZ ? A LYS 31 NZ 8 1 Y 1 A ARG 36 ? CD ? A ARG 36 CD 9 1 Y 1 A ARG 36 ? NE ? A ARG 36 NE 10 1 Y 1 A ARG 36 ? CZ ? A ARG 36 CZ 11 1 Y 1 A ARG 36 ? NH1 ? A ARG 36 NH1 12 1 Y 1 A ARG 36 ? NH2 ? A ARG 36 NH2 13 1 Y 1 A LYS 46 ? CE ? A LYS 46 CE 14 1 Y 1 A LYS 46 ? NZ ? A LYS 46 NZ 15 1 Y 1 A GLU 48 ? CG ? A GLU 48 CG 16 1 Y 1 A GLU 48 ? CD ? A GLU 48 CD 17 1 Y 1 A GLU 48 ? OE1 ? A GLU 48 OE1 18 1 Y 1 A GLU 48 ? OE2 ? A GLU 48 OE2 19 1 Y 1 A LYS 74 ? CD ? A LYS 74 CD 20 1 Y 1 A LYS 74 ? CE ? A LYS 74 CE 21 1 Y 1 A LYS 74 ? NZ ? A LYS 74 NZ 22 1 Y 1 A LYS 77 ? CD ? A LYS 77 CD 23 1 Y 1 A LYS 77 ? CE ? A LYS 77 CE 24 1 Y 1 A LYS 77 ? NZ ? A LYS 77 NZ 25 1 Y 1 A GLU 79 ? CD ? A GLU 79 CD 26 1 Y 1 A GLU 79 ? OE1 ? A GLU 79 OE1 27 1 Y 1 A GLU 79 ? OE2 ? A GLU 79 OE2 28 1 Y 1 A GLU 97 ? CD ? A GLU 97 CD 29 1 Y 1 A GLU 97 ? OE1 ? A GLU 97 OE1 30 1 Y 1 A GLU 97 ? OE2 ? A GLU 97 OE2 31 1 Y 1 A LYS 105 ? CD ? A LYS 105 CD 32 1 Y 1 A LYS 105 ? CE ? A LYS 105 CE 33 1 Y 1 A LYS 105 ? NZ ? A LYS 105 NZ 34 1 Y 1 A GLU 132 ? CG ? A GLU 132 CG 35 1 Y 1 A GLU 132 ? CD ? A GLU 132 CD 36 1 Y 1 A GLU 132 ? OE1 ? A GLU 132 OE1 37 1 Y 1 A GLU 132 ? OE2 ? A GLU 132 OE2 38 1 Y 1 A LYS 136 ? CG ? A LYS 136 CG 39 1 Y 1 A LYS 136 ? CD ? A LYS 136 CD 40 1 Y 1 A LYS 136 ? CE ? A LYS 136 CE 41 1 Y 1 A LYS 136 ? NZ ? A LYS 136 NZ 42 1 Y 1 A LYS 139 ? CD ? A LYS 139 CD 43 1 Y 1 A LYS 139 ? CE ? A LYS 139 CE 44 1 Y 1 A LYS 139 ? NZ ? A LYS 139 NZ 45 1 Y 1 A LYS 142 ? CD ? A LYS 142 CD 46 1 Y 1 A LYS 142 ? CE ? A LYS 142 CE 47 1 Y 1 A LYS 142 ? NZ ? A LYS 142 NZ 48 1 Y 1 A GLU 159 ? CG ? A GLU 159 CG 49 1 Y 1 A GLU 159 ? CD ? A GLU 159 CD 50 1 Y 1 A GLU 159 ? OE1 ? A GLU 159 OE1 51 1 Y 1 A GLU 159 ? OE2 ? A GLU 159 OE2 52 1 Y 1 A VAL 161 ? CG1 ? A VAL 161 CG1 53 1 Y 1 A VAL 161 ? CG2 ? A VAL 161 CG2 54 1 Y 1 A ARG 162 ? CD ? A ARG 162 CD 55 1 Y 1 A ARG 162 ? NE ? A ARG 162 NE 56 1 Y 1 A ARG 162 ? CZ ? A ARG 162 CZ 57 1 Y 1 A ARG 162 ? NH1 ? A ARG 162 NH1 58 1 Y 1 A ARG 162 ? NH2 ? A ARG 162 NH2 59 1 Y 1 A MET 165 ? CG ? A MET 165 CG 60 1 Y 1 A MET 165 ? SD ? A MET 165 SD 61 1 Y 1 A MET 165 ? CE ? A MET 165 CE 62 1 Y 1 A PHE 175 ? CG ? A PHE 175 CG 63 1 Y 1 A PHE 175 ? CD1 ? A PHE 175 CD1 64 1 Y 1 A PHE 175 ? CD2 ? A PHE 175 CD2 65 1 Y 1 A PHE 175 ? CE1 ? A PHE 175 CE1 66 1 Y 1 A PHE 175 ? CE2 ? A PHE 175 CE2 67 1 Y 1 A PHE 175 ? CZ ? A PHE 175 CZ 68 1 Y 1 A ARG 177 ? CG ? A ARG 177 CG 69 1 Y 1 A ARG 177 ? CD ? A ARG 177 CD 70 1 Y 1 A ARG 177 ? NE ? A ARG 177 NE 71 1 Y 1 A ARG 177 ? CZ ? A ARG 177 CZ 72 1 Y 1 A ARG 177 ? NH1 ? A ARG 177 NH1 73 1 Y 1 A ARG 177 ? NH2 ? A ARG 177 NH2 74 1 Y 1 A VAL 179 ? CG1 ? A VAL 179 CG1 75 1 Y 1 A VAL 179 ? CG2 ? A VAL 179 CG2 76 1 Y 1 A TYR 183 ? CG ? A TYR 183 CG 77 1 Y 1 A TYR 183 ? CD1 ? A TYR 183 CD1 78 1 Y 1 A TYR 183 ? CD2 ? A TYR 183 CD2 79 1 Y 1 A TYR 183 ? CE1 ? A TYR 183 CE1 80 1 Y 1 A TYR 183 ? CE2 ? A TYR 183 CE2 81 1 Y 1 A TYR 183 ? CZ ? A TYR 183 CZ 82 1 Y 1 A TYR 183 ? OH ? A TYR 183 OH 83 1 Y 1 A GLU 185 ? CG ? A GLU 185 CG 84 1 Y 1 A GLU 185 ? CD ? A GLU 185 CD 85 1 Y 1 A GLU 185 ? OE1 ? A GLU 185 OE1 86 1 Y 1 A GLU 185 ? OE2 ? A GLU 185 OE2 87 1 Y 1 A LYS 188 ? CG ? A LYS 188 CG 88 1 Y 1 A LYS 188 ? CD ? A LYS 188 CD 89 1 Y 1 A LYS 188 ? CE ? A LYS 188 CE 90 1 Y 1 A LYS 188 ? NZ ? A LYS 188 NZ 91 1 Y 1 A LEU 189 ? CG ? A LEU 189 CG 92 1 Y 1 A LEU 189 ? CD1 ? A LEU 189 CD1 93 1 Y 1 A LEU 189 ? CD2 ? A LEU 189 CD2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? 714n 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? 714n 2 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? 2.8.2 3 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? dev_3112 4 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 6VEH _cell.details ? _cell.formula_units_Z ? _cell.length_a 88.182 _cell.length_a_esd ? _cell.length_b 88.182 _cell.length_b_esd ? _cell.length_c 65.244 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 9 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6VEH _symmetry.cell_setting ? _symmetry.Int_Tables_number 146 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'H 3' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6VEH _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.32 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 47.03 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;1mM DL-glutamic acid monohydrate, 100mM DL-alanine, 100mM glycine, 100mM DL-lysine monohydrochloride, 100mM DL-serine, 100mM Tris (base), 100mM BICINE, 20% (v/v) ethylene glycol, 10 % (w/v) PEG 8000, pH8.5 ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details 'liquid nitrogen stream' _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-02-10 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.977408 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ALS BEAMLINE 5.0.1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.977408 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 5.0.1 _diffrn_source.pdbx_synchrotron_site ALS # _reflns.B_iso_Wilson_estimate 40.430 _reflns.entry_id 6VEH _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.300 _reflns.d_resolution_low 100.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 8361 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100.000 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 5.600 _reflns.pdbx_Rmerge_I_obs 0.119 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 6.200 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.944 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.131 _reflns.pdbx_Rpim_I_all 0.055 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 46905 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split 2.300 2.340 ? ? ? ? ? ? 388 100.000 ? ? ? ? 1.198 ? ? ? ? ? ? ? ? 5.000 ? 0.714 ? ? 1.341 0.598 ? 1 1 0.619 ? ? 2.340 2.380 ? ? ? ? ? ? 454 100.000 ? ? ? ? 0.948 ? ? ? ? ? ? ? ? 5.200 ? 0.673 ? ? 1.053 0.458 ? 2 1 0.586 ? ? 2.380 2.430 ? ? ? ? ? ? 410 100.000 ? ? ? ? 0.845 ? ? ? ? ? ? ? ? 5.400 ? 0.759 ? ? 0.935 0.400 ? 3 1 0.653 ? ? 2.430 2.480 ? ? ? ? ? ? 423 100.000 ? ? ? ? 0.835 ? ? ? ? ? ? ? ? 5.600 ? 0.715 ? ? 0.921 0.389 ? 4 1 0.780 ? ? 2.480 2.530 ? ? ? ? ? ? 403 100.000 ? ? ? ? 0.617 ? ? ? ? ? ? ? ? 5.500 ? 1.248 ? ? 0.683 0.290 ? 5 1 0.805 ? ? 2.530 2.590 ? ? ? ? ? ? 424 100.000 ? ? ? ? 0.674 ? ? ? ? ? ? ? ? 5.700 ? 0.769 ? ? 0.743 0.312 ? 6 1 0.793 ? ? 2.590 2.660 ? ? ? ? ? ? 418 100.000 ? ? ? ? 0.546 ? ? ? ? ? ? ? ? 5.700 ? 0.860 ? ? 0.603 0.253 ? 7 1 0.878 ? ? 2.660 2.730 ? ? ? ? ? ? 412 100.000 ? ? ? ? 0.411 ? ? ? ? ? ? ? ? 5.700 ? 0.950 ? ? 0.453 0.190 ? 8 1 0.904 ? ? 2.730 2.810 ? ? ? ? ? ? 430 100.000 ? ? ? ? 0.380 ? ? ? ? ? ? ? ? 5.700 ? 1.023 ? ? 0.418 0.175 ? 9 1 0.916 ? ? 2.810 2.900 ? ? ? ? ? ? 427 100.000 ? ? ? ? 0.299 ? ? ? ? ? ? ? ? 5.700 ? 1.003 ? ? 0.330 0.138 ? 10 1 0.952 ? ? 2.900 3.000 ? ? ? ? ? ? 386 100.000 ? ? ? ? 0.279 ? ? ? ? ? ? ? ? 5.700 ? 0.958 ? ? 0.307 0.128 ? 11 1 0.950 ? ? 3.000 3.120 ? ? ? ? ? ? 431 100.000 ? ? ? ? 0.255 ? ? ? ? ? ? ? ? 5.700 ? 1.030 ? ? 0.280 0.117 ? 12 1 0.951 ? ? 3.120 3.260 ? ? ? ? ? ? 428 100.000 ? ? ? ? 0.228 ? ? ? ? ? ? ? ? 5.700 ? 1.004 ? ? 0.251 0.106 ? 13 1 0.965 ? ? 3.260 3.440 ? ? ? ? ? ? 408 100.000 ? ? ? ? 0.152 ? ? ? ? ? ? ? ? 5.600 ? 0.968 ? ? 0.167 0.070 ? 14 1 0.973 ? ? 3.440 3.650 ? ? ? ? ? ? 435 100.000 ? ? ? ? 0.140 ? ? ? ? ? ? ? ? 5.700 ? 0.985 ? ? 0.154 0.064 ? 15 1 0.987 ? ? 3.650 3.930 ? ? ? ? ? ? 417 100.000 ? ? ? ? 0.124 ? ? ? ? ? ? ? ? 5.700 ? 1.005 ? ? 0.137 0.057 ? 16 1 0.984 ? ? 3.930 4.330 ? ? ? ? ? ? 409 100.000 ? ? ? ? 0.088 ? ? ? ? ? ? ? ? 5.600 ? 0.993 ? ? 0.097 0.041 ? 17 1 0.993 ? ? 4.330 4.960 ? ? ? ? ? ? 423 100.000 ? ? ? ? 0.067 ? ? ? ? ? ? ? ? 5.500 ? 1.059 ? ? 0.074 0.032 ? 18 1 0.995 ? ? 4.960 6.240 ? ? ? ? ? ? 416 100.000 ? ? ? ? 0.059 ? ? ? ? ? ? ? ? 5.900 ? 1.039 ? ? 0.065 0.027 ? 19 1 0.997 ? ? 6.240 100.000 ? ? ? ? ? ? 419 99.800 ? ? ? ? 0.033 ? ? ? ? ? ? ? ? 5.800 ? 1.077 ? ? 0.036 0.015 ? 20 1 0.999 ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 121.210 _refine.B_iso_mean 53.4257 _refine.B_iso_min 26.150 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6VEH _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.3030 _refine.ls_d_res_low 44.0910 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 7654 _refine.ls_number_reflns_R_free 756 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 91.5200 _refine.ls_percent_reflns_R_free 9.8800 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2045 _refine.ls_R_factor_R_free 0.2261 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2021 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.150 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 'Computational design model' _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 25.6400 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2500 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.3030 _refine_hist.d_res_low 44.0910 _refine_hist.number_atoms_solvent 25 _refine_hist.number_atoms_total 1274 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 180 _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent 50.80 _refine_hist.pdbx_number_atoms_protein 1249 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.3035 2.4813 . . 128 1210 80.0000 . . . 0.2700 0.0000 0.2417 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.4813 2.7310 . . 151 1321 89.0000 . . . 0.3052 0.0000 0.2316 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.7310 3.1261 . . 154 1429 94.0000 . . . 0.2467 0.0000 0.2119 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.1261 3.9382 . . 157 1447 95.0000 . . . 0.2064 0.0000 0.1929 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.9382 44.0910 . . 166 1491 99.0000 . . . 0.2085 0.0000 0.1919 . . . . . . . . . . . # _struct.entry_id 6VEH _struct.title 'Computationally designed C3-symmetric homotrimer from HEAT repeat protein' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6VEH _struct_keywords.text 'designed protein, vaccine, DE NOVO PROTEIN' _struct_keywords.pdbx_keywords 'DE NOVO PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 6VEH _struct_ref.pdbx_db_accession 6VEH _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6VEH _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 196 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 6VEH _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 196 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 196 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details trimeric _pdbx_struct_assembly.oligomeric_count 3 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 4540 ? 1 MORE -61 ? 1 'SSA (A^2)' 22780 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support SAXS _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_655 -y+1,x-y,z -0.5000000000 -0.8660254038 0.0000000000 88.1820000000 0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_665 -x+y+1,-x+1,z -0.5000000000 0.8660254038 0.0000000000 44.0910000000 -0.8660254038 -0.5000000000 0.0000000000 76.3678521565 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 2 ? MET A 13 ? THR A 2 MET A 13 1 ? 12 HELX_P HELX_P2 AA2 LEU A 14 ? LEU A 16 ? LEU A 14 LEU A 16 5 ? 3 HELX_P HELX_P3 AA3 LYS A 18 ? GLY A 33 ? LYS A 18 GLY A 33 1 ? 16 HELX_P HELX_P4 AA4 ASP A 34 ? ARG A 36 ? ASP A 34 ARG A 36 5 ? 3 HELX_P HELX_P5 AA5 ALA A 37 ? LEU A 45 ? ALA A 37 LEU A 45 1 ? 9 HELX_P HELX_P6 AA6 ASP A 49 ? GLY A 64 ? ASP A 49 GLY A 64 1 ? 16 HELX_P HELX_P7 AA7 ASP A 65 ? ARG A 67 ? ASP A 65 ARG A 67 5 ? 3 HELX_P HELX_P8 AA8 ALA A 68 ? LEU A 76 ? ALA A 68 LEU A 76 1 ? 9 HELX_P HELX_P9 AA9 ASP A 80 ? GLY A 95 ? ASP A 80 GLY A 95 1 ? 16 HELX_P HELX_P10 AB1 ASP A 96 ? ARG A 98 ? ASP A 96 ARG A 98 5 ? 3 HELX_P HELX_P11 AB2 ALA A 99 ? LEU A 107 ? ALA A 99 LEU A 107 1 ? 9 HELX_P HELX_P12 AB3 ASP A 111 ? GLY A 126 ? ASP A 111 GLY A 126 1 ? 16 HELX_P HELX_P13 AB4 ASP A 127 ? ARG A 129 ? ASP A 127 ARG A 129 5 ? 3 HELX_P HELX_P14 AB5 ALA A 130 ? LEU A 138 ? ALA A 130 LEU A 138 1 ? 9 HELX_P HELX_P15 AB6 LYS A 142 ? GLY A 157 ? LYS A 142 GLY A 157 1 ? 16 HELX_P HELX_P16 AB7 GLY A 157 ? MET A 165 ? GLY A 157 MET A 165 1 ? 9 HELX_P HELX_P17 AB8 ALA A 176 ? LEU A 189 ? ALA A 176 LEU A 189 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag both _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id FME _struct_conn.ptnr1_label_seq_id 1 _struct_conn.ptnr1_label_atom_id C _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id THR _struct_conn.ptnr2_label_seq_id 2 _struct_conn.ptnr2_label_atom_id N _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id FME _struct_conn.ptnr1_auth_seq_id 1 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id THR _struct_conn.ptnr2_auth_seq_id 2 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.329 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 ALA _pdbx_validate_close_contact.auth_seq_id_1 180 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 H _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 LEU _pdbx_validate_close_contact.auth_seq_id_2 184 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.60 # _phasing.method MR # _pdbx_entry_details.entry_id 6VEH _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLU 166 ? A GLU 166 2 1 Y 1 A LYS 167 ? A LYS 167 3 1 Y 1 A LEU 168 ? A LEU 168 4 1 Y 1 A ALA 169 ? A ALA 169 5 1 Y 1 A GLU 170 ? A GLU 170 6 1 Y 1 A THR 171 ? A THR 171 7 1 Y 1 A GLY 172 ? A GLY 172 8 1 Y 1 A THR 173 ? A THR 173 9 1 Y 1 A GLY 174 ? A GLY 174 10 1 Y 1 A GLU 190 ? A GLU 190 11 1 Y 1 A HIS 191 ? A HIS 191 12 1 Y 1 A HIS 192 ? A HIS 192 13 1 Y 1 A HIS 193 ? A HIS 193 14 1 Y 1 A HIS 194 ? A HIS 194 15 1 Y 1 A HIS 195 ? A HIS 195 16 1 Y 1 A HIS 196 ? A HIS 196 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 FME N N N N 74 FME CN C N N 75 FME O1 O N N 76 FME CA C N S 77 FME CB C N N 78 FME CG C N N 79 FME SD S N N 80 FME CE C N N 81 FME C C N N 82 FME O O N N 83 FME OXT O N N 84 FME H H N N 85 FME HCN H N N 86 FME HA H N N 87 FME HB2 H N N 88 FME HB3 H N N 89 FME HG2 H N N 90 FME HG3 H N N 91 FME HE1 H N N 92 FME HE2 H N N 93 FME HE3 H N N 94 FME HXT H N N 95 GLN N N N N 96 GLN CA C N S 97 GLN C C N N 98 GLN O O N N 99 GLN CB C N N 100 GLN CG C N N 101 GLN CD C N N 102 GLN OE1 O N N 103 GLN NE2 N N N 104 GLN OXT O N N 105 GLN H H N N 106 GLN H2 H N N 107 GLN HA H N N 108 GLN HB2 H N N 109 GLN HB3 H N N 110 GLN HG2 H N N 111 GLN HG3 H N N 112 GLN HE21 H N N 113 GLN HE22 H N N 114 GLN HXT H N N 115 GLU N N N N 116 GLU CA C N S 117 GLU C C N N 118 GLU O O N N 119 GLU CB C N N 120 GLU CG C N N 121 GLU CD C N N 122 GLU OE1 O N N 123 GLU OE2 O N N 124 GLU OXT O N N 125 GLU H H N N 126 GLU H2 H N N 127 GLU HA H N N 128 GLU HB2 H N N 129 GLU HB3 H N N 130 GLU HG2 H N N 131 GLU HG3 H N N 132 GLU HE2 H N N 133 GLU HXT H N N 134 GLY N N N N 135 GLY CA C N N 136 GLY C C N N 137 GLY O O N N 138 GLY OXT O N N 139 GLY H H N N 140 GLY H2 H N N 141 GLY HA2 H N N 142 GLY HA3 H N N 143 GLY HXT H N N 144 HIS N N N N 145 HIS CA C N S 146 HIS C C N N 147 HIS O O N N 148 HIS CB C N N 149 HIS CG C Y N 150 HIS ND1 N Y N 151 HIS CD2 C Y N 152 HIS CE1 C Y N 153 HIS NE2 N Y N 154 HIS OXT O N N 155 HIS H H N N 156 HIS H2 H N N 157 HIS HA H N N 158 HIS HB2 H N N 159 HIS HB3 H N N 160 HIS HD1 H N N 161 HIS HD2 H N N 162 HIS HE1 H N N 163 HIS HE2 H N N 164 HIS HXT H N N 165 HOH O O N N 166 HOH H1 H N N 167 HOH H2 H N N 168 ILE N N N N 169 ILE CA C N S 170 ILE C C N N 171 ILE O O N N 172 ILE CB C N S 173 ILE CG1 C N N 174 ILE CG2 C N N 175 ILE CD1 C N N 176 ILE OXT O N N 177 ILE H H N N 178 ILE H2 H N N 179 ILE HA H N N 180 ILE HB H N N 181 ILE HG12 H N N 182 ILE HG13 H N N 183 ILE HG21 H N N 184 ILE HG22 H N N 185 ILE HG23 H N N 186 ILE HD11 H N N 187 ILE HD12 H N N 188 ILE HD13 H N N 189 ILE HXT H N N 190 LEU N N N N 191 LEU CA C N S 192 LEU C C N N 193 LEU O O N N 194 LEU CB C N N 195 LEU CG C N N 196 LEU CD1 C N N 197 LEU CD2 C N N 198 LEU OXT O N N 199 LEU H H N N 200 LEU H2 H N N 201 LEU HA H N N 202 LEU HB2 H N N 203 LEU HB3 H N N 204 LEU HG H N N 205 LEU HD11 H N N 206 LEU HD12 H N N 207 LEU HD13 H N N 208 LEU HD21 H N N 209 LEU HD22 H N N 210 LEU HD23 H N N 211 LEU HXT H N N 212 LYS N N N N 213 LYS CA C N S 214 LYS C C N N 215 LYS O O N N 216 LYS CB C N N 217 LYS CG C N N 218 LYS CD C N N 219 LYS CE C N N 220 LYS NZ N N N 221 LYS OXT O N N 222 LYS H H N N 223 LYS H2 H N N 224 LYS HA H N N 225 LYS HB2 H N N 226 LYS HB3 H N N 227 LYS HG2 H N N 228 LYS HG3 H N N 229 LYS HD2 H N N 230 LYS HD3 H N N 231 LYS HE2 H N N 232 LYS HE3 H N N 233 LYS HZ1 H N N 234 LYS HZ2 H N N 235 LYS HZ3 H N N 236 LYS HXT H N N 237 MET N N N N 238 MET CA C N S 239 MET C C N N 240 MET O O N N 241 MET CB C N N 242 MET CG C N N 243 MET SD S N N 244 MET CE C N N 245 MET OXT O N N 246 MET H H N N 247 MET H2 H N N 248 MET HA H N N 249 MET HB2 H N N 250 MET HB3 H N N 251 MET HG2 H N N 252 MET HG3 H N N 253 MET HE1 H N N 254 MET HE2 H N N 255 MET HE3 H N N 256 MET HXT H N N 257 PHE N N N N 258 PHE CA C N S 259 PHE C C N N 260 PHE O O N N 261 PHE CB C N N 262 PHE CG C Y N 263 PHE CD1 C Y N 264 PHE CD2 C Y N 265 PHE CE1 C Y N 266 PHE CE2 C Y N 267 PHE CZ C Y N 268 PHE OXT O N N 269 PHE H H N N 270 PHE H2 H N N 271 PHE HA H N N 272 PHE HB2 H N N 273 PHE HB3 H N N 274 PHE HD1 H N N 275 PHE HD2 H N N 276 PHE HE1 H N N 277 PHE HE2 H N N 278 PHE HZ H N N 279 PHE HXT H N N 280 PRO N N N N 281 PRO CA C N S 282 PRO C C N N 283 PRO O O N N 284 PRO CB C N N 285 PRO CG C N N 286 PRO CD C N N 287 PRO OXT O N N 288 PRO H H N N 289 PRO HA H N N 290 PRO HB2 H N N 291 PRO HB3 H N N 292 PRO HG2 H N N 293 PRO HG3 H N N 294 PRO HD2 H N N 295 PRO HD3 H N N 296 PRO HXT H N N 297 SER N N N N 298 SER CA C N S 299 SER C C N N 300 SER O O N N 301 SER CB C N N 302 SER OG O N N 303 SER OXT O N N 304 SER H H N N 305 SER H2 H N N 306 SER HA H N N 307 SER HB2 H N N 308 SER HB3 H N N 309 SER HG H N N 310 SER HXT H N N 311 THR N N N N 312 THR CA C N S 313 THR C C N N 314 THR O O N N 315 THR CB C N R 316 THR OG1 O N N 317 THR CG2 C N N 318 THR OXT O N N 319 THR H H N N 320 THR H2 H N N 321 THR HA H N N 322 THR HB H N N 323 THR HG1 H N N 324 THR HG21 H N N 325 THR HG22 H N N 326 THR HG23 H N N 327 THR HXT H N N 328 TYR N N N N 329 TYR CA C N S 330 TYR C C N N 331 TYR O O N N 332 TYR CB C N N 333 TYR CG C Y N 334 TYR CD1 C Y N 335 TYR CD2 C Y N 336 TYR CE1 C Y N 337 TYR CE2 C Y N 338 TYR CZ C Y N 339 TYR OH O N N 340 TYR OXT O N N 341 TYR H H N N 342 TYR H2 H N N 343 TYR HA H N N 344 TYR HB2 H N N 345 TYR HB3 H N N 346 TYR HD1 H N N 347 TYR HD2 H N N 348 TYR HE1 H N N 349 TYR HE2 H N N 350 TYR HH H N N 351 TYR HXT H N N 352 VAL N N N N 353 VAL CA C N S 354 VAL C C N N 355 VAL O O N N 356 VAL CB C N N 357 VAL CG1 C N N 358 VAL CG2 C N N 359 VAL OXT O N N 360 VAL H H N N 361 VAL H2 H N N 362 VAL HA H N N 363 VAL HB H N N 364 VAL HG11 H N N 365 VAL HG12 H N N 366 VAL HG13 H N N 367 VAL HG21 H N N 368 VAL HG22 H N N 369 VAL HG23 H N N 370 VAL HXT H N N 371 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 FME N CN sing N N 70 FME N CA sing N N 71 FME N H sing N N 72 FME CN O1 doub N N 73 FME CN HCN sing N N 74 FME CA CB sing N N 75 FME CA C sing N N 76 FME CA HA sing N N 77 FME CB CG sing N N 78 FME CB HB2 sing N N 79 FME CB HB3 sing N N 80 FME CG SD sing N N 81 FME CG HG2 sing N N 82 FME CG HG3 sing N N 83 FME SD CE sing N N 84 FME CE HE1 sing N N 85 FME CE HE2 sing N N 86 FME CE HE3 sing N N 87 FME C O doub N N 88 FME C OXT sing N N 89 FME OXT HXT sing N N 90 GLN N CA sing N N 91 GLN N H sing N N 92 GLN N H2 sing N N 93 GLN CA C sing N N 94 GLN CA CB sing N N 95 GLN CA HA sing N N 96 GLN C O doub N N 97 GLN C OXT sing N N 98 GLN CB CG sing N N 99 GLN CB HB2 sing N N 100 GLN CB HB3 sing N N 101 GLN CG CD sing N N 102 GLN CG HG2 sing N N 103 GLN CG HG3 sing N N 104 GLN CD OE1 doub N N 105 GLN CD NE2 sing N N 106 GLN NE2 HE21 sing N N 107 GLN NE2 HE22 sing N N 108 GLN OXT HXT sing N N 109 GLU N CA sing N N 110 GLU N H sing N N 111 GLU N H2 sing N N 112 GLU CA C sing N N 113 GLU CA CB sing N N 114 GLU CA HA sing N N 115 GLU C O doub N N 116 GLU C OXT sing N N 117 GLU CB CG sing N N 118 GLU CB HB2 sing N N 119 GLU CB HB3 sing N N 120 GLU CG CD sing N N 121 GLU CG HG2 sing N N 122 GLU CG HG3 sing N N 123 GLU CD OE1 doub N N 124 GLU CD OE2 sing N N 125 GLU OE2 HE2 sing N N 126 GLU OXT HXT sing N N 127 GLY N CA sing N N 128 GLY N H sing N N 129 GLY N H2 sing N N 130 GLY CA C sing N N 131 GLY CA HA2 sing N N 132 GLY CA HA3 sing N N 133 GLY C O doub N N 134 GLY C OXT sing N N 135 GLY OXT HXT sing N N 136 HIS N CA sing N N 137 HIS N H sing N N 138 HIS N H2 sing N N 139 HIS CA C sing N N 140 HIS CA CB sing N N 141 HIS CA HA sing N N 142 HIS C O doub N N 143 HIS C OXT sing N N 144 HIS CB CG sing N N 145 HIS CB HB2 sing N N 146 HIS CB HB3 sing N N 147 HIS CG ND1 sing Y N 148 HIS CG CD2 doub Y N 149 HIS ND1 CE1 doub Y N 150 HIS ND1 HD1 sing N N 151 HIS CD2 NE2 sing Y N 152 HIS CD2 HD2 sing N N 153 HIS CE1 NE2 sing Y N 154 HIS CE1 HE1 sing N N 155 HIS NE2 HE2 sing N N 156 HIS OXT HXT sing N N 157 HOH O H1 sing N N 158 HOH O H2 sing N N 159 ILE N CA sing N N 160 ILE N H sing N N 161 ILE N H2 sing N N 162 ILE CA C sing N N 163 ILE CA CB sing N N 164 ILE CA HA sing N N 165 ILE C O doub N N 166 ILE C OXT sing N N 167 ILE CB CG1 sing N N 168 ILE CB CG2 sing N N 169 ILE CB HB sing N N 170 ILE CG1 CD1 sing N N 171 ILE CG1 HG12 sing N N 172 ILE CG1 HG13 sing N N 173 ILE CG2 HG21 sing N N 174 ILE CG2 HG22 sing N N 175 ILE CG2 HG23 sing N N 176 ILE CD1 HD11 sing N N 177 ILE CD1 HD12 sing N N 178 ILE CD1 HD13 sing N N 179 ILE OXT HXT sing N N 180 LEU N CA sing N N 181 LEU N H sing N N 182 LEU N H2 sing N N 183 LEU CA C sing N N 184 LEU CA CB sing N N 185 LEU CA HA sing N N 186 LEU C O doub N N 187 LEU C OXT sing N N 188 LEU CB CG sing N N 189 LEU CB HB2 sing N N 190 LEU CB HB3 sing N N 191 LEU CG CD1 sing N N 192 LEU CG CD2 sing N N 193 LEU CG HG sing N N 194 LEU CD1 HD11 sing N N 195 LEU CD1 HD12 sing N N 196 LEU CD1 HD13 sing N N 197 LEU CD2 HD21 sing N N 198 LEU CD2 HD22 sing N N 199 LEU CD2 HD23 sing N N 200 LEU OXT HXT sing N N 201 LYS N CA sing N N 202 LYS N H sing N N 203 LYS N H2 sing N N 204 LYS CA C sing N N 205 LYS CA CB sing N N 206 LYS CA HA sing N N 207 LYS C O doub N N 208 LYS C OXT sing N N 209 LYS CB CG sing N N 210 LYS CB HB2 sing N N 211 LYS CB HB3 sing N N 212 LYS CG CD sing N N 213 LYS CG HG2 sing N N 214 LYS CG HG3 sing N N 215 LYS CD CE sing N N 216 LYS CD HD2 sing N N 217 LYS CD HD3 sing N N 218 LYS CE NZ sing N N 219 LYS CE HE2 sing N N 220 LYS CE HE3 sing N N 221 LYS NZ HZ1 sing N N 222 LYS NZ HZ2 sing N N 223 LYS NZ HZ3 sing N N 224 LYS OXT HXT sing N N 225 MET N CA sing N N 226 MET N H sing N N 227 MET N H2 sing N N 228 MET CA C sing N N 229 MET CA CB sing N N 230 MET CA HA sing N N 231 MET C O doub N N 232 MET C OXT sing N N 233 MET CB CG sing N N 234 MET CB HB2 sing N N 235 MET CB HB3 sing N N 236 MET CG SD sing N N 237 MET CG HG2 sing N N 238 MET CG HG3 sing N N 239 MET SD CE sing N N 240 MET CE HE1 sing N N 241 MET CE HE2 sing N N 242 MET CE HE3 sing N N 243 MET OXT HXT sing N N 244 PHE N CA sing N N 245 PHE N H sing N N 246 PHE N H2 sing N N 247 PHE CA C sing N N 248 PHE CA CB sing N N 249 PHE CA HA sing N N 250 PHE C O doub N N 251 PHE C OXT sing N N 252 PHE CB CG sing N N 253 PHE CB HB2 sing N N 254 PHE CB HB3 sing N N 255 PHE CG CD1 doub Y N 256 PHE CG CD2 sing Y N 257 PHE CD1 CE1 sing Y N 258 PHE CD1 HD1 sing N N 259 PHE CD2 CE2 doub Y N 260 PHE CD2 HD2 sing N N 261 PHE CE1 CZ doub Y N 262 PHE CE1 HE1 sing N N 263 PHE CE2 CZ sing Y N 264 PHE CE2 HE2 sing N N 265 PHE CZ HZ sing N N 266 PHE OXT HXT sing N N 267 PRO N CA sing N N 268 PRO N CD sing N N 269 PRO N H sing N N 270 PRO CA C sing N N 271 PRO CA CB sing N N 272 PRO CA HA sing N N 273 PRO C O doub N N 274 PRO C OXT sing N N 275 PRO CB CG sing N N 276 PRO CB HB2 sing N N 277 PRO CB HB3 sing N N 278 PRO CG CD sing N N 279 PRO CG HG2 sing N N 280 PRO CG HG3 sing N N 281 PRO CD HD2 sing N N 282 PRO CD HD3 sing N N 283 PRO OXT HXT sing N N 284 SER N CA sing N N 285 SER N H sing N N 286 SER N H2 sing N N 287 SER CA C sing N N 288 SER CA CB sing N N 289 SER CA HA sing N N 290 SER C O doub N N 291 SER C OXT sing N N 292 SER CB OG sing N N 293 SER CB HB2 sing N N 294 SER CB HB3 sing N N 295 SER OG HG sing N N 296 SER OXT HXT sing N N 297 THR N CA sing N N 298 THR N H sing N N 299 THR N H2 sing N N 300 THR CA C sing N N 301 THR CA CB sing N N 302 THR CA HA sing N N 303 THR C O doub N N 304 THR C OXT sing N N 305 THR CB OG1 sing N N 306 THR CB CG2 sing N N 307 THR CB HB sing N N 308 THR OG1 HG1 sing N N 309 THR CG2 HG21 sing N N 310 THR CG2 HG22 sing N N 311 THR CG2 HG23 sing N N 312 THR OXT HXT sing N N 313 TYR N CA sing N N 314 TYR N H sing N N 315 TYR N H2 sing N N 316 TYR CA C sing N N 317 TYR CA CB sing N N 318 TYR CA HA sing N N 319 TYR C O doub N N 320 TYR C OXT sing N N 321 TYR CB CG sing N N 322 TYR CB HB2 sing N N 323 TYR CB HB3 sing N N 324 TYR CG CD1 doub Y N 325 TYR CG CD2 sing Y N 326 TYR CD1 CE1 sing Y N 327 TYR CD1 HD1 sing N N 328 TYR CD2 CE2 doub Y N 329 TYR CD2 HD2 sing N N 330 TYR CE1 CZ doub Y N 331 TYR CE1 HE1 sing N N 332 TYR CE2 CZ sing Y N 333 TYR CE2 HE2 sing N N 334 TYR CZ OH sing N N 335 TYR OH HH sing N N 336 TYR OXT HXT sing N N 337 VAL N CA sing N N 338 VAL N H sing N N 339 VAL N H2 sing N N 340 VAL CA C sing N N 341 VAL CA CB sing N N 342 VAL CA HA sing N N 343 VAL C O doub N N 344 VAL C OXT sing N N 345 VAL CB CG1 sing N N 346 VAL CB CG2 sing N N 347 VAL CB HB sing N N 348 VAL CG1 HG11 sing N N 349 VAL CG1 HG12 sing N N 350 VAL CG1 HG13 sing N N 351 VAL CG2 HG21 sing N N 352 VAL CG2 HG22 sing N N 353 VAL CG2 HG23 sing N N 354 VAL OXT HXT sing N N 355 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Department of Energy (DOE, United States)' 'United States' DE-AC02-05CH11231 1 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' P30GM124169 2 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' S10OD018483 3 'Howard Hughes Medical Institute (HHMI)' 'United States' ? 4 # _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'in silico model' _pdbx_initial_refinement_model.source_name Other _pdbx_initial_refinement_model.details 'Computational design model' # _atom_sites.entry_id 6VEH _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.011340 _atom_sites.fract_transf_matrix[1][2] 0.006547 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013095 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.015327 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_