data_6VG5 # _entry.id 6VG5 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6VG5 pdb_00006vg5 10.2210/pdb6vg5/pdb WWPDB D_1000245999 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6VG5 _pdbx_database_status.recvd_initial_deposition_date 2020-01-07 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'White, M.' 1 ? 'Xia, H.' 2 ? 'Shi, P.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Proc.Natl.Acad.Sci.USA _citation.journal_id_ASTM PNASA6 _citation.journal_id_CSD 0040 _citation.journal_id_ISSN 1091-6490 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 117 _citation.language ? _citation.page_first 17992 _citation.page_last 18001 _citation.title 'A cocrystal structure of dengue capsid protein in complex of inhibitor.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1073/pnas.2003056117 _citation.pdbx_database_id_PubMed 32669438 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Xia, H.' 1 ? primary 'Xie, X.' 2 ? primary 'Zou, J.' 3 ? primary 'Noble, C.G.' 4 ? primary 'Russell, W.K.' 5 ? primary 'Holthauzen, L.M.F.' 6 ? primary 'Choi, K.H.' 7 ? primary 'White, M.A.' 8 ? primary 'Shi, P.Y.' 9 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 92.550 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6VG5 _cell.details ? _cell.formula_units_Z ? _cell.length_a 40.400 _cell.length_a_esd ? _cell.length_b 25.500 _cell.length_b_esd ? _cell.length_c 68.500 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6VG5 _symmetry.cell_setting ? _symmetry.Int_Tables_number 3 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Capsid premembrane protein' 9400.506 2 ? ? ? ? 2 non-polymer syn 'NITRATE ION' 62.005 14 ? ? ? ? 3 non-polymer syn GLYCEROL 92.094 2 ? ? ? ? 4 non-polymer syn '3-amino-N-(5-phenyl-1,3,4-thiadiazol-2-yl)-6,7,8,9-tetrahydro-5H-cyclohepta[b]thieno[3,2-e]pyridine-2-carboxamide' 421.538 1 ? ? ? ? 5 water nat water 18.015 54 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MNRVSTVQQLTKRFSLGMLQGRGPLKLFMALVAFLRFLTIPPTAGILKRWGTIKKSKAINVLRGFRKEIGRMLNILNRRR R ; _entity_poly.pdbx_seq_one_letter_code_can ;MNRVSTVQQLTKRFSLGMLQGRGPLKLFMALVAFLRFLTIPPTAGILKRWGTIKKSKAINVLRGFRKEIGRMLNILNRRR R ; _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASN n 1 3 ARG n 1 4 VAL n 1 5 SER n 1 6 THR n 1 7 VAL n 1 8 GLN n 1 9 GLN n 1 10 LEU n 1 11 THR n 1 12 LYS n 1 13 ARG n 1 14 PHE n 1 15 SER n 1 16 LEU n 1 17 GLY n 1 18 MET n 1 19 LEU n 1 20 GLN n 1 21 GLY n 1 22 ARG n 1 23 GLY n 1 24 PRO n 1 25 LEU n 1 26 LYS n 1 27 LEU n 1 28 PHE n 1 29 MET n 1 30 ALA n 1 31 LEU n 1 32 VAL n 1 33 ALA n 1 34 PHE n 1 35 LEU n 1 36 ARG n 1 37 PHE n 1 38 LEU n 1 39 THR n 1 40 ILE n 1 41 PRO n 1 42 PRO n 1 43 THR n 1 44 ALA n 1 45 GLY n 1 46 ILE n 1 47 LEU n 1 48 LYS n 1 49 ARG n 1 50 TRP n 1 51 GLY n 1 52 THR n 1 53 ILE n 1 54 LYS n 1 55 LYS n 1 56 SER n 1 57 LYS n 1 58 ALA n 1 59 ILE n 1 60 ASN n 1 61 VAL n 1 62 LEU n 1 63 ARG n 1 64 GLY n 1 65 PHE n 1 66 ARG n 1 67 LYS n 1 68 GLU n 1 69 ILE n 1 70 GLY n 1 71 ARG n 1 72 MET n 1 73 LEU n 1 74 ASN n 1 75 ILE n 1 76 LEU n 1 77 ASN n 1 78 ARG n 1 79 ARG n 1 80 ARG n 1 81 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 81 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Dengue virus 2' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 11060 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A2D2BF61_9FLAV _struct_ref.pdbx_db_accession A0A2D2BF61 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;NRVSTVQQLTKRFSLGMLQGRGPLKLFMALVAFLRFLTIPPTAGILKRWGTIKKSKAINVLRGFRKEIGRMLNILNRRRR ; _struct_ref.pdbx_align_begin 6 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 6VG5 A 2 ? 81 ? A0A2D2BF61 6 ? 85 ? 21 100 2 1 6VG5 B 2 ? 81 ? A0A2D2BF61 6 ? 85 ? 21 100 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6VG5 MET A 1 ? UNP A0A2D2BF61 ? ? 'initiating methionine' 20 1 2 6VG5 MET B 1 ? UNP A0A2D2BF61 ? ? 'initiating methionine' 20 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NO3 non-polymer . 'NITRATE ION' ? 'N O3 -1' 62.005 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 QWY non-polymer . '3-amino-N-(5-phenyl-1,3,4-thiadiazol-2-yl)-6,7,8,9-tetrahydro-5H-cyclohepta[b]thieno[3,2-e]pyridine-2-carboxamide' ? 'C21 H19 N5 O S2' 421.538 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6VG5 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.87 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 34.40 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.8 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '3.0 M NaNO3, 100 mM HEPES pH 6.8, 5% glycerol' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 9M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-03-10 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'Si(111)' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.07812 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 21-ID-D' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.07812 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 21-ID-D _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6VG5 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.500 _reflns.d_resolution_low 50.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 21285 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 93.400 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.100 _reflns.pdbx_Rmerge_I_obs 0.094 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 8.700 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.922 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.103 _reflns.pdbx_Rpim_I_all 0.042 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 129277 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split 1.500 1.530 ? ? ? ? ? ? 815 75.900 ? ? ? ? 0.829 ? ? ? ? ? ? ? ? 5.800 ? 0.705 ? ? 0.910 0.369 ? 1 1 0.695 ? ? 1.530 1.550 ? ? ? ? ? ? 1013 88.400 ? ? ? ? 0.798 ? ? ? ? ? ? ? ? 6.100 ? 0.719 ? ? 0.873 0.349 ? 2 1 0.722 ? ? 1.550 1.580 ? ? ? ? ? ? 1042 92.500 ? ? ? ? 0.718 ? ? ? ? ? ? ? ? 6.400 ? 0.750 ? ? 0.782 0.305 ? 3 1 0.848 ? ? 1.580 1.620 ? ? ? ? ? ? 1061 94.500 ? ? ? ? 0.628 ? ? ? ? ? ? ? ? 6.300 ? 0.773 ? ? 0.684 0.269 ? 4 1 0.874 ? ? 1.620 1.650 ? ? ? ? ? ? 1059 94.300 ? ? ? ? 0.574 ? ? ? ? ? ? ? ? 6.400 ? 0.794 ? ? 0.625 0.244 ? 5 1 0.886 ? ? 1.650 1.690 ? ? ? ? ? ? 1090 94.800 ? ? ? ? 0.505 ? ? ? ? ? ? ? ? 6.200 ? 0.829 ? ? 0.551 0.217 ? 6 1 0.916 ? ? 1.690 1.730 ? ? ? ? ? ? 1039 94.900 ? ? ? ? 0.430 ? ? ? ? ? ? ? ? 6.200 ? 0.861 ? ? 0.469 0.185 ? 7 1 0.931 ? ? 1.730 1.780 ? ? ? ? ? ? 1102 96.200 ? ? ? ? 0.378 ? ? ? ? ? ? ? ? 6.200 ? 0.909 ? ? 0.413 0.163 ? 8 1 0.942 ? ? 1.780 1.830 ? ? ? ? ? ? 1096 95.700 ? ? ? ? 0.325 ? ? ? ? ? ? ? ? 6.200 ? 0.960 ? ? 0.355 0.140 ? 9 1 0.958 ? ? 1.830 1.890 ? ? ? ? ? ? 1059 95.300 ? ? ? ? 0.275 ? ? ? ? ? ? ? ? 6.200 ? 0.981 ? ? 0.301 0.119 ? 10 1 0.966 ? ? 1.890 1.960 ? ? ? ? ? ? 1097 94.600 ? ? ? ? 0.222 ? ? ? ? ? ? ? ? 6.000 ? 1.051 ? ? 0.243 0.098 ? 11 1 0.977 ? ? 1.960 2.040 ? ? ? ? ? ? 970 87.200 ? ? ? ? 0.156 ? ? ? ? ? ? ? ? 5.800 ? 1.060 ? ? 0.172 0.070 ? 12 1 0.988 ? ? 2.040 2.130 ? ? ? ? ? ? 1071 92.700 ? ? ? ? 0.124 ? ? ? ? ? ? ? ? 6.100 ? 1.093 ? ? 0.135 0.054 ? 13 1 0.992 ? ? 2.130 2.240 ? ? ? ? ? ? 1099 97.400 ? ? ? ? 0.103 ? ? ? ? ? ? ? ? 6.400 ? 1.108 ? ? 0.112 0.044 ? 14 1 0.993 ? ? 2.240 2.380 ? ? ? ? ? ? 1108 96.900 ? ? ? ? 0.085 ? ? ? ? ? ? ? ? 6.300 ? 1.083 ? ? 0.092 0.037 ? 15 1 0.996 ? ? 2.380 2.560 ? ? ? ? ? ? 1114 96.900 ? ? ? ? 0.074 ? ? ? ? ? ? ? ? 6.200 ? 1.060 ? ? 0.081 0.033 ? 16 1 0.995 ? ? 2.560 2.820 ? ? ? ? ? ? 1122 97.000 ? ? ? ? 0.065 ? ? ? ? ? ? ? ? 6.000 ? 1.061 ? ? 0.072 0.029 ? 17 1 0.996 ? ? 2.820 3.230 ? ? ? ? ? ? 1099 96.200 ? ? ? ? 0.051 ? ? ? ? ? ? ? ? 5.700 ? 0.912 ? ? 0.056 0.023 ? 18 1 0.996 ? ? 3.230 4.070 ? ? ? ? ? ? 1042 88.300 ? ? ? ? 0.041 ? ? ? ? ? ? ? ? 5.300 ? 0.834 ? ? 0.046 0.020 ? 19 1 0.997 ? ? 4.070 50.000 ? ? ? ? ? ? 1187 97.400 ? ? ? ? 0.041 ? ? ? ? ? ? ? ? 5.800 ? 0.806 ? ? 0.046 0.020 ? 20 1 0.996 ? ? # _refine.aniso_B[1][1] 0.1600 _refine.aniso_B[1][2] -0.0000 _refine.aniso_B[1][3] -0.0700 _refine.aniso_B[2][2] -0.0500 _refine.aniso_B[2][3] -0.0000 _refine.aniso_B[3][3] -0.1100 _refine.B_iso_max 77.500 _refine.B_iso_mean 17.5350 _refine.B_iso_min 6.220 _refine.correlation_coeff_Fo_to_Fc 0.9670 _refine.correlation_coeff_Fo_to_Fc_free 0.9490 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES : REFINED INDIVIDUALLY' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6VG5 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.5000 _refine.ls_d_res_low 40.3900 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 19240 _refine.ls_number_reflns_R_free 973 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 88.5700 _refine.ls_percent_reflns_R_free 4.8000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1478 _refine.ls_R_factor_R_free 0.1937 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1454 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1sfk _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.1190 _refine.pdbx_overall_ESU_R_Free 0.0860 _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 2.8140 _refine.overall_SU_ML 0.0470 _refine.overall_SU_R_Cruickshank_DPI 0.1190 _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 1.5000 _refine_hist.d_res_low 40.3900 _refine_hist.number_atoms_solvent 54 _refine_hist.number_atoms_total 1489 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 162 _refine_hist.pdbx_B_iso_mean_ligand 26.73 _refine_hist.pdbx_B_iso_mean_solvent 28.01 _refine_hist.pdbx_number_atoms_protein 1309 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 126 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.008 0.013 1466 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.002 0.017 1489 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.629 1.670 1949 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.323 1.583 3404 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 4.847 5.000 166 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 30.452 15.974 77 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 12.335 15.000 284 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 12.070 15.000 24 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.064 0.200 174 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.005 0.019 1585 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.019 353 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? 1.585 1.525 652 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 1.582 1.523 651 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 2.124 2.277 813 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 1.102 3.000 2954 ? r_rigid_bond_restr ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.5000 _refine_ls_shell.d_res_low 1.5390 _refine_ls_shell.number_reflns_all 779 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 36 _refine_ls_shell.number_reflns_R_work 743 _refine_ls_shell.percent_reflns_obs 48.0300 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.1970 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.1650 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 6VG5 _struct.title 'DengueV-2 Capsid ST148 inhibitor Complex' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6VG5 _struct_keywords.text 'Dengue, Capsid, Inhibitor, VIRAL PROTEIN, VIRAL PROTEIN-INHIBITOR complex' _struct_keywords.pdbx_keywords 'VIRAL PROTEIN/INHIBITOR' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 2 ? E N N 2 ? F N N 2 ? G N N 2 ? H N N 2 ? I N N 3 ? J N N 4 ? K N N 2 ? L N N 2 ? M N N 2 ? N N N 2 ? O N N 2 ? P N N 2 ? Q N N 2 ? R N N 2 ? S N N 3 ? T N N 5 ? U N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 6 ? PHE A 14 ? THR A 25 PHE A 33 1 ? 9 HELX_P HELX_P2 AA2 SER A 15 ? GLY A 21 ? SER A 34 GLY A 40 5 ? 7 HELX_P HELX_P3 AA3 PRO A 24 ? LEU A 38 ? PRO A 43 LEU A 57 1 ? 15 HELX_P HELX_P4 AA4 THR A 43 ? GLY A 51 ? THR A 62 GLY A 70 1 ? 9 HELX_P HELX_P5 AA5 LYS A 54 ? ARG A 80 ? LYS A 73 ARG A 99 1 ? 27 HELX_P HELX_P6 AA6 THR B 6 ? PHE B 14 ? THR B 25 PHE B 33 1 ? 9 HELX_P HELX_P7 AA7 SER B 15 ? GLY B 21 ? SER B 34 GLY B 40 5 ? 7 HELX_P HELX_P8 AA8 PRO B 24 ? LEU B 38 ? PRO B 43 LEU B 57 1 ? 15 HELX_P HELX_P9 AA9 THR B 43 ? ILE B 53 ? THR B 62 ILE B 72 1 ? 11 HELX_P HELX_P10 AB1 LYS B 54 ? ARG B 78 ? LYS B 73 ARG B 97 1 ? 25 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A NO3 201 ? 4 'binding site for residue NO3 A 201' AC2 Software A NO3 202 ? 7 'binding site for residue NO3 A 202' AC3 Software A NO3 203 ? 4 'binding site for residue NO3 A 203' AC4 Software A NO3 204 ? 5 'binding site for residue NO3 A 204' AC5 Software A NO3 205 ? 2 'binding site for residue NO3 A 205' AC6 Software A NO3 206 ? 5 'binding site for residue NO3 A 206' AC7 Software A GOL 207 ? 3 'binding site for residue GOL A 207' AC8 Software B QWY 201 ? 10 'binding site for residue QWY B 201' AC9 Software B NO3 202 ? 4 'binding site for residue NO3 B 202' AD1 Software B NO3 203 ? 5 'binding site for residue NO3 B 203' AD2 Software B NO3 204 ? 4 'binding site for residue NO3 B 204' AD3 Software B NO3 205 ? 6 'binding site for residue NO3 B 205' AD4 Software B NO3 206 ? 4 'binding site for residue NO3 B 206' AD5 Software B NO3 207 ? 3 'binding site for residue NO3 B 207' AD6 Software B NO3 208 ? 6 'binding site for residue NO3 B 208' AD7 Software B NO3 209 ? 4 'binding site for residue NO3 B 209' AD8 Software B GOL 210 ? 4 'binding site for residue GOL B 210' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 ARG A 66 ? ARG A 85 . ? 1_555 ? 2 AC1 4 HOH T . ? HOH A 302 . ? 1_555 ? 3 AC1 4 HOH T . ? HOH A 304 . ? 1_555 ? 4 AC1 4 HOH T . ? HOH A 310 . ? 1_555 ? 5 AC2 7 GLN A 20 ? GLN A 39 . ? 1_555 ? 6 AC2 7 THR A 43 ? THR A 62 . ? 1_555 ? 7 AC2 7 ALA A 44 ? ALA A 63 . ? 1_555 ? 8 AC2 7 GLY A 45 ? GLY A 64 . ? 1_555 ? 9 AC2 7 VAL B 7 ? VAL B 26 . ? 1_555 ? 10 AC2 7 HOH U . ? HOH B 319 . ? 1_555 ? 11 AC2 7 HOH U . ? HOH B 324 . ? 1_555 ? 12 AC3 4 ARG A 63 ? ARG A 82 . ? 1_555 ? 13 AC3 4 ARG A 66 ? ARG A 85 . ? 1_555 ? 14 AC3 4 HOH T . ? HOH A 302 . ? 1_555 ? 15 AC3 4 LEU B 73 ? LEU B 92 . ? 1_555 ? 16 AC4 5 LYS A 26 ? LYS A 45 . ? 1_555 ? 17 AC4 5 LYS A 57 ? LYS A 76 . ? 1_555 ? 18 AC4 5 ASN A 60 ? ASN A 79 . ? 1_555 ? 19 AC4 5 VAL A 61 ? VAL A 80 . ? 1_555 ? 20 AC4 5 ARG B 71 ? ARG B 90 . ? 1_545 ? 21 AC5 2 ARG A 36 ? ARG A 55 . ? 1_555 ? 22 AC5 2 TRP A 50 ? TRP A 69 . ? 1_555 ? 23 AC6 5 ARG A 13 ? ARG A 32 . ? 1_555 ? 24 AC6 5 ARG B 13 ? ARG B 32 . ? 1_545 ? 25 AC6 5 PRO B 24 ? PRO B 43 . ? 1_545 ? 26 AC6 5 LYS B 26 ? LYS B 45 . ? 1_545 ? 27 AC6 5 LEU B 27 ? LEU B 46 . ? 1_545 ? 28 AC7 3 ARG A 36 ? ARG A 55 . ? 1_555 ? 29 AC7 3 THR A 39 ? THR A 58 . ? 1_555 ? 30 AC7 3 ILE A 40 ? ILE A 59 . ? 1_555 ? 31 AC8 10 THR A 11 ? THR A 30 . ? 1_555 ? 32 AC8 10 PHE A 14 ? PHE A 33 . ? 1_555 ? 33 AC8 10 MET A 18 ? MET A 37 . ? 1_555 ? 34 AC8 10 THR B 11 ? THR B 30 . ? 1_555 ? 35 AC8 10 PHE B 14 ? PHE B 33 . ? 1_555 ? 36 AC8 10 MET B 18 ? MET B 37 . ? 1_555 ? 37 AC8 10 HOH U . ? HOH B 301 . ? 1_555 ? 38 AC8 10 HOH U . ? HOH B 307 . ? 1_555 ? 39 AC8 10 HOH U . ? HOH B 309 . ? 1_555 ? 40 AC8 10 HOH U . ? HOH B 311 . ? 1_555 ? 41 AC9 4 ARG A 81 ? ARG A 100 . ? 1_655 ? 42 AC9 4 ARG B 78 ? ARG B 97 . ? 1_555 ? 43 AC9 4 HOH U . ? HOH B 310 . ? 1_555 ? 44 AC9 4 HOH U . ? HOH B 316 . ? 1_555 ? 45 AD1 5 HOH T . ? HOH A 301 . ? 1_565 ? 46 AD1 5 LEU B 25 ? LEU B 44 . ? 1_555 ? 47 AD1 5 ARG B 49 ? ARG B 68 . ? 1_555 ? 48 AD1 5 ILE B 53 ? ILE B 72 . ? 1_555 ? 49 AD1 5 LYS B 54 ? LYS B 73 . ? 1_555 ? 50 AD2 4 ARG B 63 ? ARG B 82 . ? 1_555 ? 51 AD2 4 ARG B 66 ? ARG B 85 . ? 1_555 ? 52 AD2 4 LYS B 67 ? LYS B 86 . ? 1_555 ? 53 AD2 4 HOH U . ? HOH B 325 . ? 1_555 ? 54 AD3 6 VAL A 7 ? VAL A 26 . ? 1_555 ? 55 AD3 6 GLN B 20 ? GLN B 39 . ? 1_555 ? 56 AD3 6 THR B 43 ? THR B 62 . ? 1_555 ? 57 AD3 6 ALA B 44 ? ALA B 63 . ? 1_555 ? 58 AD3 6 GLY B 45 ? GLY B 64 . ? 1_555 ? 59 AD3 6 HOH U . ? HOH B 308 . ? 1_555 ? 60 AD4 4 ARG A 78 ? ARG A 97 . ? 1_655 ? 61 AD4 4 ARG B 79 ? ARG B 98 . ? 1_555 ? 62 AD4 4 ARG B 80 ? ARG B 99 . ? 1_555 ? 63 AD4 4 HOH U . ? HOH B 302 . ? 1_555 ? 64 AD5 3 LEU A 27 ? LEU A 46 . ? 1_565 ? 65 AD5 3 ARG B 13 ? ARG B 32 . ? 1_555 ? 66 AD5 3 LYS B 26 ? LYS B 45 . ? 1_555 ? 67 AD6 6 ARG A 13 ? ARG A 32 . ? 1_565 ? 68 AD6 6 SER B 15 ? SER B 34 . ? 1_555 ? 69 AD6 6 MET B 18 ? MET B 37 . ? 1_555 ? 70 AD6 6 ARG B 22 ? ARG B 41 . ? 1_555 ? 71 AD6 6 GLY B 23 ? GLY B 42 . ? 1_555 ? 72 AD6 6 LEU B 27 ? LEU B 46 . ? 1_555 ? 73 AD7 4 VAL B 32 ? VAL B 51 . ? 1_555 ? 74 AD7 4 ARG B 36 ? ARG B 55 . ? 1_555 ? 75 AD7 4 TRP B 50 ? TRP B 69 . ? 1_555 ? 76 AD7 4 HOH U . ? HOH B 305 . ? 1_555 ? 77 AD8 4 ASN B 60 ? ASN B 79 . ? 1_555 ? 78 AD8 4 VAL B 61 ? VAL B 80 . ? 1_555 ? 79 AD8 4 HOH U . ? HOH B 312 . ? 1_555 ? 80 AD8 4 HOH U . ? HOH B 326 . ? 1_565 ? # _atom_sites.entry_id 6VG5 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.024752 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.001103 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.039216 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.014613 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 20 20 MET MET A . n A 1 2 ASN 2 21 21 ASN ASN A . n A 1 3 ARG 3 22 22 ARG ARG A . n A 1 4 VAL 4 23 23 VAL VAL A . n A 1 5 SER 5 24 24 SER SER A . n A 1 6 THR 6 25 25 THR THR A . n A 1 7 VAL 7 26 26 VAL VAL A . n A 1 8 GLN 8 27 27 GLN GLN A . n A 1 9 GLN 9 28 28 GLN GLN A . n A 1 10 LEU 10 29 29 LEU LEU A . n A 1 11 THR 11 30 30 THR THR A . n A 1 12 LYS 12 31 31 LYS LYS A . n A 1 13 ARG 13 32 32 ARG ARG A . n A 1 14 PHE 14 33 33 PHE PHE A . n A 1 15 SER 15 34 34 SER SER A . n A 1 16 LEU 16 35 35 LEU LEU A . n A 1 17 GLY 17 36 36 GLY GLY A . n A 1 18 MET 18 37 37 MET MET A . n A 1 19 LEU 19 38 38 LEU LEU A . n A 1 20 GLN 20 39 39 GLN GLN A . n A 1 21 GLY 21 40 40 GLY GLY A . n A 1 22 ARG 22 41 41 ARG ARG A . n A 1 23 GLY 23 42 42 GLY GLY A . n A 1 24 PRO 24 43 43 PRO PRO A . n A 1 25 LEU 25 44 44 LEU LEU A . n A 1 26 LYS 26 45 45 LYS LYS A . n A 1 27 LEU 27 46 46 LEU LEU A . n A 1 28 PHE 28 47 47 PHE PHE A . n A 1 29 MET 29 48 48 MET MET A . n A 1 30 ALA 30 49 49 ALA ALA A . n A 1 31 LEU 31 50 50 LEU LEU A . n A 1 32 VAL 32 51 51 VAL VAL A . n A 1 33 ALA 33 52 52 ALA ALA A . n A 1 34 PHE 34 53 53 PHE PHE A . n A 1 35 LEU 35 54 54 LEU LEU A . n A 1 36 ARG 36 55 55 ARG ARG A . n A 1 37 PHE 37 56 56 PHE PHE A . n A 1 38 LEU 38 57 57 LEU LEU A . n A 1 39 THR 39 58 58 THR THR A . n A 1 40 ILE 40 59 59 ILE ILE A . n A 1 41 PRO 41 60 60 PRO PRO A . n A 1 42 PRO 42 61 61 PRO PRO A . n A 1 43 THR 43 62 62 THR THR A . n A 1 44 ALA 44 63 63 ALA ALA A . n A 1 45 GLY 45 64 64 GLY GLY A . n A 1 46 ILE 46 65 65 ILE ILE A . n A 1 47 LEU 47 66 66 LEU LEU A . n A 1 48 LYS 48 67 67 LYS LYS A . n A 1 49 ARG 49 68 68 ARG ARG A . n A 1 50 TRP 50 69 69 TRP TRP A . n A 1 51 GLY 51 70 70 GLY GLY A . n A 1 52 THR 52 71 71 THR THR A . n A 1 53 ILE 53 72 72 ILE ILE A . n A 1 54 LYS 54 73 73 LYS LYS A . n A 1 55 LYS 55 74 74 LYS LYS A . n A 1 56 SER 56 75 75 SER SER A . n A 1 57 LYS 57 76 76 LYS LYS A . n A 1 58 ALA 58 77 77 ALA ALA A . n A 1 59 ILE 59 78 78 ILE ILE A . n A 1 60 ASN 60 79 79 ASN ASN A . n A 1 61 VAL 61 80 80 VAL VAL A . n A 1 62 LEU 62 81 81 LEU LEU A . n A 1 63 ARG 63 82 82 ARG ARG A . n A 1 64 GLY 64 83 83 GLY GLY A . n A 1 65 PHE 65 84 84 PHE PHE A . n A 1 66 ARG 66 85 85 ARG ARG A . n A 1 67 LYS 67 86 86 LYS LYS A . n A 1 68 GLU 68 87 87 GLU GLU A . n A 1 69 ILE 69 88 88 ILE ILE A . n A 1 70 GLY 70 89 89 GLY GLY A . n A 1 71 ARG 71 90 90 ARG ARG A . n A 1 72 MET 72 91 91 MET MET A . n A 1 73 LEU 73 92 92 LEU LEU A . n A 1 74 ASN 74 93 93 ASN ASN A . n A 1 75 ILE 75 94 94 ILE ILE A . n A 1 76 LEU 76 95 95 LEU LEU A . n A 1 77 ASN 77 96 96 ASN ASN A . n A 1 78 ARG 78 97 97 ARG ARG A . n A 1 79 ARG 79 98 98 ARG ARG A . n A 1 80 ARG 80 99 99 ARG ARG A . n A 1 81 ARG 81 100 100 ARG ARG A . n B 1 1 MET 1 20 20 MET MET B . n B 1 2 ASN 2 21 21 ASN ASN B . n B 1 3 ARG 3 22 22 ARG ARG B . n B 1 4 VAL 4 23 23 VAL VAL B . n B 1 5 SER 5 24 24 SER SER B . n B 1 6 THR 6 25 25 THR THR B . n B 1 7 VAL 7 26 26 VAL VAL B . n B 1 8 GLN 8 27 27 GLN GLN B . n B 1 9 GLN 9 28 28 GLN GLN B . n B 1 10 LEU 10 29 29 LEU LEU B . n B 1 11 THR 11 30 30 THR THR B . n B 1 12 LYS 12 31 31 LYS LYS B . n B 1 13 ARG 13 32 32 ARG ARG B . n B 1 14 PHE 14 33 33 PHE PHE B . n B 1 15 SER 15 34 34 SER SER B . n B 1 16 LEU 16 35 35 LEU LEU B . n B 1 17 GLY 17 36 36 GLY GLY B . n B 1 18 MET 18 37 37 MET MET B . n B 1 19 LEU 19 38 38 LEU LEU B . n B 1 20 GLN 20 39 39 GLN GLN B . n B 1 21 GLY 21 40 40 GLY GLY B . n B 1 22 ARG 22 41 41 ARG ARG B . n B 1 23 GLY 23 42 42 GLY GLY B . n B 1 24 PRO 24 43 43 PRO PRO B . n B 1 25 LEU 25 44 44 LEU LEU B . n B 1 26 LYS 26 45 45 LYS LYS B . n B 1 27 LEU 27 46 46 LEU LEU B . n B 1 28 PHE 28 47 47 PHE PHE B . n B 1 29 MET 29 48 48 MET MET B . n B 1 30 ALA 30 49 49 ALA ALA B . n B 1 31 LEU 31 50 50 LEU LEU B . n B 1 32 VAL 32 51 51 VAL VAL B . n B 1 33 ALA 33 52 52 ALA ALA B . n B 1 34 PHE 34 53 53 PHE PHE B . n B 1 35 LEU 35 54 54 LEU LEU B . n B 1 36 ARG 36 55 55 ARG ARG B . n B 1 37 PHE 37 56 56 PHE PHE B . n B 1 38 LEU 38 57 57 LEU LEU B . n B 1 39 THR 39 58 58 THR THR B . n B 1 40 ILE 40 59 59 ILE ILE B . n B 1 41 PRO 41 60 60 PRO PRO B . n B 1 42 PRO 42 61 61 PRO PRO B . n B 1 43 THR 43 62 62 THR THR B . n B 1 44 ALA 44 63 63 ALA ALA B . n B 1 45 GLY 45 64 64 GLY GLY B . n B 1 46 ILE 46 65 65 ILE ILE B . n B 1 47 LEU 47 66 66 LEU LEU B . n B 1 48 LYS 48 67 67 LYS LYS B . n B 1 49 ARG 49 68 68 ARG ARG B . n B 1 50 TRP 50 69 69 TRP TRP B . n B 1 51 GLY 51 70 70 GLY GLY B . n B 1 52 THR 52 71 71 THR THR B . n B 1 53 ILE 53 72 72 ILE ILE B . n B 1 54 LYS 54 73 73 LYS LYS B . n B 1 55 LYS 55 74 74 LYS LYS B . n B 1 56 SER 56 75 75 SER SER B . n B 1 57 LYS 57 76 76 LYS LYS B . n B 1 58 ALA 58 77 77 ALA ALA B . n B 1 59 ILE 59 78 78 ILE ILE B . n B 1 60 ASN 60 79 79 ASN ASN B . n B 1 61 VAL 61 80 80 VAL VAL B . n B 1 62 LEU 62 81 81 LEU LEU B . n B 1 63 ARG 63 82 82 ARG ARG B . n B 1 64 GLY 64 83 83 GLY GLY B . n B 1 65 PHE 65 84 84 PHE PHE B . n B 1 66 ARG 66 85 85 ARG ARG B . n B 1 67 LYS 67 86 86 LYS LYS B . n B 1 68 GLU 68 87 87 GLU GLU B . n B 1 69 ILE 69 88 88 ILE ILE B . n B 1 70 GLY 70 89 89 GLY GLY B . n B 1 71 ARG 71 90 90 ARG ARG B . n B 1 72 MET 72 91 91 MET MET B . n B 1 73 LEU 73 92 92 LEU LEU B . n B 1 74 ASN 74 93 93 ASN ASN B . n B 1 75 ILE 75 94 94 ILE ILE B . n B 1 76 LEU 76 95 95 LEU LEU B . n B 1 77 ASN 77 96 96 ASN ASN B . n B 1 78 ARG 78 97 97 ARG ARG B . n B 1 79 ARG 79 98 98 ARG ARG B . n B 1 80 ARG 80 99 99 ARG ARG B . n B 1 81 ARG 81 100 100 ARG ARG B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 2 NO3 1 201 2 NO3 NO3 A . D 2 NO3 1 202 5 NO3 NO3 A . E 2 NO3 1 203 4 NO3 NO3 A . F 2 NO3 1 204 6 NO3 NO3 A . G 2 NO3 1 205 7 NO3 NO3 A . H 2 NO3 1 206 9 NO3 NO3 A . I 3 GOL 1 207 1 GOL GOL A . J 4 QWY 1 201 1 QWY DRG B . K 2 NO3 1 202 13 NO3 NO3 B . L 2 NO3 1 203 3 NO3 NO3 B . M 2 NO3 1 204 8 NO3 NO3 B . N 2 NO3 1 205 1 NO3 NO3 B . O 2 NO3 1 206 15 NO3 NO3 B . P 2 NO3 1 207 14 NO3 NO3 B . Q 2 NO3 1 208 12 NO3 NO3 B . R 2 NO3 1 209 11 NO3 NO3 B . S 3 GOL 1 210 2 GOL GOL B . T 5 HOH 1 301 53 HOH HOH A . T 5 HOH 2 302 35 HOH HOH A . T 5 HOH 3 303 30 HOH HOH A . T 5 HOH 4 304 11 HOH HOH A . T 5 HOH 5 305 19 HOH HOH A . T 5 HOH 6 306 50 HOH HOH A . T 5 HOH 7 307 9 HOH HOH A . T 5 HOH 8 308 5 HOH HOH A . T 5 HOH 9 309 43 HOH HOH A . T 5 HOH 10 310 1 HOH HOH A . T 5 HOH 11 311 3 HOH HOH A . T 5 HOH 12 312 40 HOH HOH A . T 5 HOH 13 313 21 HOH HOH A . T 5 HOH 14 314 36 HOH HOH A . T 5 HOH 15 315 37 HOH HOH A . T 5 HOH 16 316 24 HOH HOH A . T 5 HOH 17 317 44 HOH HOH A . T 5 HOH 18 318 7 HOH HOH A . T 5 HOH 19 319 51 HOH HOH A . T 5 HOH 20 320 34 HOH HOH A . T 5 HOH 21 321 26 HOH HOH A . T 5 HOH 22 322 49 HOH HOH A . T 5 HOH 23 323 23 HOH HOH A . U 5 HOH 1 301 32 HOH HOH B . U 5 HOH 2 302 47 HOH HOH B . U 5 HOH 3 303 28 HOH HOH B . U 5 HOH 4 304 42 HOH HOH B . U 5 HOH 5 305 41 HOH HOH B . U 5 HOH 6 306 25 HOH HOH B . U 5 HOH 7 307 8 HOH HOH B . U 5 HOH 8 308 31 HOH HOH B . U 5 HOH 9 309 18 HOH HOH B . U 5 HOH 10 310 52 HOH HOH B . U 5 HOH 11 311 15 HOH HOH B . U 5 HOH 12 312 6 HOH HOH B . U 5 HOH 13 313 17 HOH HOH B . U 5 HOH 14 314 10 HOH HOH B . U 5 HOH 15 315 12 HOH HOH B . U 5 HOH 16 316 2 HOH HOH B . U 5 HOH 17 317 45 HOH HOH B . U 5 HOH 18 318 20 HOH HOH B . U 5 HOH 19 319 16 HOH HOH B . U 5 HOH 20 320 4 HOH HOH B . U 5 HOH 21 321 13 HOH HOH B . U 5 HOH 22 322 14 HOH HOH B . U 5 HOH 23 323 29 HOH HOH B . U 5 HOH 24 324 38 HOH HOH B . U 5 HOH 25 325 22 HOH HOH B . U 5 HOH 26 326 48 HOH HOH B . U 5 HOH 27 327 27 HOH HOH B . U 5 HOH 28 328 39 HOH HOH B . U 5 HOH 29 329 33 HOH HOH B . U 5 HOH 30 330 54 HOH HOH B . U 5 HOH 31 331 46 HOH HOH B . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_656 -x+1,y,-z+1 -1.0000000000 0.0000000000 0.0000000000 37.3523524789 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 68.4321696615 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A NO3 203 ? E NO3 . 2 1 A HOH 315 ? T HOH . 3 1 A HOH 322 ? T HOH . 4 1 B HOH 307 ? U HOH . 5 1 B HOH 311 ? U HOH . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-07-15 2 'Structure model' 1 1 2020-07-29 3 'Structure model' 1 2 2020-08-12 4 'Structure model' 1 3 2023-10-11 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 4 'Structure model' chem_comp_atom 5 4 'Structure model' chem_comp_bond 6 4 'Structure model' database_2 7 4 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.pdbx_database_id_PubMed' 2 2 'Structure model' '_citation.title' 3 2 'Structure model' '_citation_author.name' 4 3 'Structure model' '_citation.journal_volume' 5 3 'Structure model' '_citation.page_first' 6 3 'Structure model' '_citation.page_last' 7 4 'Structure model' '_database_2.pdbx_DOI' 8 4 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_phasing_MR.entry_id 6VG5 _pdbx_phasing_MR.method_rotation ? _pdbx_phasing_MR.method_translation ? _pdbx_phasing_MR.model_details 'Phaser MODE: MR_AUTO' _pdbx_phasing_MR.R_factor ? _pdbx_phasing_MR.R_rigid_body ? _pdbx_phasing_MR.correlation_coeff_Fo_to_Fc ? _pdbx_phasing_MR.correlation_coeff_Io_to_Ic ? _pdbx_phasing_MR.d_res_high_rotation 1.850 _pdbx_phasing_MR.d_res_low_rotation 20.370 _pdbx_phasing_MR.d_res_high_translation 1.850 _pdbx_phasing_MR.d_res_low_translation 20.370 _pdbx_phasing_MR.packing ? _pdbx_phasing_MR.reflns_percent_rotation ? _pdbx_phasing_MR.reflns_percent_translation ? _pdbx_phasing_MR.sigma_F_rotation ? _pdbx_phasing_MR.sigma_F_translation ? _pdbx_phasing_MR.sigma_I_rotation ? _pdbx_phasing_MR.sigma_I_translation ? # _phasing.method MR # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 1 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? 2.7.17 2 ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0257 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25 4 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 5 # _pdbx_entry_details.entry_id 6VG5 _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 B _pdbx_validate_close_contact.auth_comp_id_1 THR _pdbx_validate_close_contact.auth_seq_id_1 30 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 B _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 301 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.16 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 22 ? CG ? A ARG 3 CG 2 1 Y 1 A ARG 22 ? CD ? A ARG 3 CD 3 1 Y 1 A ARG 22 ? NE ? A ARG 3 NE 4 1 Y 1 A ARG 22 ? CZ ? A ARG 3 CZ 5 1 Y 1 A ARG 22 ? NH1 ? A ARG 3 NH1 6 1 Y 1 A ARG 22 ? NH2 ? A ARG 3 NH2 7 1 Y 1 A LYS 31 ? CD ? A LYS 12 CD 8 1 Y 1 A LYS 31 ? CE ? A LYS 12 CE 9 1 Y 1 A LYS 31 ? NZ ? A LYS 12 NZ # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 GLN N N N N 58 GLN CA C N S 59 GLN C C N N 60 GLN O O N N 61 GLN CB C N N 62 GLN CG C N N 63 GLN CD C N N 64 GLN OE1 O N N 65 GLN NE2 N N N 66 GLN OXT O N N 67 GLN H H N N 68 GLN H2 H N N 69 GLN HA H N N 70 GLN HB2 H N N 71 GLN HB3 H N N 72 GLN HG2 H N N 73 GLN HG3 H N N 74 GLN HE21 H N N 75 GLN HE22 H N N 76 GLN HXT H N N 77 GLU N N N N 78 GLU CA C N S 79 GLU C C N N 80 GLU O O N N 81 GLU CB C N N 82 GLU CG C N N 83 GLU CD C N N 84 GLU OE1 O N N 85 GLU OE2 O N N 86 GLU OXT O N N 87 GLU H H N N 88 GLU H2 H N N 89 GLU HA H N N 90 GLU HB2 H N N 91 GLU HB3 H N N 92 GLU HG2 H N N 93 GLU HG3 H N N 94 GLU HE2 H N N 95 GLU HXT H N N 96 GLY N N N N 97 GLY CA C N N 98 GLY C C N N 99 GLY O O N N 100 GLY OXT O N N 101 GLY H H N N 102 GLY H2 H N N 103 GLY HA2 H N N 104 GLY HA3 H N N 105 GLY HXT H N N 106 GOL C1 C N N 107 GOL O1 O N N 108 GOL C2 C N N 109 GOL O2 O N N 110 GOL C3 C N N 111 GOL O3 O N N 112 GOL H11 H N N 113 GOL H12 H N N 114 GOL HO1 H N N 115 GOL H2 H N N 116 GOL HO2 H N N 117 GOL H31 H N N 118 GOL H32 H N N 119 GOL HO3 H N N 120 HOH O O N N 121 HOH H1 H N N 122 HOH H2 H N N 123 ILE N N N N 124 ILE CA C N S 125 ILE C C N N 126 ILE O O N N 127 ILE CB C N S 128 ILE CG1 C N N 129 ILE CG2 C N N 130 ILE CD1 C N N 131 ILE OXT O N N 132 ILE H H N N 133 ILE H2 H N N 134 ILE HA H N N 135 ILE HB H N N 136 ILE HG12 H N N 137 ILE HG13 H N N 138 ILE HG21 H N N 139 ILE HG22 H N N 140 ILE HG23 H N N 141 ILE HD11 H N N 142 ILE HD12 H N N 143 ILE HD13 H N N 144 ILE HXT H N N 145 LEU N N N N 146 LEU CA C N S 147 LEU C C N N 148 LEU O O N N 149 LEU CB C N N 150 LEU CG C N N 151 LEU CD1 C N N 152 LEU CD2 C N N 153 LEU OXT O N N 154 LEU H H N N 155 LEU H2 H N N 156 LEU HA H N N 157 LEU HB2 H N N 158 LEU HB3 H N N 159 LEU HG H N N 160 LEU HD11 H N N 161 LEU HD12 H N N 162 LEU HD13 H N N 163 LEU HD21 H N N 164 LEU HD22 H N N 165 LEU HD23 H N N 166 LEU HXT H N N 167 LYS N N N N 168 LYS CA C N S 169 LYS C C N N 170 LYS O O N N 171 LYS CB C N N 172 LYS CG C N N 173 LYS CD C N N 174 LYS CE C N N 175 LYS NZ N N N 176 LYS OXT O N N 177 LYS H H N N 178 LYS H2 H N N 179 LYS HA H N N 180 LYS HB2 H N N 181 LYS HB3 H N N 182 LYS HG2 H N N 183 LYS HG3 H N N 184 LYS HD2 H N N 185 LYS HD3 H N N 186 LYS HE2 H N N 187 LYS HE3 H N N 188 LYS HZ1 H N N 189 LYS HZ2 H N N 190 LYS HZ3 H N N 191 LYS HXT H N N 192 MET N N N N 193 MET CA C N S 194 MET C C N N 195 MET O O N N 196 MET CB C N N 197 MET CG C N N 198 MET SD S N N 199 MET CE C N N 200 MET OXT O N N 201 MET H H N N 202 MET H2 H N N 203 MET HA H N N 204 MET HB2 H N N 205 MET HB3 H N N 206 MET HG2 H N N 207 MET HG3 H N N 208 MET HE1 H N N 209 MET HE2 H N N 210 MET HE3 H N N 211 MET HXT H N N 212 NO3 N N N N 213 NO3 O1 O N N 214 NO3 O2 O N N 215 NO3 O3 O N N 216 PHE N N N N 217 PHE CA C N S 218 PHE C C N N 219 PHE O O N N 220 PHE CB C N N 221 PHE CG C Y N 222 PHE CD1 C Y N 223 PHE CD2 C Y N 224 PHE CE1 C Y N 225 PHE CE2 C Y N 226 PHE CZ C Y N 227 PHE OXT O N N 228 PHE H H N N 229 PHE H2 H N N 230 PHE HA H N N 231 PHE HB2 H N N 232 PHE HB3 H N N 233 PHE HD1 H N N 234 PHE HD2 H N N 235 PHE HE1 H N N 236 PHE HE2 H N N 237 PHE HZ H N N 238 PHE HXT H N N 239 PRO N N N N 240 PRO CA C N S 241 PRO C C N N 242 PRO O O N N 243 PRO CB C N N 244 PRO CG C N N 245 PRO CD C N N 246 PRO OXT O N N 247 PRO H H N N 248 PRO HA H N N 249 PRO HB2 H N N 250 PRO HB3 H N N 251 PRO HG2 H N N 252 PRO HG3 H N N 253 PRO HD2 H N N 254 PRO HD3 H N N 255 PRO HXT H N N 256 QWY CAD C Y N 257 QWY CAC C Y N 258 QWY CAT C Y N 259 QWY CAU C Y N 260 QWY CAV C Y N 261 QWY CAE C Y N 262 QWY CAF C Y N 263 QWY SAW S Y N 264 QWY NAG N Y N 265 QWY NAH N Y N 266 QWY CAI C Y N 267 QWY NAJ N N N 268 QWY CAK C N N 269 QWY OAA O N N 270 QWY CAL C Y N 271 QWY SAX S Y N 272 QWY CAY C Y N 273 QWY NAZ N Y N 274 QWY CBA C Y N 275 QWY CBB C N N 276 QWY CBC C N N 277 QWY CAS C N N 278 QWY CAR C N N 279 QWY CAQ C N N 280 QWY CAP C Y N 281 QWY CAO C Y N 282 QWY CAN C Y N 283 QWY CAM C Y N 284 QWY NAB N N N 285 QWY H1 H N N 286 QWY H2 H N N 287 QWY H3 H N N 288 QWY H4 H N N 289 QWY H5 H N N 290 QWY H6 H N N 291 QWY H7 H N N 292 QWY H8 H N N 293 QWY H9 H N N 294 QWY H10 H N N 295 QWY H11 H N N 296 QWY H12 H N N 297 QWY H13 H N N 298 QWY H14 H N N 299 QWY H15 H N N 300 QWY H16 H N N 301 QWY H17 H N N 302 QWY H18 H N N 303 QWY H19 H N N 304 SER N N N N 305 SER CA C N S 306 SER C C N N 307 SER O O N N 308 SER CB C N N 309 SER OG O N N 310 SER OXT O N N 311 SER H H N N 312 SER H2 H N N 313 SER HA H N N 314 SER HB2 H N N 315 SER HB3 H N N 316 SER HG H N N 317 SER HXT H N N 318 THR N N N N 319 THR CA C N S 320 THR C C N N 321 THR O O N N 322 THR CB C N R 323 THR OG1 O N N 324 THR CG2 C N N 325 THR OXT O N N 326 THR H H N N 327 THR H2 H N N 328 THR HA H N N 329 THR HB H N N 330 THR HG1 H N N 331 THR HG21 H N N 332 THR HG22 H N N 333 THR HG23 H N N 334 THR HXT H N N 335 TRP N N N N 336 TRP CA C N S 337 TRP C C N N 338 TRP O O N N 339 TRP CB C N N 340 TRP CG C Y N 341 TRP CD1 C Y N 342 TRP CD2 C Y N 343 TRP NE1 N Y N 344 TRP CE2 C Y N 345 TRP CE3 C Y N 346 TRP CZ2 C Y N 347 TRP CZ3 C Y N 348 TRP CH2 C Y N 349 TRP OXT O N N 350 TRP H H N N 351 TRP H2 H N N 352 TRP HA H N N 353 TRP HB2 H N N 354 TRP HB3 H N N 355 TRP HD1 H N N 356 TRP HE1 H N N 357 TRP HE3 H N N 358 TRP HZ2 H N N 359 TRP HZ3 H N N 360 TRP HH2 H N N 361 TRP HXT H N N 362 VAL N N N N 363 VAL CA C N S 364 VAL C C N N 365 VAL O O N N 366 VAL CB C N N 367 VAL CG1 C N N 368 VAL CG2 C N N 369 VAL OXT O N N 370 VAL H H N N 371 VAL H2 H N N 372 VAL HA H N N 373 VAL HB H N N 374 VAL HG11 H N N 375 VAL HG12 H N N 376 VAL HG13 H N N 377 VAL HG21 H N N 378 VAL HG22 H N N 379 VAL HG23 H N N 380 VAL HXT H N N 381 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 GLN N CA sing N N 55 GLN N H sing N N 56 GLN N H2 sing N N 57 GLN CA C sing N N 58 GLN CA CB sing N N 59 GLN CA HA sing N N 60 GLN C O doub N N 61 GLN C OXT sing N N 62 GLN CB CG sing N N 63 GLN CB HB2 sing N N 64 GLN CB HB3 sing N N 65 GLN CG CD sing N N 66 GLN CG HG2 sing N N 67 GLN CG HG3 sing N N 68 GLN CD OE1 doub N N 69 GLN CD NE2 sing N N 70 GLN NE2 HE21 sing N N 71 GLN NE2 HE22 sing N N 72 GLN OXT HXT sing N N 73 GLU N CA sing N N 74 GLU N H sing N N 75 GLU N H2 sing N N 76 GLU CA C sing N N 77 GLU CA CB sing N N 78 GLU CA HA sing N N 79 GLU C O doub N N 80 GLU C OXT sing N N 81 GLU CB CG sing N N 82 GLU CB HB2 sing N N 83 GLU CB HB3 sing N N 84 GLU CG CD sing N N 85 GLU CG HG2 sing N N 86 GLU CG HG3 sing N N 87 GLU CD OE1 doub N N 88 GLU CD OE2 sing N N 89 GLU OE2 HE2 sing N N 90 GLU OXT HXT sing N N 91 GLY N CA sing N N 92 GLY N H sing N N 93 GLY N H2 sing N N 94 GLY CA C sing N N 95 GLY CA HA2 sing N N 96 GLY CA HA3 sing N N 97 GLY C O doub N N 98 GLY C OXT sing N N 99 GLY OXT HXT sing N N 100 GOL C1 O1 sing N N 101 GOL C1 C2 sing N N 102 GOL C1 H11 sing N N 103 GOL C1 H12 sing N N 104 GOL O1 HO1 sing N N 105 GOL C2 O2 sing N N 106 GOL C2 C3 sing N N 107 GOL C2 H2 sing N N 108 GOL O2 HO2 sing N N 109 GOL C3 O3 sing N N 110 GOL C3 H31 sing N N 111 GOL C3 H32 sing N N 112 GOL O3 HO3 sing N N 113 HOH O H1 sing N N 114 HOH O H2 sing N N 115 ILE N CA sing N N 116 ILE N H sing N N 117 ILE N H2 sing N N 118 ILE CA C sing N N 119 ILE CA CB sing N N 120 ILE CA HA sing N N 121 ILE C O doub N N 122 ILE C OXT sing N N 123 ILE CB CG1 sing N N 124 ILE CB CG2 sing N N 125 ILE CB HB sing N N 126 ILE CG1 CD1 sing N N 127 ILE CG1 HG12 sing N N 128 ILE CG1 HG13 sing N N 129 ILE CG2 HG21 sing N N 130 ILE CG2 HG22 sing N N 131 ILE CG2 HG23 sing N N 132 ILE CD1 HD11 sing N N 133 ILE CD1 HD12 sing N N 134 ILE CD1 HD13 sing N N 135 ILE OXT HXT sing N N 136 LEU N CA sing N N 137 LEU N H sing N N 138 LEU N H2 sing N N 139 LEU CA C sing N N 140 LEU CA CB sing N N 141 LEU CA HA sing N N 142 LEU C O doub N N 143 LEU C OXT sing N N 144 LEU CB CG sing N N 145 LEU CB HB2 sing N N 146 LEU CB HB3 sing N N 147 LEU CG CD1 sing N N 148 LEU CG CD2 sing N N 149 LEU CG HG sing N N 150 LEU CD1 HD11 sing N N 151 LEU CD1 HD12 sing N N 152 LEU CD1 HD13 sing N N 153 LEU CD2 HD21 sing N N 154 LEU CD2 HD22 sing N N 155 LEU CD2 HD23 sing N N 156 LEU OXT HXT sing N N 157 LYS N CA sing N N 158 LYS N H sing N N 159 LYS N H2 sing N N 160 LYS CA C sing N N 161 LYS CA CB sing N N 162 LYS CA HA sing N N 163 LYS C O doub N N 164 LYS C OXT sing N N 165 LYS CB CG sing N N 166 LYS CB HB2 sing N N 167 LYS CB HB3 sing N N 168 LYS CG CD sing N N 169 LYS CG HG2 sing N N 170 LYS CG HG3 sing N N 171 LYS CD CE sing N N 172 LYS CD HD2 sing N N 173 LYS CD HD3 sing N N 174 LYS CE NZ sing N N 175 LYS CE HE2 sing N N 176 LYS CE HE3 sing N N 177 LYS NZ HZ1 sing N N 178 LYS NZ HZ2 sing N N 179 LYS NZ HZ3 sing N N 180 LYS OXT HXT sing N N 181 MET N CA sing N N 182 MET N H sing N N 183 MET N H2 sing N N 184 MET CA C sing N N 185 MET CA CB sing N N 186 MET CA HA sing N N 187 MET C O doub N N 188 MET C OXT sing N N 189 MET CB CG sing N N 190 MET CB HB2 sing N N 191 MET CB HB3 sing N N 192 MET CG SD sing N N 193 MET CG HG2 sing N N 194 MET CG HG3 sing N N 195 MET SD CE sing N N 196 MET CE HE1 sing N N 197 MET CE HE2 sing N N 198 MET CE HE3 sing N N 199 MET OXT HXT sing N N 200 NO3 N O1 doub N N 201 NO3 N O2 sing N N 202 NO3 N O3 sing N N 203 PHE N CA sing N N 204 PHE N H sing N N 205 PHE N H2 sing N N 206 PHE CA C sing N N 207 PHE CA CB sing N N 208 PHE CA HA sing N N 209 PHE C O doub N N 210 PHE C OXT sing N N 211 PHE CB CG sing N N 212 PHE CB HB2 sing N N 213 PHE CB HB3 sing N N 214 PHE CG CD1 doub Y N 215 PHE CG CD2 sing Y N 216 PHE CD1 CE1 sing Y N 217 PHE CD1 HD1 sing N N 218 PHE CD2 CE2 doub Y N 219 PHE CD2 HD2 sing N N 220 PHE CE1 CZ doub Y N 221 PHE CE1 HE1 sing N N 222 PHE CE2 CZ sing Y N 223 PHE CE2 HE2 sing N N 224 PHE CZ HZ sing N N 225 PHE OXT HXT sing N N 226 PRO N CA sing N N 227 PRO N CD sing N N 228 PRO N H sing N N 229 PRO CA C sing N N 230 PRO CA CB sing N N 231 PRO CA HA sing N N 232 PRO C O doub N N 233 PRO C OXT sing N N 234 PRO CB CG sing N N 235 PRO CB HB2 sing N N 236 PRO CB HB3 sing N N 237 PRO CG CD sing N N 238 PRO CG HG2 sing N N 239 PRO CG HG3 sing N N 240 PRO CD HD2 sing N N 241 PRO CD HD3 sing N N 242 PRO OXT HXT sing N N 243 QWY CAS CBC sing N N 244 QWY CAS CAR sing N N 245 QWY CBC CBB sing N N 246 QWY CAR CAQ sing N N 247 QWY CBB CBA sing N N 248 QWY CAQ CAP sing N N 249 QWY CBA CAP doub Y N 250 QWY CBA NAZ sing Y N 251 QWY CAP CAO sing Y N 252 QWY NAZ CAY doub Y N 253 QWY CAO CAN doub Y N 254 QWY CAY CAN sing Y N 255 QWY CAY SAX sing Y N 256 QWY CAN CAM sing Y N 257 QWY SAX CAL sing Y N 258 QWY CAM NAB sing N N 259 QWY CAM CAL doub Y N 260 QWY CAL CAK sing N N 261 QWY CAK OAA doub N N 262 QWY CAK NAJ sing N N 263 QWY NAJ CAI sing N N 264 QWY CAI NAH doub Y N 265 QWY CAI SAW sing Y N 266 QWY NAH NAG sing Y N 267 QWY SAW CAF sing Y N 268 QWY NAG CAF doub Y N 269 QWY CAF CAE sing N N 270 QWY CAE CAV doub Y N 271 QWY CAE CAD sing Y N 272 QWY CAV CAU sing Y N 273 QWY CAD CAC doub Y N 274 QWY CAU CAT doub Y N 275 QWY CAC CAT sing Y N 276 QWY CAD H1 sing N N 277 QWY CAC H2 sing N N 278 QWY CAT H3 sing N N 279 QWY CAU H4 sing N N 280 QWY CAV H5 sing N N 281 QWY NAJ H6 sing N N 282 QWY CBB H7 sing N N 283 QWY CBB H8 sing N N 284 QWY CBC H9 sing N N 285 QWY CBC H10 sing N N 286 QWY CAS H11 sing N N 287 QWY CAS H12 sing N N 288 QWY CAR H13 sing N N 289 QWY CAR H14 sing N N 290 QWY CAQ H15 sing N N 291 QWY CAQ H16 sing N N 292 QWY CAO H17 sing N N 293 QWY NAB H18 sing N N 294 QWY NAB H19 sing N N 295 SER N CA sing N N 296 SER N H sing N N 297 SER N H2 sing N N 298 SER CA C sing N N 299 SER CA CB sing N N 300 SER CA HA sing N N 301 SER C O doub N N 302 SER C OXT sing N N 303 SER CB OG sing N N 304 SER CB HB2 sing N N 305 SER CB HB3 sing N N 306 SER OG HG sing N N 307 SER OXT HXT sing N N 308 THR N CA sing N N 309 THR N H sing N N 310 THR N H2 sing N N 311 THR CA C sing N N 312 THR CA CB sing N N 313 THR CA HA sing N N 314 THR C O doub N N 315 THR C OXT sing N N 316 THR CB OG1 sing N N 317 THR CB CG2 sing N N 318 THR CB HB sing N N 319 THR OG1 HG1 sing N N 320 THR CG2 HG21 sing N N 321 THR CG2 HG22 sing N N 322 THR CG2 HG23 sing N N 323 THR OXT HXT sing N N 324 TRP N CA sing N N 325 TRP N H sing N N 326 TRP N H2 sing N N 327 TRP CA C sing N N 328 TRP CA CB sing N N 329 TRP CA HA sing N N 330 TRP C O doub N N 331 TRP C OXT sing N N 332 TRP CB CG sing N N 333 TRP CB HB2 sing N N 334 TRP CB HB3 sing N N 335 TRP CG CD1 doub Y N 336 TRP CG CD2 sing Y N 337 TRP CD1 NE1 sing Y N 338 TRP CD1 HD1 sing N N 339 TRP CD2 CE2 doub Y N 340 TRP CD2 CE3 sing Y N 341 TRP NE1 CE2 sing Y N 342 TRP NE1 HE1 sing N N 343 TRP CE2 CZ2 sing Y N 344 TRP CE3 CZ3 doub Y N 345 TRP CE3 HE3 sing N N 346 TRP CZ2 CH2 doub Y N 347 TRP CZ2 HZ2 sing N N 348 TRP CZ3 CH2 sing Y N 349 TRP CZ3 HZ3 sing N N 350 TRP CH2 HH2 sing N N 351 TRP OXT HXT sing N N 352 VAL N CA sing N N 353 VAL N H sing N N 354 VAL N H2 sing N N 355 VAL CA C sing N N 356 VAL CA CB sing N N 357 VAL CA HA sing N N 358 VAL C O doub N N 359 VAL C OXT sing N N 360 VAL CB CG1 sing N N 361 VAL CB CG2 sing N N 362 VAL CB HB sing N N 363 VAL CG1 HG11 sing N N 364 VAL CG1 HG12 sing N N 365 VAL CG1 HG13 sing N N 366 VAL CG2 HG21 sing N N 367 VAL CG2 HG22 sing N N 368 VAL CG2 HG23 sing N N 369 VAL OXT HXT sing N N 370 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' 'United States' AI142759 1 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' 'United States' AI127744 2 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' 'United States' AI136126 3 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' 'United States' AI145617 4 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id QWY _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id QWY _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'NITRATE ION' NO3 3 GLYCEROL GOL 4 '3-amino-N-(5-phenyl-1,3,4-thiadiazol-2-yl)-6,7,8,9-tetrahydro-5H-cyclohepta[b]thieno[3,2-e]pyridine-2-carboxamide' QWY 5 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1SFK _pdbx_initial_refinement_model.details ? # loop_ _pdbx_struct_assembly_auth_evidence.id _pdbx_struct_assembly_auth_evidence.assembly_id _pdbx_struct_assembly_auth_evidence.experimental_support _pdbx_struct_assembly_auth_evidence.details 1 1 SAXS 'Tetramer fraction observed in solution' 2 1 'equilibrium centrifugation' 'Tetramer fraction observed in solution' #