data_6VI7 # _entry.id 6VI7 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6VI7 pdb_00006vi7 10.2210/pdb6vi7/pdb WWPDB D_1000246447 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6VI7 _pdbx_database_status.recvd_initial_deposition_date 2020-01-12 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Wang, Y.' 1 ? 'Liu, F.' 2 ? 'Yang, Y.' 3 ? 'Liu, A.' 4 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Proc.Natl.Acad.Sci.USA _citation.journal_id_ASTM PNASA6 _citation.journal_id_CSD 0040 _citation.journal_id_ISSN 1091-6490 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 117 _citation.language ? _citation.page_first 19720 _citation.page_last 19730 _citation.title 'Observing 3-hydroxyanthranilate-3,4-dioxygenase in action through a crystalline lens.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1073/pnas.2005327117 _citation.pdbx_database_id_PubMed 32732435 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wang, Y.' 1 ? primary 'Liu, K.F.' 2 ? primary 'Yang, Y.' 3 ? primary 'Davis, I.' 4 ? primary 'Liu, A.' 5 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 6VI7 _cell.details ? _cell.formula_units_Z ? _cell.length_a 58.040 _cell.length_a_esd ? _cell.length_b 58.040 _cell.length_b_esd ? _cell.length_c 231.580 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6VI7 _symmetry.cell_setting ? _symmetry.Int_Tables_number 179 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 65 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man '3-hydroxyanthranilate 3,4-dioxygenase' 22590.377 1 1.13.11.6 ? ? ? 2 non-polymer syn '3-HYDROXYANTHRANILIC ACID' 153.135 1 ? ? ? ? 3 non-polymer syn 'FE (II) ION' 55.845 2 ? ? ? ? 4 non-polymer syn 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL 122.143 1 ? ? ? ? 5 water nat water 18.015 75 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name '3-hydroxyanthranilate oxygenase,3-HAO,3-hydroxyanthranilic acid dioxygenase,HAD' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGHHHHHHHHHHSSGHIEGRHMLTYGAPFNFPRWIDEHAHLLKPPVGNRQVWQDSDFIVTVVGGPNHRTDYHDDPLEEFF YQLRGNAYLNLWVDGRRERADLKEGDIFLLPPHVRHSPQRPEAGSACLVIERQRPAGMLDGFEWYCDACGHLVHRVEVQL KSIVTDLPPLFESFYASEDKRRCPHCGQVHPGRAA ; _entity_poly.pdbx_seq_one_letter_code_can ;MGHHHHHHHHHHSSGHIEGRHMLTYGAPFNFPRWIDEHAHLLKPPVGNRQVWQDSDFIVTVVGGPNHRTDYHDDPLEEFF YQLRGNAYLNLWVDGRRERADLKEGDIFLLPPHVRHSPQRPEAGSACLVIERQRPAGMLDGFEWYCDACGHLVHRVEVQL KSIVTDLPPLFESFYASEDKRRCPHCGQVHPGRAA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 HIS n 1 12 HIS n 1 13 SER n 1 14 SER n 1 15 GLY n 1 16 HIS n 1 17 ILE n 1 18 GLU n 1 19 GLY n 1 20 ARG n 1 21 HIS n 1 22 MET n 1 23 LEU n 1 24 THR n 1 25 TYR n 1 26 GLY n 1 27 ALA n 1 28 PRO n 1 29 PHE n 1 30 ASN n 1 31 PHE n 1 32 PRO n 1 33 ARG n 1 34 TRP n 1 35 ILE n 1 36 ASP n 1 37 GLU n 1 38 HIS n 1 39 ALA n 1 40 HIS n 1 41 LEU n 1 42 LEU n 1 43 LYS n 1 44 PRO n 1 45 PRO n 1 46 VAL n 1 47 GLY n 1 48 ASN n 1 49 ARG n 1 50 GLN n 1 51 VAL n 1 52 TRP n 1 53 GLN n 1 54 ASP n 1 55 SER n 1 56 ASP n 1 57 PHE n 1 58 ILE n 1 59 VAL n 1 60 THR n 1 61 VAL n 1 62 VAL n 1 63 GLY n 1 64 GLY n 1 65 PRO n 1 66 ASN n 1 67 HIS n 1 68 ARG n 1 69 THR n 1 70 ASP n 1 71 TYR n 1 72 HIS n 1 73 ASP n 1 74 ASP n 1 75 PRO n 1 76 LEU n 1 77 GLU n 1 78 GLU n 1 79 PHE n 1 80 PHE n 1 81 TYR n 1 82 GLN n 1 83 LEU n 1 84 ARG n 1 85 GLY n 1 86 ASN n 1 87 ALA n 1 88 TYR n 1 89 LEU n 1 90 ASN n 1 91 LEU n 1 92 TRP n 1 93 VAL n 1 94 ASP n 1 95 GLY n 1 96 ARG n 1 97 ARG n 1 98 GLU n 1 99 ARG n 1 100 ALA n 1 101 ASP n 1 102 LEU n 1 103 LYS n 1 104 GLU n 1 105 GLY n 1 106 ASP n 1 107 ILE n 1 108 PHE n 1 109 LEU n 1 110 LEU n 1 111 PRO n 1 112 PRO n 1 113 HIS n 1 114 VAL n 1 115 ARG n 1 116 HIS n 1 117 SER n 1 118 PRO n 1 119 GLN n 1 120 ARG n 1 121 PRO n 1 122 GLU n 1 123 ALA n 1 124 GLY n 1 125 SER n 1 126 ALA n 1 127 CYS n 1 128 LEU n 1 129 VAL n 1 130 ILE n 1 131 GLU n 1 132 ARG n 1 133 GLN n 1 134 ARG n 1 135 PRO n 1 136 ALA n 1 137 GLY n 1 138 MET n 1 139 LEU n 1 140 ASP n 1 141 GLY n 1 142 PHE n 1 143 GLU n 1 144 TRP n 1 145 TYR n 1 146 CYS n 1 147 ASP n 1 148 ALA n 1 149 CYS n 1 150 GLY n 1 151 HIS n 1 152 LEU n 1 153 VAL n 1 154 HIS n 1 155 ARG n 1 156 VAL n 1 157 GLU n 1 158 VAL n 1 159 GLN n 1 160 LEU n 1 161 LYS n 1 162 SER n 1 163 ILE n 1 164 VAL n 1 165 THR n 1 166 ASP n 1 167 LEU n 1 168 PRO n 1 169 PRO n 1 170 LEU n 1 171 PHE n 1 172 GLU n 1 173 SER n 1 174 PHE n 1 175 TYR n 1 176 ALA n 1 177 SER n 1 178 GLU n 1 179 ASP n 1 180 LYS n 1 181 ARG n 1 182 ARG n 1 183 CYS n 1 184 PRO n 1 185 HIS n 1 186 CYS n 1 187 GLY n 1 188 GLN n 1 189 VAL n 1 190 HIS n 1 191 PRO n 1 192 GLY n 1 193 ARG n 1 194 ALA n 1 195 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 195 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'nbaC, Rmet_5193' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC 43123 / DSM 2839 / NBRC 102507 / CH34' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 266264 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code 3HAO_CUPMC _struct_ref.pdbx_db_accession Q1LCS4 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MLTYGAPFNFPRWIDEHAHLLKPPVGNRQVWQDSDFIVTVVGGPNHRTDYHDDPLEEFFYQLRGNAYLNLWVDGRRERAD LKEGDIFLLPPHVRHSPQRPEAGSACLVIERQRPAGMLDGFEWYCDACGHLVHRVEVQLKSIVTDLPPLFESFYASEDKR RCPHCGQVHPGRAA ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6VI7 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 22 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 195 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q1LCS4 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 174 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 174 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6VI7 MET A 1 ? UNP Q1LCS4 ? ? 'expression tag' -20 1 1 6VI7 GLY A 2 ? UNP Q1LCS4 ? ? 'expression tag' -19 2 1 6VI7 HIS A 3 ? UNP Q1LCS4 ? ? 'expression tag' -18 3 1 6VI7 HIS A 4 ? UNP Q1LCS4 ? ? 'expression tag' -17 4 1 6VI7 HIS A 5 ? UNP Q1LCS4 ? ? 'expression tag' -16 5 1 6VI7 HIS A 6 ? UNP Q1LCS4 ? ? 'expression tag' -15 6 1 6VI7 HIS A 7 ? UNP Q1LCS4 ? ? 'expression tag' -14 7 1 6VI7 HIS A 8 ? UNP Q1LCS4 ? ? 'expression tag' -13 8 1 6VI7 HIS A 9 ? UNP Q1LCS4 ? ? 'expression tag' -12 9 1 6VI7 HIS A 10 ? UNP Q1LCS4 ? ? 'expression tag' -11 10 1 6VI7 HIS A 11 ? UNP Q1LCS4 ? ? 'expression tag' -10 11 1 6VI7 HIS A 12 ? UNP Q1LCS4 ? ? 'expression tag' -9 12 1 6VI7 SER A 13 ? UNP Q1LCS4 ? ? 'expression tag' -8 13 1 6VI7 SER A 14 ? UNP Q1LCS4 ? ? 'expression tag' -7 14 1 6VI7 GLY A 15 ? UNP Q1LCS4 ? ? 'expression tag' -6 15 1 6VI7 HIS A 16 ? UNP Q1LCS4 ? ? 'expression tag' -5 16 1 6VI7 ILE A 17 ? UNP Q1LCS4 ? ? 'expression tag' -4 17 1 6VI7 GLU A 18 ? UNP Q1LCS4 ? ? 'expression tag' -3 18 1 6VI7 GLY A 19 ? UNP Q1LCS4 ? ? 'expression tag' -2 19 1 6VI7 ARG A 20 ? UNP Q1LCS4 ? ? 'expression tag' -1 20 1 6VI7 HIS A 21 ? UNP Q1LCS4 ? ? 'expression tag' 0 21 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 3HA non-polymer . '3-HYDROXYANTHRANILIC ACID' '2-AMINO-3-HYDROXYBENZOIC ACID' 'C7 H7 N O3' 153.135 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 FE2 non-polymer . 'FE (II) ION' ? 'Fe 2' 55.845 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TRS non-polymer . 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL 'TRIS BUFFER' 'C4 H12 N O3 1' 122.143 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6VI7 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.45 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 49.80 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '15% PEG8000, 0.1 M Tris-HCl, 0.2 M magnesium chloride, pH 8.5' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M-F' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2017-11-14 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'double crystal Si(111)' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97919 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 19-BM' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97919 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 19-BM _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 22.040 _reflns.entry_id 6VI7 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.610 _reflns.d_resolution_low 50.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 7721 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.700 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 25.500 _reflns.pdbx_Rmerge_I_obs 0.221 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 4.300 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 1.365 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.226 _reflns.pdbx_Rpim_I_all 0.045 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 196633 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split 2.610 2.660 ? ? ? ? ? ? 374 100.000 ? ? ? ? 1.224 ? ? ? ? ? ? ? ? 26.300 ? 0.756 ? ? 1.248 0.241 ? 1 1 0.984 ? ? 2.660 2.700 ? ? ? ? ? ? 354 100.000 ? ? ? ? 0.847 ? ? ? ? ? ? ? ? 27.100 ? 1.395 ? ? 0.863 0.165 ? 2 1 0.978 ? ? 2.700 2.760 ? ? ? ? ? ? 385 100.000 ? ? ? ? 0.836 ? ? ? ? ? ? ? ? 27.100 ? 0.656 ? ? 0.853 0.163 ? 3 1 0.993 ? ? 2.760 2.810 ? ? ? ? ? ? 363 100.000 ? ? ? ? 0.599 ? ? ? ? ? ? ? ? 26.700 ? 0.698 ? ? 0.611 0.117 ? 4 1 0.993 ? ? 2.810 2.870 ? ? ? ? ? ? 375 100.000 ? ? ? ? 0.589 ? ? ? ? ? ? ? ? 27.100 ? 0.710 ? ? 0.600 0.114 ? 5 1 0.993 ? ? 2.870 2.940 ? ? ? ? ? ? 376 100.000 ? ? ? ? 0.605 ? ? ? ? ? ? ? ? 26.600 ? 0.724 ? ? 0.617 0.119 ? 6 1 0.988 ? ? 2.940 3.010 ? ? ? ? ? ? 367 100.000 ? ? ? ? 0.491 ? ? ? ? ? ? ? ? 27.000 ? 0.819 ? ? 0.500 0.096 ? 7 1 0.992 ? ? 3.010 3.090 ? ? ? ? ? ? 364 100.000 ? ? ? ? 0.392 ? ? ? ? ? ? ? ? 26.700 ? 0.929 ? ? 0.400 0.077 ? 8 1 0.995 ? ? 3.090 3.190 ? ? ? ? ? ? 380 100.000 ? ? ? ? 0.336 ? ? ? ? ? ? ? ? 26.700 ? 1.060 ? ? 0.342 0.066 ? 9 1 0.996 ? ? 3.190 3.290 ? ? ? ? ? ? 376 100.000 ? ? ? ? 0.299 ? ? ? ? ? ? ? ? 26.200 ? 1.199 ? ? 0.305 0.059 ? 10 1 0.994 ? ? 3.290 3.410 ? ? ? ? ? ? 395 100.000 ? ? ? ? 0.282 ? ? ? ? ? ? ? ? 26.500 ? 1.385 ? ? 0.288 0.056 ? 11 1 0.993 ? ? 3.410 3.540 ? ? ? ? ? ? 363 100.000 ? ? ? ? 0.283 ? ? ? ? ? ? ? ? 25.800 ? 2.159 ? ? 0.289 0.057 ? 12 1 0.997 ? ? 3.540 3.700 ? ? ? ? ? ? 387 99.700 ? ? ? ? 0.252 ? ? ? ? ? ? ? ? 25.600 ? 1.885 ? ? 0.257 0.051 ? 13 1 0.995 ? ? 3.700 3.900 ? ? ? ? ? ? 386 100.000 ? ? ? ? 0.221 ? ? ? ? ? ? ? ? 25.300 ? 2.057 ? ? 0.226 0.046 ? 14 1 0.999 ? ? 3.900 4.140 ? ? ? ? ? ? 398 100.000 ? ? ? ? 0.203 ? ? ? ? ? ? ? ? 25.200 ? 2.122 ? ? 0.207 0.042 ? 15 1 0.997 ? ? 4.140 4.460 ? ? ? ? ? ? 383 100.000 ? ? ? ? 0.174 ? ? ? ? ? ? ? ? 24.800 ? 2.159 ? ? 0.178 0.036 ? 16 1 0.996 ? ? 4.460 4.910 ? ? ? ? ? ? 393 100.000 ? ? ? ? 0.167 ? ? ? ? ? ? ? ? 23.900 ? 2.223 ? ? 0.171 0.035 ? 17 1 0.996 ? ? 4.910 5.620 ? ? ? ? ? ? 411 100.000 ? ? ? ? 0.160 ? ? ? ? ? ? ? ? 24.300 ? 1.855 ? ? 0.163 0.032 ? 18 1 0.995 ? ? 5.620 7.080 ? ? ? ? ? ? 420 100.000 ? ? ? ? 0.136 ? ? ? ? ? ? ? ? 23.500 ? 1.515 ? ? 0.139 0.028 ? 19 1 0.998 ? ? 7.080 50.000 ? ? ? ? ? ? 471 95.300 ? ? ? ? 0.106 ? ? ? ? ? ? ? ? 19.200 ? 1.151 ? ? 0.109 0.025 ? 20 1 0.988 ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 108.210 _refine.B_iso_mean 21.9238 _refine.B_iso_min 1.600 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6VI7 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.6170 _refine.ls_d_res_low 37.9550 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 6930 _refine.ls_number_reflns_R_free 693 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 90.5200 _refine.ls_percent_reflns_R_free 10.0000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2077 _refine.ls_R_factor_R_free 0.2895 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1987 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.350 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 'PDB entry 1YFU' _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 24.5900 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3400 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.6170 _refine_hist.d_res_low 37.9550 _refine_hist.number_atoms_solvent 75 _refine_hist.number_atoms_total 1492 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 173 _refine_hist.pdbx_B_iso_mean_ligand 29.04 _refine_hist.pdbx_B_iso_mean_solvent 18.61 _refine_hist.pdbx_number_atoms_protein 1396 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 21 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.014 ? 1468 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.290 ? 1991 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.055 ? 196 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.008 ? 267 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 19.433 ? 849 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.6173 2.8193 . . 76 681 52.0000 . . . 0.3521 0.0000 0.2602 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.8193 3.1029 . . 147 1326 100.0000 . . . 0.3467 0.0000 0.2575 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.1029 3.5516 . . 151 1355 100.0000 . . . 0.3240 0.0000 0.2137 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.5516 4.4735 . . 153 1380 99.0000 . . . 0.2926 0.0000 0.1698 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.4735 37.9550 . . 166 1495 99.0000 . . . 0.2173 0.0000 0.1703 . . . . . . . . . . . # _struct.entry_id 6VI7 _struct.title ;Probing extradiol dioxygenase mechanism in NAD(+) biosynthesis by viewing reaction cycle intermediates - a substrate bidentately bound structure ; _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6VI7 _struct_keywords.text 'In crystallo reaction, Extradiol dioxygenase, NAD+ biosynthesis, Intermediate, OXIDOREDUCTASE' _struct_keywords.pdbx_keywords OXIDOREDUCTASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 4 ? F N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASN A 30 ? HIS A 38 ? ASN A 9 HIS A 17 1 ? 9 HELX_P HELX_P2 AA2 ALA A 39 ? LEU A 42 ? ALA A 18 LEU A 21 5 ? 4 HELX_P HELX_P3 AA3 LEU A 167 ? ALA A 176 ? LEU A 146 ALA A 155 1 ? 10 HELX_P HELX_P4 AA4 SER A 177 ? ARG A 182 ? SER A 156 ARG A 161 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 72 ND1 ? ? ? 1_555 C FE2 . FE ? ? A HIS 51 A FE2 202 1_555 ? ? ? ? ? ? ? 2.537 ? ? metalc2 metalc ? ? A GLU 78 OE1 ? ? ? 1_555 C FE2 . FE ? ? A GLU 57 A FE2 202 1_555 ? ? ? ? ? ? ? 2.658 ? ? metalc3 metalc ? ? A GLU 78 OE2 ? ? ? 1_555 C FE2 . FE ? ? A GLU 57 A FE2 202 1_555 ? ? ? ? ? ? ? 2.548 ? ? metalc4 metalc ? ? A HIS 116 NE2 ? ? ? 1_555 C FE2 . FE ? ? A HIS 95 A FE2 202 1_555 ? ? ? ? ? ? ? 2.423 ? ? metalc5 metalc ? ? A CYS 146 SG ? ? ? 1_555 D FE2 . FE ? ? A CYS 125 A FE2 203 1_555 ? ? ? ? ? ? ? 2.302 ? ? metalc6 metalc ? ? A CYS 149 SG ? ? ? 1_555 D FE2 . FE ? ? A CYS 128 A FE2 203 1_555 ? ? ? ? ? ? ? 2.298 ? ? metalc7 metalc ? ? A CYS 183 SG ? ? ? 1_555 D FE2 . FE ? ? A CYS 162 A FE2 203 1_555 ? ? ? ? ? ? ? 2.302 ? ? metalc8 metalc ? ? A CYS 186 SG ? ? ? 1_555 D FE2 . FE ? ? A CYS 165 A FE2 203 1_555 ? ? ? ? ? ? ? 2.301 ? ? metalc9 metalc ? ? B 3HA . O11 ? ? ? 1_555 C FE2 . FE ? ? A 3HA 201 A FE2 202 1_555 ? ? ? ? ? ? ? 2.025 ? ? metalc10 metalc ? ? B 3HA . N10 ? ? ? 1_555 C FE2 . FE ? ? A 3HA 201 A FE2 202 1_555 ? ? ? ? ? ? ? 2.285 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 PRO 44 A . ? PRO 23 A PRO 45 A ? PRO 24 A 1 -0.79 2 GLY 64 A . ? GLY 43 A PRO 65 A ? PRO 44 A 1 1.20 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 3 ? AA3 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 57 ? VAL A 62 ? PHE A 36 VAL A 41 AA1 2 ALA A 126 ? ARG A 132 ? ALA A 105 ARG A 111 AA1 3 GLU A 78 ? ARG A 84 ? GLU A 57 ARG A 63 AA1 4 ILE A 107 ? LEU A 110 ? ILE A 86 LEU A 89 AA2 1 TYR A 71 ? ASP A 73 ? TYR A 50 ASP A 52 AA2 2 ASP A 140 ? TYR A 145 ? ASP A 119 TYR A 124 AA2 3 LEU A 152 ? VAL A 158 ? LEU A 131 VAL A 137 AA3 1 ARG A 96 ? LEU A 102 ? ARG A 75 LEU A 81 AA3 2 ALA A 87 ? VAL A 93 ? ALA A 66 VAL A 72 AA3 3 HIS A 116 ? GLN A 119 ? HIS A 95 GLN A 98 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ILE A 58 ? N ILE A 37 O GLU A 131 ? O GLU A 110 AA1 2 3 O ALA A 126 ? O ALA A 105 N ARG A 84 ? N ARG A 63 AA1 3 4 N GLU A 78 ? N GLU A 57 O LEU A 110 ? O LEU A 89 AA2 1 2 N ASP A 73 ? N ASP A 52 O GLY A 141 ? O GLY A 120 AA2 2 3 N TRP A 144 ? N TRP A 123 O VAL A 153 ? O VAL A 132 AA3 1 2 O ALA A 100 ? O ALA A 79 N LEU A 89 ? N LEU A 68 AA3 2 3 N TYR A 88 ? N TYR A 67 O GLN A 119 ? O GLN A 98 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A 3HA 201 ? 12 'binding site for residue 3HA A 201' AC2 Software A FE2 202 ? 4 'binding site for residue FE2 A 202' AC3 Software A FE2 203 ? 4 'binding site for residue FE2 A 203' AC4 Software A TRS 204 ? 6 'binding site for residue TRS A 204' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 12 VAL A 46 ? VAL A 25 . ? 1_555 ? 2 AC1 12 ASN A 48 ? ASN A 27 . ? 1_555 ? 3 AC1 12 VAL A 62 ? VAL A 41 . ? 1_555 ? 4 AC1 12 ARG A 68 ? ARG A 47 . ? 1_555 ? 5 AC1 12 HIS A 72 ? HIS A 51 . ? 1_555 ? 6 AC1 12 GLU A 78 ? GLU A 57 . ? 1_555 ? 7 AC1 12 PHE A 80 ? PHE A 59 . ? 1_555 ? 8 AC1 12 PRO A 118 ? PRO A 97 . ? 1_555 ? 9 AC1 12 ARG A 120 ? ARG A 99 . ? 1_555 ? 10 AC1 12 GLU A 131 ? GLU A 110 . ? 1_555 ? 11 AC1 12 ILE A 163 ? ILE A 142 . ? 1_555 ? 12 AC1 12 FE2 C . ? FE2 A 202 . ? 1_555 ? 13 AC2 4 HIS A 72 ? HIS A 51 . ? 1_555 ? 14 AC2 4 GLU A 78 ? GLU A 57 . ? 1_555 ? 15 AC2 4 HIS A 116 ? HIS A 95 . ? 1_555 ? 16 AC2 4 3HA B . ? 3HA A 201 . ? 1_555 ? 17 AC3 4 CYS A 146 ? CYS A 125 . ? 1_555 ? 18 AC3 4 CYS A 149 ? CYS A 128 . ? 1_555 ? 19 AC3 4 CYS A 183 ? CYS A 162 . ? 1_555 ? 20 AC3 4 CYS A 186 ? CYS A 165 . ? 1_555 ? 21 AC4 6 VAL A 153 ? VAL A 132 . ? 1_555 ? 22 AC4 6 HIS A 154 ? HIS A 133 . ? 1_555 ? 23 AC4 6 ASP A 179 ? ASP A 158 . ? 1_555 ? 24 AC4 6 LYS A 180 ? LYS A 159 . ? 1_555 ? 25 AC4 6 ARG A 182 ? ARG A 161 . ? 1_555 ? 26 AC4 6 PRO A 184 ? PRO A 163 . ? 1_555 ? # _atom_sites.entry_id 6VI7 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.017229 _atom_sites.fract_transf_matrix[1][2] 0.009947 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.019895 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.004318 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C FE N O S # loop_ # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -20 ? ? ? A . n A 1 2 GLY 2 -19 ? ? ? A . n A 1 3 HIS 3 -18 ? ? ? A . n A 1 4 HIS 4 -17 ? ? ? A . n A 1 5 HIS 5 -16 ? ? ? A . n A 1 6 HIS 6 -15 ? ? ? A . n A 1 7 HIS 7 -14 ? ? ? A . n A 1 8 HIS 8 -13 ? ? ? A . n A 1 9 HIS 9 -12 ? ? ? A . n A 1 10 HIS 10 -11 ? ? ? A . n A 1 11 HIS 11 -10 ? ? ? A . n A 1 12 HIS 12 -9 ? ? ? A . n A 1 13 SER 13 -8 ? ? ? A . n A 1 14 SER 14 -7 ? ? ? A . n A 1 15 GLY 15 -6 ? ? ? A . n A 1 16 HIS 16 -5 ? ? ? A . n A 1 17 ILE 17 -4 ? ? ? A . n A 1 18 GLU 18 -3 ? ? ? A . n A 1 19 GLY 19 -2 ? ? ? A . n A 1 20 ARG 20 -1 ? ? ? A . n A 1 21 HIS 21 0 0 HIS HIS A . n A 1 22 MET 22 1 1 MET MET A . n A 1 23 LEU 23 2 2 LEU LEU A . n A 1 24 THR 24 3 3 THR THR A . n A 1 25 TYR 25 4 4 TYR TYR A . n A 1 26 GLY 26 5 5 GLY GLY A . n A 1 27 ALA 27 6 6 ALA ALA A . n A 1 28 PRO 28 7 7 PRO PRO A . n A 1 29 PHE 29 8 8 PHE PHE A . n A 1 30 ASN 30 9 9 ASN ASN A . n A 1 31 PHE 31 10 10 PHE PHE A . n A 1 32 PRO 32 11 11 PRO PRO A . n A 1 33 ARG 33 12 12 ARG ARG A . n A 1 34 TRP 34 13 13 TRP TRP A . n A 1 35 ILE 35 14 14 ILE ILE A . n A 1 36 ASP 36 15 15 ASP ASP A . n A 1 37 GLU 37 16 16 GLU GLU A . n A 1 38 HIS 38 17 17 HIS HIS A . n A 1 39 ALA 39 18 18 ALA ALA A . n A 1 40 HIS 40 19 19 HIS HIS A . n A 1 41 LEU 41 20 20 LEU LEU A . n A 1 42 LEU 42 21 21 LEU LEU A . n A 1 43 LYS 43 22 22 LYS LYS A . n A 1 44 PRO 44 23 23 PRO PRO A . n A 1 45 PRO 45 24 24 PRO PRO A . n A 1 46 VAL 46 25 25 VAL VAL A . n A 1 47 GLY 47 26 26 GLY GLY A . n A 1 48 ASN 48 27 27 ASN ASN A . n A 1 49 ARG 49 28 28 ARG ARG A . n A 1 50 GLN 50 29 29 GLN GLN A . n A 1 51 VAL 51 30 30 VAL VAL A . n A 1 52 TRP 52 31 31 TRP TRP A . n A 1 53 GLN 53 32 32 GLN GLN A . n A 1 54 ASP 54 33 33 ASP ASP A . n A 1 55 SER 55 34 34 SER SER A . n A 1 56 ASP 56 35 35 ASP ASP A . n A 1 57 PHE 57 36 36 PHE PHE A . n A 1 58 ILE 58 37 37 ILE ILE A . n A 1 59 VAL 59 38 38 VAL VAL A . n A 1 60 THR 60 39 39 THR THR A . n A 1 61 VAL 61 40 40 VAL VAL A . n A 1 62 VAL 62 41 41 VAL VAL A . n A 1 63 GLY 63 42 42 GLY GLY A . n A 1 64 GLY 64 43 43 GLY GLY A . n A 1 65 PRO 65 44 44 PRO PRO A . n A 1 66 ASN 66 45 45 ASN ASN A . n A 1 67 HIS 67 46 46 HIS HIS A . n A 1 68 ARG 68 47 47 ARG ARG A . n A 1 69 THR 69 48 48 THR THR A . n A 1 70 ASP 70 49 49 ASP ASP A . n A 1 71 TYR 71 50 50 TYR TYR A . n A 1 72 HIS 72 51 51 HIS HIS A . n A 1 73 ASP 73 52 52 ASP ASP A . n A 1 74 ASP 74 53 53 ASP ASP A . n A 1 75 PRO 75 54 54 PRO PRO A . n A 1 76 LEU 76 55 55 LEU LEU A . n A 1 77 GLU 77 56 56 GLU GLU A . n A 1 78 GLU 78 57 57 GLU GLU A . n A 1 79 PHE 79 58 58 PHE PHE A . n A 1 80 PHE 80 59 59 PHE PHE A . n A 1 81 TYR 81 60 60 TYR TYR A . n A 1 82 GLN 82 61 61 GLN GLN A . n A 1 83 LEU 83 62 62 LEU LEU A . n A 1 84 ARG 84 63 63 ARG ARG A . n A 1 85 GLY 85 64 64 GLY GLY A . n A 1 86 ASN 86 65 65 ASN ASN A . n A 1 87 ALA 87 66 66 ALA ALA A . n A 1 88 TYR 88 67 67 TYR TYR A . n A 1 89 LEU 89 68 68 LEU LEU A . n A 1 90 ASN 90 69 69 ASN ASN A . n A 1 91 LEU 91 70 70 LEU LEU A . n A 1 92 TRP 92 71 71 TRP TRP A . n A 1 93 VAL 93 72 72 VAL VAL A . n A 1 94 ASP 94 73 73 ASP ASP A . n A 1 95 GLY 95 74 74 GLY GLY A . n A 1 96 ARG 96 75 75 ARG ARG A . n A 1 97 ARG 97 76 76 ARG ARG A . n A 1 98 GLU 98 77 77 GLU GLU A . n A 1 99 ARG 99 78 78 ARG ARG A . n A 1 100 ALA 100 79 79 ALA ALA A . n A 1 101 ASP 101 80 80 ASP ASP A . n A 1 102 LEU 102 81 81 LEU LEU A . n A 1 103 LYS 103 82 82 LYS LYS A . n A 1 104 GLU 104 83 83 GLU GLU A . n A 1 105 GLY 105 84 84 GLY GLY A . n A 1 106 ASP 106 85 85 ASP ASP A . n A 1 107 ILE 107 86 86 ILE ILE A . n A 1 108 PHE 108 87 87 PHE PHE A . n A 1 109 LEU 109 88 88 LEU LEU A . n A 1 110 LEU 110 89 89 LEU LEU A . n A 1 111 PRO 111 90 90 PRO PRO A . n A 1 112 PRO 112 91 91 PRO PRO A . n A 1 113 HIS 113 92 92 HIS HIS A . n A 1 114 VAL 114 93 93 VAL VAL A . n A 1 115 ARG 115 94 94 ARG ARG A . n A 1 116 HIS 116 95 95 HIS HIS A . n A 1 117 SER 117 96 96 SER SER A . n A 1 118 PRO 118 97 97 PRO PRO A . n A 1 119 GLN 119 98 98 GLN GLN A . n A 1 120 ARG 120 99 99 ARG ARG A . n A 1 121 PRO 121 100 100 PRO PRO A . n A 1 122 GLU 122 101 101 GLU GLU A . n A 1 123 ALA 123 102 102 ALA ALA A . n A 1 124 GLY 124 103 103 GLY GLY A . n A 1 125 SER 125 104 104 SER SER A . n A 1 126 ALA 126 105 105 ALA ALA A . n A 1 127 CYS 127 106 106 CYS CYS A . n A 1 128 LEU 128 107 107 LEU LEU A . n A 1 129 VAL 129 108 108 VAL VAL A . n A 1 130 ILE 130 109 109 ILE ILE A . n A 1 131 GLU 131 110 110 GLU GLU A . n A 1 132 ARG 132 111 111 ARG ARG A . n A 1 133 GLN 133 112 112 GLN GLN A . n A 1 134 ARG 134 113 113 ARG ARG A . n A 1 135 PRO 135 114 114 PRO PRO A . n A 1 136 ALA 136 115 115 ALA ALA A . n A 1 137 GLY 137 116 116 GLY GLY A . n A 1 138 MET 138 117 117 MET MET A . n A 1 139 LEU 139 118 118 LEU LEU A . n A 1 140 ASP 140 119 119 ASP ASP A . n A 1 141 GLY 141 120 120 GLY GLY A . n A 1 142 PHE 142 121 121 PHE PHE A . n A 1 143 GLU 143 122 122 GLU GLU A . n A 1 144 TRP 144 123 123 TRP TRP A . n A 1 145 TYR 145 124 124 TYR TYR A . n A 1 146 CYS 146 125 125 CYS CYS A . n A 1 147 ASP 147 126 126 ASP ASP A . n A 1 148 ALA 148 127 127 ALA ALA A . n A 1 149 CYS 149 128 128 CYS CYS A . n A 1 150 GLY 150 129 129 GLY GLY A . n A 1 151 HIS 151 130 130 HIS HIS A . n A 1 152 LEU 152 131 131 LEU LEU A . n A 1 153 VAL 153 132 132 VAL VAL A . n A 1 154 HIS 154 133 133 HIS HIS A . n A 1 155 ARG 155 134 134 ARG ARG A . n A 1 156 VAL 156 135 135 VAL VAL A . n A 1 157 GLU 157 136 136 GLU GLU A . n A 1 158 VAL 158 137 137 VAL VAL A . n A 1 159 GLN 159 138 138 GLN GLN A . n A 1 160 LEU 160 139 139 LEU LEU A . n A 1 161 LYS 161 140 140 LYS LYS A . n A 1 162 SER 162 141 141 SER SER A . n A 1 163 ILE 163 142 142 ILE ILE A . n A 1 164 VAL 164 143 143 VAL VAL A . n A 1 165 THR 165 144 144 THR THR A . n A 1 166 ASP 166 145 145 ASP ASP A . n A 1 167 LEU 167 146 146 LEU LEU A . n A 1 168 PRO 168 147 147 PRO PRO A . n A 1 169 PRO 169 148 148 PRO PRO A . n A 1 170 LEU 170 149 149 LEU LEU A . n A 1 171 PHE 171 150 150 PHE PHE A . n A 1 172 GLU 172 151 151 GLU GLU A . n A 1 173 SER 173 152 152 SER SER A . n A 1 174 PHE 174 153 153 PHE PHE A . n A 1 175 TYR 175 154 154 TYR TYR A . n A 1 176 ALA 176 155 155 ALA ALA A . n A 1 177 SER 177 156 156 SER SER A . n A 1 178 GLU 178 157 157 GLU GLU A . n A 1 179 ASP 179 158 158 ASP ASP A . n A 1 180 LYS 180 159 159 LYS LYS A . n A 1 181 ARG 181 160 160 ARG ARG A . n A 1 182 ARG 182 161 161 ARG ARG A . n A 1 183 CYS 183 162 162 CYS CYS A . n A 1 184 PRO 184 163 163 PRO PRO A . n A 1 185 HIS 185 164 164 HIS HIS A . n A 1 186 CYS 186 165 165 CYS CYS A . n A 1 187 GLY 187 166 166 GLY GLY A . n A 1 188 GLN 188 167 167 GLN GLN A . n A 1 189 VAL 189 168 168 VAL VAL A . n A 1 190 HIS 190 169 169 HIS HIS A . n A 1 191 PRO 191 170 170 PRO PRO A . n A 1 192 GLY 192 171 171 GLY GLY A . n A 1 193 ARG 193 172 172 ARG ARG A . n A 1 194 ALA 194 173 ? ? ? A . n A 1 195 ALA 195 174 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 3HA 1 201 201 3HA 3HA A . C 3 FE2 1 202 202 FE2 FE2 A . D 3 FE2 1 203 203 FE2 FE2 A . E 4 TRS 1 204 204 TRS TRS A . F 5 HOH 1 301 301 HOH HOH A . F 5 HOH 2 302 302 HOH HOH A . F 5 HOH 3 303 303 HOH HOH A . F 5 HOH 4 304 304 HOH HOH A . F 5 HOH 5 305 305 HOH HOH A . F 5 HOH 6 306 306 HOH HOH A . F 5 HOH 7 307 307 HOH HOH A . F 5 HOH 8 308 308 HOH HOH A . F 5 HOH 9 309 309 HOH HOH A . F 5 HOH 10 310 310 HOH HOH A . F 5 HOH 11 311 311 HOH HOH A . F 5 HOH 12 312 312 HOH HOH A . F 5 HOH 13 313 313 HOH HOH A . F 5 HOH 14 314 314 HOH HOH A . F 5 HOH 15 315 315 HOH HOH A . F 5 HOH 16 316 316 HOH HOH A . F 5 HOH 17 317 317 HOH HOH A . F 5 HOH 18 318 318 HOH HOH A . F 5 HOH 19 319 319 HOH HOH A . F 5 HOH 20 320 320 HOH HOH A . F 5 HOH 21 321 321 HOH HOH A . F 5 HOH 22 322 322 HOH HOH A . F 5 HOH 23 323 323 HOH HOH A . F 5 HOH 24 324 324 HOH HOH A . F 5 HOH 25 325 325 HOH HOH A . F 5 HOH 26 326 326 HOH HOH A . F 5 HOH 27 327 327 HOH HOH A . F 5 HOH 28 328 328 HOH HOH A . F 5 HOH 29 329 329 HOH HOH A . F 5 HOH 30 330 330 HOH HOH A . F 5 HOH 31 331 331 HOH HOH A . F 5 HOH 32 332 332 HOH HOH A . F 5 HOH 33 333 333 HOH HOH A . F 5 HOH 34 334 334 HOH HOH A . F 5 HOH 35 335 335 HOH HOH A . F 5 HOH 36 336 336 HOH HOH A . F 5 HOH 37 337 337 HOH HOH A . F 5 HOH 38 338 338 HOH HOH A . F 5 HOH 39 339 339 HOH HOH A . F 5 HOH 40 340 340 HOH HOH A . F 5 HOH 41 341 341 HOH HOH A . F 5 HOH 42 342 342 HOH HOH A . F 5 HOH 43 343 343 HOH HOH A . F 5 HOH 44 344 344 HOH HOH A . F 5 HOH 45 345 345 HOH HOH A . F 5 HOH 46 346 346 HOH HOH A . F 5 HOH 47 347 347 HOH HOH A . F 5 HOH 48 348 348 HOH HOH A . F 5 HOH 49 349 349 HOH HOH A . F 5 HOH 50 350 350 HOH HOH A . F 5 HOH 51 351 351 HOH HOH A . F 5 HOH 52 352 352 HOH HOH A . F 5 HOH 53 353 353 HOH HOH A . F 5 HOH 54 354 354 HOH HOH A . F 5 HOH 55 355 355 HOH HOH A . F 5 HOH 56 356 356 HOH HOH A . F 5 HOH 57 357 357 HOH HOH A . F 5 HOH 58 358 358 HOH HOH A . F 5 HOH 59 359 359 HOH HOH A . F 5 HOH 60 360 360 HOH HOH A . F 5 HOH 61 361 361 HOH HOH A . F 5 HOH 62 362 362 HOH HOH A . F 5 HOH 63 363 363 HOH HOH A . F 5 HOH 64 364 364 HOH HOH A . F 5 HOH 65 365 365 HOH HOH A . F 5 HOH 66 366 366 HOH HOH A . F 5 HOH 67 367 367 HOH HOH A . F 5 HOH 68 368 368 HOH HOH A . F 5 HOH 69 369 369 HOH HOH A . F 5 HOH 70 370 370 HOH HOH A . F 5 HOH 71 371 371 HOH HOH A . F 5 HOH 72 372 372 HOH HOH A . F 5 HOH 73 373 373 HOH HOH A . F 5 HOH 74 374 374 HOH HOH A . F 5 HOH 75 375 375 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 5130 ? 1 MORE -47 ? 1 'SSA (A^2)' 15330 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 10_775 -y+2,-x+2,-z+1/6 0.5000000000 -0.8660254038 0.0000000000 58.0400000000 -0.8660254038 -0.5000000000 0.0000000000 100.5282288713 0.0000000000 0.0000000000 -1.0000000000 38.5966666667 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 ND1 ? A HIS 72 ? A HIS 51 ? 1_555 FE ? C FE2 . ? A FE2 202 ? 1_555 OE1 ? A GLU 78 ? A GLU 57 ? 1_555 138.7 ? 2 ND1 ? A HIS 72 ? A HIS 51 ? 1_555 FE ? C FE2 . ? A FE2 202 ? 1_555 OE2 ? A GLU 78 ? A GLU 57 ? 1_555 89.4 ? 3 OE1 ? A GLU 78 ? A GLU 57 ? 1_555 FE ? C FE2 . ? A FE2 202 ? 1_555 OE2 ? A GLU 78 ? A GLU 57 ? 1_555 49.4 ? 4 ND1 ? A HIS 72 ? A HIS 51 ? 1_555 FE ? C FE2 . ? A FE2 202 ? 1_555 NE2 ? A HIS 116 ? A HIS 95 ? 1_555 98.1 ? 5 OE1 ? A GLU 78 ? A GLU 57 ? 1_555 FE ? C FE2 . ? A FE2 202 ? 1_555 NE2 ? A HIS 116 ? A HIS 95 ? 1_555 76.0 ? 6 OE2 ? A GLU 78 ? A GLU 57 ? 1_555 FE ? C FE2 . ? A FE2 202 ? 1_555 NE2 ? A HIS 116 ? A HIS 95 ? 1_555 79.3 ? 7 ND1 ? A HIS 72 ? A HIS 51 ? 1_555 FE ? C FE2 . ? A FE2 202 ? 1_555 O11 ? B 3HA . ? A 3HA 201 ? 1_555 78.9 ? 8 OE1 ? A GLU 78 ? A GLU 57 ? 1_555 FE ? C FE2 . ? A FE2 202 ? 1_555 O11 ? B 3HA . ? A 3HA 201 ? 1_555 101.7 ? 9 OE2 ? A GLU 78 ? A GLU 57 ? 1_555 FE ? C FE2 . ? A FE2 202 ? 1_555 O11 ? B 3HA . ? A 3HA 201 ? 1_555 93.7 ? 10 NE2 ? A HIS 116 ? A HIS 95 ? 1_555 FE ? C FE2 . ? A FE2 202 ? 1_555 O11 ? B 3HA . ? A 3HA 201 ? 1_555 172.4 ? 11 ND1 ? A HIS 72 ? A HIS 51 ? 1_555 FE ? C FE2 . ? A FE2 202 ? 1_555 N10 ? B 3HA . ? A 3HA 201 ? 1_555 145.8 ? 12 OE1 ? A GLU 78 ? A GLU 57 ? 1_555 FE ? C FE2 . ? A FE2 202 ? 1_555 N10 ? B 3HA . ? A 3HA 201 ? 1_555 68.1 ? 13 OE2 ? A GLU 78 ? A GLU 57 ? 1_555 FE ? C FE2 . ? A FE2 202 ? 1_555 N10 ? B 3HA . ? A 3HA 201 ? 1_555 112.2 ? 14 NE2 ? A HIS 116 ? A HIS 95 ? 1_555 FE ? C FE2 . ? A FE2 202 ? 1_555 N10 ? B 3HA . ? A 3HA 201 ? 1_555 111.3 ? 15 O11 ? B 3HA . ? A 3HA 201 ? 1_555 FE ? C FE2 . ? A FE2 202 ? 1_555 N10 ? B 3HA . ? A 3HA 201 ? 1_555 73.8 ? 16 SG ? A CYS 146 ? A CYS 125 ? 1_555 FE ? D FE2 . ? A FE2 203 ? 1_555 SG ? A CYS 149 ? A CYS 128 ? 1_555 128.9 ? 17 SG ? A CYS 146 ? A CYS 125 ? 1_555 FE ? D FE2 . ? A FE2 203 ? 1_555 SG ? A CYS 183 ? A CYS 162 ? 1_555 108.8 ? 18 SG ? A CYS 149 ? A CYS 128 ? 1_555 FE ? D FE2 . ? A FE2 203 ? 1_555 SG ? A CYS 183 ? A CYS 162 ? 1_555 108.1 ? 19 SG ? A CYS 146 ? A CYS 125 ? 1_555 FE ? D FE2 . ? A FE2 203 ? 1_555 SG ? A CYS 186 ? A CYS 165 ? 1_555 84.6 ? 20 SG ? A CYS 149 ? A CYS 128 ? 1_555 FE ? D FE2 . ? A FE2 203 ? 1_555 SG ? A CYS 186 ? A CYS 165 ? 1_555 126.7 ? 21 SG ? A CYS 183 ? A CYS 162 ? 1_555 FE ? D FE2 . ? A FE2 203 ? 1_555 SG ? A CYS 186 ? A CYS 165 ? 1_555 93.6 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-02-12 2 'Structure model' 1 1 2020-08-05 3 'Structure model' 1 2 2020-08-12 4 'Structure model' 1 3 2020-09-02 5 'Structure model' 1 4 2023-10-11 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Database references' 4 5 'Structure model' 'Data collection' 5 5 'Structure model' 'Database references' 6 5 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' citation 3 3 'Structure model' citation_author 4 4 'Structure model' citation 5 5 'Structure model' chem_comp_atom 6 5 'Structure model' chem_comp_bond 7 5 'Structure model' database_2 8 5 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.pdbx_database_id_DOI' 7 2 'Structure model' '_citation.title' 8 2 'Structure model' '_citation.year' 9 3 'Structure model' '_citation.pdbx_database_id_PubMed' 10 3 'Structure model' '_citation.title' 11 4 'Structure model' '_citation.journal_volume' 12 4 'Structure model' '_citation.page_first' 13 4 'Structure model' '_citation.page_last' 14 5 'Structure model' '_database_2.pdbx_DOI' 15 5 'Structure model' '_database_2.pdbx_database_accession' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.16 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? DENZO ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALEPACK ? ? ? . 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.24 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 5 # _pdbx_entry_details.entry_id 6VI7 _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 GLU _pdbx_validate_close_contact.auth_seq_id_1 83 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 301 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.06 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 76 ? ? -59.12 104.93 2 1 PHE A 87 ? ? -177.62 139.33 3 1 HIS A 92 ? ? 77.61 -0.27 4 1 ALA A 115 ? ? -24.84 122.79 5 1 ALA A 127 ? ? -102.56 -70.05 6 1 LEU A 146 ? ? -75.02 -70.25 7 1 HIS A 164 ? ? -117.85 -76.18 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 28 ? CZ ? A ARG 49 CZ 2 1 Y 1 A ARG 28 ? NH1 ? A ARG 49 NH1 3 1 Y 1 A ARG 28 ? NH2 ? A ARG 49 NH2 4 1 Y 1 A ARG 75 ? CG ? A ARG 96 CG 5 1 Y 1 A ARG 75 ? CD ? A ARG 96 CD 6 1 Y 1 A ARG 75 ? NE ? A ARG 96 NE 7 1 Y 1 A ARG 75 ? CZ ? A ARG 96 CZ 8 1 Y 1 A ARG 75 ? NH1 ? A ARG 96 NH1 9 1 Y 1 A ARG 75 ? NH2 ? A ARG 96 NH2 10 1 Y 1 A ARG 76 ? CG ? A ARG 97 CG 11 1 Y 1 A ARG 76 ? CD ? A ARG 97 CD 12 1 Y 1 A ARG 76 ? NE ? A ARG 97 NE 13 1 Y 1 A ARG 76 ? CZ ? A ARG 97 CZ 14 1 Y 1 A ARG 76 ? NH1 ? A ARG 97 NH1 15 1 Y 1 A ARG 76 ? NH2 ? A ARG 97 NH2 16 1 Y 1 A LEU 146 ? CB ? A LEU 167 CB 17 1 Y 1 A LEU 146 ? CG ? A LEU 167 CG 18 1 Y 1 A LEU 146 ? CD1 ? A LEU 167 CD1 19 1 Y 1 A LEU 146 ? CD2 ? A LEU 167 CD2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -20 ? A MET 1 2 1 Y 1 A GLY -19 ? A GLY 2 3 1 Y 1 A HIS -18 ? A HIS 3 4 1 Y 1 A HIS -17 ? A HIS 4 5 1 Y 1 A HIS -16 ? A HIS 5 6 1 Y 1 A HIS -15 ? A HIS 6 7 1 Y 1 A HIS -14 ? A HIS 7 8 1 Y 1 A HIS -13 ? A HIS 8 9 1 Y 1 A HIS -12 ? A HIS 9 10 1 Y 1 A HIS -11 ? A HIS 10 11 1 Y 1 A HIS -10 ? A HIS 11 12 1 Y 1 A HIS -9 ? A HIS 12 13 1 Y 1 A SER -8 ? A SER 13 14 1 Y 1 A SER -7 ? A SER 14 15 1 Y 1 A GLY -6 ? A GLY 15 16 1 Y 1 A HIS -5 ? A HIS 16 17 1 Y 1 A ILE -4 ? A ILE 17 18 1 Y 1 A GLU -3 ? A GLU 18 19 1 Y 1 A GLY -2 ? A GLY 19 20 1 Y 1 A ARG -1 ? A ARG 20 21 1 Y 1 A ALA 173 ? A ALA 194 22 1 Y 1 A ALA 174 ? A ALA 195 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal 3HA O8 O N N 1 3HA C7 C N N 2 3HA O9 O N N 3 3HA C2 C Y N 4 3HA C1 C Y N 5 3HA C6 C Y N 6 3HA C5 C Y N 7 3HA C4 C Y N 8 3HA O11 O N N 9 3HA C3 C Y N 10 3HA N10 N N N 11 3HA HO8 H N N 12 3HA H1 H N N 13 3HA H6 H N N 14 3HA H5 H N N 15 3HA H11 H N N 16 3HA H101 H N N 17 3HA H102 H N N 18 ALA N N N N 19 ALA CA C N S 20 ALA C C N N 21 ALA O O N N 22 ALA CB C N N 23 ALA OXT O N N 24 ALA H H N N 25 ALA H2 H N N 26 ALA HA H N N 27 ALA HB1 H N N 28 ALA HB2 H N N 29 ALA HB3 H N N 30 ALA HXT H N N 31 ARG N N N N 32 ARG CA C N S 33 ARG C C N N 34 ARG O O N N 35 ARG CB C N N 36 ARG CG C N N 37 ARG CD C N N 38 ARG NE N N N 39 ARG CZ C N N 40 ARG NH1 N N N 41 ARG NH2 N N N 42 ARG OXT O N N 43 ARG H H N N 44 ARG H2 H N N 45 ARG HA H N N 46 ARG HB2 H N N 47 ARG HB3 H N N 48 ARG HG2 H N N 49 ARG HG3 H N N 50 ARG HD2 H N N 51 ARG HD3 H N N 52 ARG HE H N N 53 ARG HH11 H N N 54 ARG HH12 H N N 55 ARG HH21 H N N 56 ARG HH22 H N N 57 ARG HXT H N N 58 ASN N N N N 59 ASN CA C N S 60 ASN C C N N 61 ASN O O N N 62 ASN CB C N N 63 ASN CG C N N 64 ASN OD1 O N N 65 ASN ND2 N N N 66 ASN OXT O N N 67 ASN H H N N 68 ASN H2 H N N 69 ASN HA H N N 70 ASN HB2 H N N 71 ASN HB3 H N N 72 ASN HD21 H N N 73 ASN HD22 H N N 74 ASN HXT H N N 75 ASP N N N N 76 ASP CA C N S 77 ASP C C N N 78 ASP O O N N 79 ASP CB C N N 80 ASP CG C N N 81 ASP OD1 O N N 82 ASP OD2 O N N 83 ASP OXT O N N 84 ASP H H N N 85 ASP H2 H N N 86 ASP HA H N N 87 ASP HB2 H N N 88 ASP HB3 H N N 89 ASP HD2 H N N 90 ASP HXT H N N 91 CYS N N N N 92 CYS CA C N R 93 CYS C C N N 94 CYS O O N N 95 CYS CB C N N 96 CYS SG S N N 97 CYS OXT O N N 98 CYS H H N N 99 CYS H2 H N N 100 CYS HA H N N 101 CYS HB2 H N N 102 CYS HB3 H N N 103 CYS HG H N N 104 CYS HXT H N N 105 FE2 FE FE N N 106 GLN N N N N 107 GLN CA C N S 108 GLN C C N N 109 GLN O O N N 110 GLN CB C N N 111 GLN CG C N N 112 GLN CD C N N 113 GLN OE1 O N N 114 GLN NE2 N N N 115 GLN OXT O N N 116 GLN H H N N 117 GLN H2 H N N 118 GLN HA H N N 119 GLN HB2 H N N 120 GLN HB3 H N N 121 GLN HG2 H N N 122 GLN HG3 H N N 123 GLN HE21 H N N 124 GLN HE22 H N N 125 GLN HXT H N N 126 GLU N N N N 127 GLU CA C N S 128 GLU C C N N 129 GLU O O N N 130 GLU CB C N N 131 GLU CG C N N 132 GLU CD C N N 133 GLU OE1 O N N 134 GLU OE2 O N N 135 GLU OXT O N N 136 GLU H H N N 137 GLU H2 H N N 138 GLU HA H N N 139 GLU HB2 H N N 140 GLU HB3 H N N 141 GLU HG2 H N N 142 GLU HG3 H N N 143 GLU HE2 H N N 144 GLU HXT H N N 145 GLY N N N N 146 GLY CA C N N 147 GLY C C N N 148 GLY O O N N 149 GLY OXT O N N 150 GLY H H N N 151 GLY H2 H N N 152 GLY HA2 H N N 153 GLY HA3 H N N 154 GLY HXT H N N 155 HIS N N N N 156 HIS CA C N S 157 HIS C C N N 158 HIS O O N N 159 HIS CB C N N 160 HIS CG C Y N 161 HIS ND1 N Y N 162 HIS CD2 C Y N 163 HIS CE1 C Y N 164 HIS NE2 N Y N 165 HIS OXT O N N 166 HIS H H N N 167 HIS H2 H N N 168 HIS HA H N N 169 HIS HB2 H N N 170 HIS HB3 H N N 171 HIS HD1 H N N 172 HIS HD2 H N N 173 HIS HE1 H N N 174 HIS HE2 H N N 175 HIS HXT H N N 176 HOH O O N N 177 HOH H1 H N N 178 HOH H2 H N N 179 ILE N N N N 180 ILE CA C N S 181 ILE C C N N 182 ILE O O N N 183 ILE CB C N S 184 ILE CG1 C N N 185 ILE CG2 C N N 186 ILE CD1 C N N 187 ILE OXT O N N 188 ILE H H N N 189 ILE H2 H N N 190 ILE HA H N N 191 ILE HB H N N 192 ILE HG12 H N N 193 ILE HG13 H N N 194 ILE HG21 H N N 195 ILE HG22 H N N 196 ILE HG23 H N N 197 ILE HD11 H N N 198 ILE HD12 H N N 199 ILE HD13 H N N 200 ILE HXT H N N 201 LEU N N N N 202 LEU CA C N S 203 LEU C C N N 204 LEU O O N N 205 LEU CB C N N 206 LEU CG C N N 207 LEU CD1 C N N 208 LEU CD2 C N N 209 LEU OXT O N N 210 LEU H H N N 211 LEU H2 H N N 212 LEU HA H N N 213 LEU HB2 H N N 214 LEU HB3 H N N 215 LEU HG H N N 216 LEU HD11 H N N 217 LEU HD12 H N N 218 LEU HD13 H N N 219 LEU HD21 H N N 220 LEU HD22 H N N 221 LEU HD23 H N N 222 LEU HXT H N N 223 LYS N N N N 224 LYS CA C N S 225 LYS C C N N 226 LYS O O N N 227 LYS CB C N N 228 LYS CG C N N 229 LYS CD C N N 230 LYS CE C N N 231 LYS NZ N N N 232 LYS OXT O N N 233 LYS H H N N 234 LYS H2 H N N 235 LYS HA H N N 236 LYS HB2 H N N 237 LYS HB3 H N N 238 LYS HG2 H N N 239 LYS HG3 H N N 240 LYS HD2 H N N 241 LYS HD3 H N N 242 LYS HE2 H N N 243 LYS HE3 H N N 244 LYS HZ1 H N N 245 LYS HZ2 H N N 246 LYS HZ3 H N N 247 LYS HXT H N N 248 MET N N N N 249 MET CA C N S 250 MET C C N N 251 MET O O N N 252 MET CB C N N 253 MET CG C N N 254 MET SD S N N 255 MET CE C N N 256 MET OXT O N N 257 MET H H N N 258 MET H2 H N N 259 MET HA H N N 260 MET HB2 H N N 261 MET HB3 H N N 262 MET HG2 H N N 263 MET HG3 H N N 264 MET HE1 H N N 265 MET HE2 H N N 266 MET HE3 H N N 267 MET HXT H N N 268 PHE N N N N 269 PHE CA C N S 270 PHE C C N N 271 PHE O O N N 272 PHE CB C N N 273 PHE CG C Y N 274 PHE CD1 C Y N 275 PHE CD2 C Y N 276 PHE CE1 C Y N 277 PHE CE2 C Y N 278 PHE CZ C Y N 279 PHE OXT O N N 280 PHE H H N N 281 PHE H2 H N N 282 PHE HA H N N 283 PHE HB2 H N N 284 PHE HB3 H N N 285 PHE HD1 H N N 286 PHE HD2 H N N 287 PHE HE1 H N N 288 PHE HE2 H N N 289 PHE HZ H N N 290 PHE HXT H N N 291 PRO N N N N 292 PRO CA C N S 293 PRO C C N N 294 PRO O O N N 295 PRO CB C N N 296 PRO CG C N N 297 PRO CD C N N 298 PRO OXT O N N 299 PRO H H N N 300 PRO HA H N N 301 PRO HB2 H N N 302 PRO HB3 H N N 303 PRO HG2 H N N 304 PRO HG3 H N N 305 PRO HD2 H N N 306 PRO HD3 H N N 307 PRO HXT H N N 308 SER N N N N 309 SER CA C N S 310 SER C C N N 311 SER O O N N 312 SER CB C N N 313 SER OG O N N 314 SER OXT O N N 315 SER H H N N 316 SER H2 H N N 317 SER HA H N N 318 SER HB2 H N N 319 SER HB3 H N N 320 SER HG H N N 321 SER HXT H N N 322 THR N N N N 323 THR CA C N S 324 THR C C N N 325 THR O O N N 326 THR CB C N R 327 THR OG1 O N N 328 THR CG2 C N N 329 THR OXT O N N 330 THR H H N N 331 THR H2 H N N 332 THR HA H N N 333 THR HB H N N 334 THR HG1 H N N 335 THR HG21 H N N 336 THR HG22 H N N 337 THR HG23 H N N 338 THR HXT H N N 339 TRP N N N N 340 TRP CA C N S 341 TRP C C N N 342 TRP O O N N 343 TRP CB C N N 344 TRP CG C Y N 345 TRP CD1 C Y N 346 TRP CD2 C Y N 347 TRP NE1 N Y N 348 TRP CE2 C Y N 349 TRP CE3 C Y N 350 TRP CZ2 C Y N 351 TRP CZ3 C Y N 352 TRP CH2 C Y N 353 TRP OXT O N N 354 TRP H H N N 355 TRP H2 H N N 356 TRP HA H N N 357 TRP HB2 H N N 358 TRP HB3 H N N 359 TRP HD1 H N N 360 TRP HE1 H N N 361 TRP HE3 H N N 362 TRP HZ2 H N N 363 TRP HZ3 H N N 364 TRP HH2 H N N 365 TRP HXT H N N 366 TRS C C N N 367 TRS C1 C N N 368 TRS C2 C N N 369 TRS C3 C N N 370 TRS N N N N 371 TRS O1 O N N 372 TRS O2 O N N 373 TRS O3 O N N 374 TRS H11 H N N 375 TRS H12 H N N 376 TRS H21 H N N 377 TRS H22 H N N 378 TRS H31 H N N 379 TRS H32 H N N 380 TRS HN1 H N N 381 TRS HN2 H N N 382 TRS HN3 H N N 383 TRS HO1 H N N 384 TRS HO2 H N N 385 TRS HO3 H N N 386 TYR N N N N 387 TYR CA C N S 388 TYR C C N N 389 TYR O O N N 390 TYR CB C N N 391 TYR CG C Y N 392 TYR CD1 C Y N 393 TYR CD2 C Y N 394 TYR CE1 C Y N 395 TYR CE2 C Y N 396 TYR CZ C Y N 397 TYR OH O N N 398 TYR OXT O N N 399 TYR H H N N 400 TYR H2 H N N 401 TYR HA H N N 402 TYR HB2 H N N 403 TYR HB3 H N N 404 TYR HD1 H N N 405 TYR HD2 H N N 406 TYR HE1 H N N 407 TYR HE2 H N N 408 TYR HH H N N 409 TYR HXT H N N 410 VAL N N N N 411 VAL CA C N S 412 VAL C C N N 413 VAL O O N N 414 VAL CB C N N 415 VAL CG1 C N N 416 VAL CG2 C N N 417 VAL OXT O N N 418 VAL H H N N 419 VAL H2 H N N 420 VAL HA H N N 421 VAL HB H N N 422 VAL HG11 H N N 423 VAL HG12 H N N 424 VAL HG13 H N N 425 VAL HG21 H N N 426 VAL HG22 H N N 427 VAL HG23 H N N 428 VAL HXT H N N 429 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal 3HA O8 C7 sing N N 1 3HA O8 HO8 sing N N 2 3HA C7 O9 doub N N 3 3HA C7 C2 sing N N 4 3HA C2 C1 sing Y N 5 3HA C2 C3 doub Y N 6 3HA C1 C6 doub Y N 7 3HA C1 H1 sing N N 8 3HA C6 C5 sing Y N 9 3HA C6 H6 sing N N 10 3HA C5 C4 doub Y N 11 3HA C5 H5 sing N N 12 3HA C4 O11 sing N N 13 3HA C4 C3 sing Y N 14 3HA O11 H11 sing N N 15 3HA C3 N10 sing N N 16 3HA N10 H101 sing N N 17 3HA N10 H102 sing N N 18 ALA N CA sing N N 19 ALA N H sing N N 20 ALA N H2 sing N N 21 ALA CA C sing N N 22 ALA CA CB sing N N 23 ALA CA HA sing N N 24 ALA C O doub N N 25 ALA C OXT sing N N 26 ALA CB HB1 sing N N 27 ALA CB HB2 sing N N 28 ALA CB HB3 sing N N 29 ALA OXT HXT sing N N 30 ARG N CA sing N N 31 ARG N H sing N N 32 ARG N H2 sing N N 33 ARG CA C sing N N 34 ARG CA CB sing N N 35 ARG CA HA sing N N 36 ARG C O doub N N 37 ARG C OXT sing N N 38 ARG CB CG sing N N 39 ARG CB HB2 sing N N 40 ARG CB HB3 sing N N 41 ARG CG CD sing N N 42 ARG CG HG2 sing N N 43 ARG CG HG3 sing N N 44 ARG CD NE sing N N 45 ARG CD HD2 sing N N 46 ARG CD HD3 sing N N 47 ARG NE CZ sing N N 48 ARG NE HE sing N N 49 ARG CZ NH1 sing N N 50 ARG CZ NH2 doub N N 51 ARG NH1 HH11 sing N N 52 ARG NH1 HH12 sing N N 53 ARG NH2 HH21 sing N N 54 ARG NH2 HH22 sing N N 55 ARG OXT HXT sing N N 56 ASN N CA sing N N 57 ASN N H sing N N 58 ASN N H2 sing N N 59 ASN CA C sing N N 60 ASN CA CB sing N N 61 ASN CA HA sing N N 62 ASN C O doub N N 63 ASN C OXT sing N N 64 ASN CB CG sing N N 65 ASN CB HB2 sing N N 66 ASN CB HB3 sing N N 67 ASN CG OD1 doub N N 68 ASN CG ND2 sing N N 69 ASN ND2 HD21 sing N N 70 ASN ND2 HD22 sing N N 71 ASN OXT HXT sing N N 72 ASP N CA sing N N 73 ASP N H sing N N 74 ASP N H2 sing N N 75 ASP CA C sing N N 76 ASP CA CB sing N N 77 ASP CA HA sing N N 78 ASP C O doub N N 79 ASP C OXT sing N N 80 ASP CB CG sing N N 81 ASP CB HB2 sing N N 82 ASP CB HB3 sing N N 83 ASP CG OD1 doub N N 84 ASP CG OD2 sing N N 85 ASP OD2 HD2 sing N N 86 ASP OXT HXT sing N N 87 CYS N CA sing N N 88 CYS N H sing N N 89 CYS N H2 sing N N 90 CYS CA C sing N N 91 CYS CA CB sing N N 92 CYS CA HA sing N N 93 CYS C O doub N N 94 CYS C OXT sing N N 95 CYS CB SG sing N N 96 CYS CB HB2 sing N N 97 CYS CB HB3 sing N N 98 CYS SG HG sing N N 99 CYS OXT HXT sing N N 100 GLN N CA sing N N 101 GLN N H sing N N 102 GLN N H2 sing N N 103 GLN CA C sing N N 104 GLN CA CB sing N N 105 GLN CA HA sing N N 106 GLN C O doub N N 107 GLN C OXT sing N N 108 GLN CB CG sing N N 109 GLN CB HB2 sing N N 110 GLN CB HB3 sing N N 111 GLN CG CD sing N N 112 GLN CG HG2 sing N N 113 GLN CG HG3 sing N N 114 GLN CD OE1 doub N N 115 GLN CD NE2 sing N N 116 GLN NE2 HE21 sing N N 117 GLN NE2 HE22 sing N N 118 GLN OXT HXT sing N N 119 GLU N CA sing N N 120 GLU N H sing N N 121 GLU N H2 sing N N 122 GLU CA C sing N N 123 GLU CA CB sing N N 124 GLU CA HA sing N N 125 GLU C O doub N N 126 GLU C OXT sing N N 127 GLU CB CG sing N N 128 GLU CB HB2 sing N N 129 GLU CB HB3 sing N N 130 GLU CG CD sing N N 131 GLU CG HG2 sing N N 132 GLU CG HG3 sing N N 133 GLU CD OE1 doub N N 134 GLU CD OE2 sing N N 135 GLU OE2 HE2 sing N N 136 GLU OXT HXT sing N N 137 GLY N CA sing N N 138 GLY N H sing N N 139 GLY N H2 sing N N 140 GLY CA C sing N N 141 GLY CA HA2 sing N N 142 GLY CA HA3 sing N N 143 GLY C O doub N N 144 GLY C OXT sing N N 145 GLY OXT HXT sing N N 146 HIS N CA sing N N 147 HIS N H sing N N 148 HIS N H2 sing N N 149 HIS CA C sing N N 150 HIS CA CB sing N N 151 HIS CA HA sing N N 152 HIS C O doub N N 153 HIS C OXT sing N N 154 HIS CB CG sing N N 155 HIS CB HB2 sing N N 156 HIS CB HB3 sing N N 157 HIS CG ND1 sing Y N 158 HIS CG CD2 doub Y N 159 HIS ND1 CE1 doub Y N 160 HIS ND1 HD1 sing N N 161 HIS CD2 NE2 sing Y N 162 HIS CD2 HD2 sing N N 163 HIS CE1 NE2 sing Y N 164 HIS CE1 HE1 sing N N 165 HIS NE2 HE2 sing N N 166 HIS OXT HXT sing N N 167 HOH O H1 sing N N 168 HOH O H2 sing N N 169 ILE N CA sing N N 170 ILE N H sing N N 171 ILE N H2 sing N N 172 ILE CA C sing N N 173 ILE CA CB sing N N 174 ILE CA HA sing N N 175 ILE C O doub N N 176 ILE C OXT sing N N 177 ILE CB CG1 sing N N 178 ILE CB CG2 sing N N 179 ILE CB HB sing N N 180 ILE CG1 CD1 sing N N 181 ILE CG1 HG12 sing N N 182 ILE CG1 HG13 sing N N 183 ILE CG2 HG21 sing N N 184 ILE CG2 HG22 sing N N 185 ILE CG2 HG23 sing N N 186 ILE CD1 HD11 sing N N 187 ILE CD1 HD12 sing N N 188 ILE CD1 HD13 sing N N 189 ILE OXT HXT sing N N 190 LEU N CA sing N N 191 LEU N H sing N N 192 LEU N H2 sing N N 193 LEU CA C sing N N 194 LEU CA CB sing N N 195 LEU CA HA sing N N 196 LEU C O doub N N 197 LEU C OXT sing N N 198 LEU CB CG sing N N 199 LEU CB HB2 sing N N 200 LEU CB HB3 sing N N 201 LEU CG CD1 sing N N 202 LEU CG CD2 sing N N 203 LEU CG HG sing N N 204 LEU CD1 HD11 sing N N 205 LEU CD1 HD12 sing N N 206 LEU CD1 HD13 sing N N 207 LEU CD2 HD21 sing N N 208 LEU CD2 HD22 sing N N 209 LEU CD2 HD23 sing N N 210 LEU OXT HXT sing N N 211 LYS N CA sing N N 212 LYS N H sing N N 213 LYS N H2 sing N N 214 LYS CA C sing N N 215 LYS CA CB sing N N 216 LYS CA HA sing N N 217 LYS C O doub N N 218 LYS C OXT sing N N 219 LYS CB CG sing N N 220 LYS CB HB2 sing N N 221 LYS CB HB3 sing N N 222 LYS CG CD sing N N 223 LYS CG HG2 sing N N 224 LYS CG HG3 sing N N 225 LYS CD CE sing N N 226 LYS CD HD2 sing N N 227 LYS CD HD3 sing N N 228 LYS CE NZ sing N N 229 LYS CE HE2 sing N N 230 LYS CE HE3 sing N N 231 LYS NZ HZ1 sing N N 232 LYS NZ HZ2 sing N N 233 LYS NZ HZ3 sing N N 234 LYS OXT HXT sing N N 235 MET N CA sing N N 236 MET N H sing N N 237 MET N H2 sing N N 238 MET CA C sing N N 239 MET CA CB sing N N 240 MET CA HA sing N N 241 MET C O doub N N 242 MET C OXT sing N N 243 MET CB CG sing N N 244 MET CB HB2 sing N N 245 MET CB HB3 sing N N 246 MET CG SD sing N N 247 MET CG HG2 sing N N 248 MET CG HG3 sing N N 249 MET SD CE sing N N 250 MET CE HE1 sing N N 251 MET CE HE2 sing N N 252 MET CE HE3 sing N N 253 MET OXT HXT sing N N 254 PHE N CA sing N N 255 PHE N H sing N N 256 PHE N H2 sing N N 257 PHE CA C sing N N 258 PHE CA CB sing N N 259 PHE CA HA sing N N 260 PHE C O doub N N 261 PHE C OXT sing N N 262 PHE CB CG sing N N 263 PHE CB HB2 sing N N 264 PHE CB HB3 sing N N 265 PHE CG CD1 doub Y N 266 PHE CG CD2 sing Y N 267 PHE CD1 CE1 sing Y N 268 PHE CD1 HD1 sing N N 269 PHE CD2 CE2 doub Y N 270 PHE CD2 HD2 sing N N 271 PHE CE1 CZ doub Y N 272 PHE CE1 HE1 sing N N 273 PHE CE2 CZ sing Y N 274 PHE CE2 HE2 sing N N 275 PHE CZ HZ sing N N 276 PHE OXT HXT sing N N 277 PRO N CA sing N N 278 PRO N CD sing N N 279 PRO N H sing N N 280 PRO CA C sing N N 281 PRO CA CB sing N N 282 PRO CA HA sing N N 283 PRO C O doub N N 284 PRO C OXT sing N N 285 PRO CB CG sing N N 286 PRO CB HB2 sing N N 287 PRO CB HB3 sing N N 288 PRO CG CD sing N N 289 PRO CG HG2 sing N N 290 PRO CG HG3 sing N N 291 PRO CD HD2 sing N N 292 PRO CD HD3 sing N N 293 PRO OXT HXT sing N N 294 SER N CA sing N N 295 SER N H sing N N 296 SER N H2 sing N N 297 SER CA C sing N N 298 SER CA CB sing N N 299 SER CA HA sing N N 300 SER C O doub N N 301 SER C OXT sing N N 302 SER CB OG sing N N 303 SER CB HB2 sing N N 304 SER CB HB3 sing N N 305 SER OG HG sing N N 306 SER OXT HXT sing N N 307 THR N CA sing N N 308 THR N H sing N N 309 THR N H2 sing N N 310 THR CA C sing N N 311 THR CA CB sing N N 312 THR CA HA sing N N 313 THR C O doub N N 314 THR C OXT sing N N 315 THR CB OG1 sing N N 316 THR CB CG2 sing N N 317 THR CB HB sing N N 318 THR OG1 HG1 sing N N 319 THR CG2 HG21 sing N N 320 THR CG2 HG22 sing N N 321 THR CG2 HG23 sing N N 322 THR OXT HXT sing N N 323 TRP N CA sing N N 324 TRP N H sing N N 325 TRP N H2 sing N N 326 TRP CA C sing N N 327 TRP CA CB sing N N 328 TRP CA HA sing N N 329 TRP C O doub N N 330 TRP C OXT sing N N 331 TRP CB CG sing N N 332 TRP CB HB2 sing N N 333 TRP CB HB3 sing N N 334 TRP CG CD1 doub Y N 335 TRP CG CD2 sing Y N 336 TRP CD1 NE1 sing Y N 337 TRP CD1 HD1 sing N N 338 TRP CD2 CE2 doub Y N 339 TRP CD2 CE3 sing Y N 340 TRP NE1 CE2 sing Y N 341 TRP NE1 HE1 sing N N 342 TRP CE2 CZ2 sing Y N 343 TRP CE3 CZ3 doub Y N 344 TRP CE3 HE3 sing N N 345 TRP CZ2 CH2 doub Y N 346 TRP CZ2 HZ2 sing N N 347 TRP CZ3 CH2 sing Y N 348 TRP CZ3 HZ3 sing N N 349 TRP CH2 HH2 sing N N 350 TRP OXT HXT sing N N 351 TRS C C1 sing N N 352 TRS C C2 sing N N 353 TRS C C3 sing N N 354 TRS C N sing N N 355 TRS C1 O1 sing N N 356 TRS C1 H11 sing N N 357 TRS C1 H12 sing N N 358 TRS C2 O2 sing N N 359 TRS C2 H21 sing N N 360 TRS C2 H22 sing N N 361 TRS C3 O3 sing N N 362 TRS C3 H31 sing N N 363 TRS C3 H32 sing N N 364 TRS N HN1 sing N N 365 TRS N HN2 sing N N 366 TRS N HN3 sing N N 367 TRS O1 HO1 sing N N 368 TRS O2 HO2 sing N N 369 TRS O3 HO3 sing N N 370 TYR N CA sing N N 371 TYR N H sing N N 372 TYR N H2 sing N N 373 TYR CA C sing N N 374 TYR CA CB sing N N 375 TYR CA HA sing N N 376 TYR C O doub N N 377 TYR C OXT sing N N 378 TYR CB CG sing N N 379 TYR CB HB2 sing N N 380 TYR CB HB3 sing N N 381 TYR CG CD1 doub Y N 382 TYR CG CD2 sing Y N 383 TYR CD1 CE1 sing Y N 384 TYR CD1 HD1 sing N N 385 TYR CD2 CE2 doub Y N 386 TYR CD2 HD2 sing N N 387 TYR CE1 CZ doub Y N 388 TYR CE1 HE1 sing N N 389 TYR CE2 CZ sing Y N 390 TYR CE2 HE2 sing N N 391 TYR CZ OH sing N N 392 TYR OH HH sing N N 393 TYR OXT HXT sing N N 394 VAL N CA sing N N 395 VAL N H sing N N 396 VAL N H2 sing N N 397 VAL CA C sing N N 398 VAL CA CB sing N N 399 VAL CA HA sing N N 400 VAL C O doub N N 401 VAL C OXT sing N N 402 VAL CB CG1 sing N N 403 VAL CB CG2 sing N N 404 VAL CB HB sing N N 405 VAL CG1 HG11 sing N N 406 VAL CG1 HG12 sing N N 407 VAL CG1 HG13 sing N N 408 VAL CG2 HG21 sing N N 409 VAL CG2 HG22 sing N N 410 VAL CG2 HG23 sing N N 411 VAL OXT HXT sing N N 412 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' R01GM108988 1 'National Institutes of Health/National Institute of Mental Health (NIH/NIMH)' 'United States' R21MH107985 2 'National Science Foundation (NSF, United States)' 'United States' CHE-1623856 3 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' R01GM107529 4 # loop_ _pdbx_entity_instance_feature.ordinal _pdbx_entity_instance_feature.comp_id _pdbx_entity_instance_feature.asym_id _pdbx_entity_instance_feature.seq_num _pdbx_entity_instance_feature.auth_comp_id _pdbx_entity_instance_feature.auth_asym_id _pdbx_entity_instance_feature.auth_seq_num _pdbx_entity_instance_feature.feature_type _pdbx_entity_instance_feature.details 1 3HA ? ? 3HA ? ? 'SUBJECT OF INVESTIGATION' ? 2 FE2 ? ? FE2 ? ? 'SUBJECT OF INVESTIGATION' ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '3-HYDROXYANTHRANILIC ACID' 3HA 3 'FE (II) ION' FE2 4 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL TRS 5 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1YFU _pdbx_initial_refinement_model.details 'PDB entry 1YFU' # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #