data_6VL4 # _entry.id 6VL4 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6VL4 pdb_00006vl4 10.2210/pdb6vl4/pdb WWPDB D_1000246575 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-12-02 2 'Structure model' 1 1 2020-12-09 3 'Structure model' 1 2 2020-12-16 4 'Structure model' 1 3 2024-10-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Refinement description' 6 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 4 'Structure model' chem_comp_atom 5 4 'Structure model' chem_comp_bond 6 4 'Structure model' database_2 7 4 'Structure model' pdbx_entry_details 8 4 'Structure model' pdbx_initial_refinement_model 9 4 'Structure model' pdbx_modification_feature 10 4 'Structure model' refine # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_id_ISSN' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation.pdbx_database_id_PubMed' 5 2 'Structure model' '_citation.title' 6 2 'Structure model' '_citation_author.identifier_ORCID' 7 3 'Structure model' '_citation.journal_volume' 8 4 'Structure model' '_database_2.pdbx_DOI' 9 4 'Structure model' '_database_2.pdbx_database_accession' 10 4 'Structure model' '_pdbx_entry_details.has_protein_modification' 11 4 'Structure model' '_refine.pdbx_starting_model' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6VL4 _pdbx_database_status.recvd_initial_deposition_date 2020-01-22 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Ho, J.D.' 1 0000-0002-9636-5527 'Lee, M.R.' 2 ? 'Rauch, C.T.' 3 ? 'Aznavour, K.' 4 ? 'Park, J.S.' 5 ? 'Luz, J.G.' 6 ? 'Antonysamy, S.' 7 ? 'Condon, B.' 8 ? 'Maletic, M.' 9 ? 'Zhang, A.' 10 ? 'Hickey, M.J.' 11 ? 'Hughes, N.E.' 12 ? 'Chandrasekhar, S.' 13 ? 'Sloan, A.V.' 14 ? 'Gooding, K.' 15 ? 'Harvey, A.' 16 ? 'Yu, X.P.' 17 ? 'Kahl, S.D.' 18 ? 'Norman, B.H.' 19 0000-0002-0765-8548 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Biochim Biophys Acta Gen Subj' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1872-8006 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 1865 _citation.language ? _citation.page_first 129800 _citation.page_last 129800 _citation.title ;Structure-based, multi-targeted drug discovery approach to eicosanoid inhibition: Dual inhibitors of mPGES-1 and 5-lipoxygenase activating protein (FLAP). ; _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.bbagen.2020.129800 _citation.pdbx_database_id_PubMed 33246032 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ho, J.D.' 1 ? primary 'Lee, M.R.' 2 ? primary 'Rauch, C.T.' 3 ? primary 'Aznavour, K.' 4 ? primary 'Park, J.S.' 5 ? primary 'Luz, J.G.' 6 ? primary 'Antonysamy, S.' 7 ? primary 'Condon, B.' 8 ? primary 'Maletic, M.' 9 ? primary 'Zhang, A.' 10 ? primary 'Hickey, M.J.' 11 ? primary 'Hughes, N.E.' 12 ? primary 'Chandrasekhar, S.' 13 ? primary 'Sloan, A.V.' 14 ? primary 'Gooding, K.' 15 ? primary 'Harvey, A.' 16 ? primary 'Yu, X.P.' 17 ? primary 'Kahl, S.D.' 18 ? primary 'Norman, B.H.' 19 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Prostaglandin E synthase' 17323.559 1 5.3.99.3 ? ? ? 2 non-polymer syn '(2R)-cyclopentyl{4-[(quinolin-2-yl)methoxy]phenyl}acetic acid' 361.434 1 ? ? ? ? 3 non-polymer man 'octyl beta-D-glucopyranoside' 292.369 1 ? ? ? ? 4 non-polymer syn 'TETRAETHYLENE GLYCOL' 194.226 2 ? ? ? ? 5 water nat water 18.015 61 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Microsomal glutathione S-transferase 1-like 1,MGST1-L1,Microsomal prostaglandin E synthase 1,MPGES-1,p53-induced gene 12 protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;MALPAHSLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQY(CSO)RSDPDVERCLRAHRN DMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGKLRAPIRSVTYTLAQLPCASMALQILWEAARHL ; _entity_poly.pdbx_seq_one_letter_code_can ;MALPAHSLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCRSDPDVERCLRAHRNDMET IYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGKLRAPIRSVTYTLAQLPCASMALQILWEAARHL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '(2R)-cyclopentyl{4-[(quinolin-2-yl)methoxy]phenyl}acetic acid' QY1 3 'octyl beta-D-glucopyranoside' BOG 4 'TETRAETHYLENE GLYCOL' PG4 5 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 LEU n 1 4 PRO n 1 5 ALA n 1 6 HIS n 1 7 SER n 1 8 LEU n 1 9 VAL n 1 10 MET n 1 11 SER n 1 12 SER n 1 13 PRO n 1 14 ALA n 1 15 LEU n 1 16 PRO n 1 17 ALA n 1 18 PHE n 1 19 LEU n 1 20 LEU n 1 21 CYS n 1 22 SER n 1 23 THR n 1 24 LEU n 1 25 LEU n 1 26 VAL n 1 27 ILE n 1 28 LYS n 1 29 MET n 1 30 TYR n 1 31 VAL n 1 32 VAL n 1 33 ALA n 1 34 ILE n 1 35 ILE n 1 36 THR n 1 37 GLY n 1 38 GLN n 1 39 VAL n 1 40 ARG n 1 41 LEU n 1 42 ARG n 1 43 LYS n 1 44 LYS n 1 45 ALA n 1 46 PHE n 1 47 ALA n 1 48 ASN n 1 49 PRO n 1 50 GLU n 1 51 ASP n 1 52 ALA n 1 53 LEU n 1 54 ARG n 1 55 HIS n 1 56 GLY n 1 57 GLY n 1 58 PRO n 1 59 GLN n 1 60 TYR n 1 61 CSO n 1 62 ARG n 1 63 SER n 1 64 ASP n 1 65 PRO n 1 66 ASP n 1 67 VAL n 1 68 GLU n 1 69 ARG n 1 70 CYS n 1 71 LEU n 1 72 ARG n 1 73 ALA n 1 74 HIS n 1 75 ARG n 1 76 ASN n 1 77 ASP n 1 78 MET n 1 79 GLU n 1 80 THR n 1 81 ILE n 1 82 TYR n 1 83 PRO n 1 84 PHE n 1 85 LEU n 1 86 PHE n 1 87 LEU n 1 88 GLY n 1 89 PHE n 1 90 VAL n 1 91 TYR n 1 92 SER n 1 93 PHE n 1 94 LEU n 1 95 GLY n 1 96 PRO n 1 97 ASN n 1 98 PRO n 1 99 PHE n 1 100 VAL n 1 101 ALA n 1 102 TRP n 1 103 MET n 1 104 HIS n 1 105 PHE n 1 106 LEU n 1 107 VAL n 1 108 PHE n 1 109 LEU n 1 110 VAL n 1 111 GLY n 1 112 ARG n 1 113 VAL n 1 114 ALA n 1 115 HIS n 1 116 THR n 1 117 VAL n 1 118 ALA n 1 119 TYR n 1 120 LEU n 1 121 GLY n 1 122 LYS n 1 123 LEU n 1 124 ARG n 1 125 ALA n 1 126 PRO n 1 127 ILE n 1 128 ARG n 1 129 SER n 1 130 VAL n 1 131 THR n 1 132 TYR n 1 133 THR n 1 134 LEU n 1 135 ALA n 1 136 GLN n 1 137 LEU n 1 138 PRO n 1 139 CYS n 1 140 ALA n 1 141 SER n 1 142 MET n 1 143 ALA n 1 144 LEU n 1 145 GLN n 1 146 ILE n 1 147 LEU n 1 148 TRP n 1 149 GLU n 1 150 ALA n 1 151 ALA n 1 152 ARG n 1 153 HIS n 1 154 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 154 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'PTGES, MGST1L1, MPGES1, PGES, PIG12' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Spodoptera frugiperda' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 7108 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 BOG D-saccharide n 'octyl beta-D-glucopyranoside' 'Beta-Octylglucoside; octyl beta-D-glucoside; octyl D-glucoside; octyl glucoside' 'C14 H28 O6' 292.369 CSO 'L-peptide linking' n S-HYDROXYCYSTEINE ? 'C3 H7 N O3 S' 137.158 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PG4 non-polymer . 'TETRAETHYLENE GLYCOL' ? 'C8 H18 O5' 194.226 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 QY1 non-polymer . '(2R)-cyclopentyl{4-[(quinolin-2-yl)methoxy]phenyl}acetic acid' ? 'C23 H23 N O3' 361.434 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_chem_comp_identifier.comp_id BOG _pdbx_chem_comp_identifier.type 'IUPAC CARBOHYDRATE SYMBOL' _pdbx_chem_comp_identifier.program PDB-CARE _pdbx_chem_comp_identifier.program_version 1.0 _pdbx_chem_comp_identifier.identifier b-octylglucoside # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -1 ? ? ? A . n A 1 2 ALA 2 0 ? ? ? A . n A 1 3 LEU 3 1 ? ? ? A . n A 1 4 PRO 4 2 ? ? ? A . n A 1 5 ALA 5 3 ? ? ? A . n A 1 6 HIS 6 4 ? ? ? A . n A 1 7 SER 7 5 ? ? ? A . n A 1 8 LEU 8 6 ? ? ? A . n A 1 9 VAL 9 7 ? ? ? A . n A 1 10 MET 10 8 ? ? ? A . n A 1 11 SER 11 9 ? ? ? A . n A 1 12 SER 12 10 10 SER SER A . n A 1 13 PRO 13 11 11 PRO PRO A . n A 1 14 ALA 14 12 12 ALA ALA A . n A 1 15 LEU 15 13 13 LEU LEU A . n A 1 16 PRO 16 14 14 PRO PRO A . n A 1 17 ALA 17 15 15 ALA ALA A . n A 1 18 PHE 18 16 16 PHE PHE A . n A 1 19 LEU 19 17 17 LEU LEU A . n A 1 20 LEU 20 18 18 LEU LEU A . n A 1 21 CYS 21 19 19 CYS CYS A . n A 1 22 SER 22 20 20 SER SER A . n A 1 23 THR 23 21 21 THR THR A . n A 1 24 LEU 24 22 22 LEU LEU A . n A 1 25 LEU 25 23 23 LEU LEU A . n A 1 26 VAL 26 24 24 VAL VAL A . n A 1 27 ILE 27 25 25 ILE ILE A . n A 1 28 LYS 28 26 26 LYS LYS A . n A 1 29 MET 29 27 27 MET MET A . n A 1 30 TYR 30 28 28 TYR TYR A . n A 1 31 VAL 31 29 29 VAL VAL A . n A 1 32 VAL 32 30 30 VAL VAL A . n A 1 33 ALA 33 31 31 ALA ALA A . n A 1 34 ILE 34 32 32 ILE ILE A . n A 1 35 ILE 35 33 33 ILE ILE A . n A 1 36 THR 36 34 34 THR THR A . n A 1 37 GLY 37 35 35 GLY GLY A . n A 1 38 GLN 38 36 36 GLN GLN A . n A 1 39 VAL 39 37 37 VAL VAL A . n A 1 40 ARG 40 38 38 ARG ARG A . n A 1 41 LEU 41 39 39 LEU LEU A . n A 1 42 ARG 42 40 40 ARG ARG A . n A 1 43 LYS 43 41 41 LYS LYS A . n A 1 44 LYS 44 42 42 LYS LYS A . n A 1 45 ALA 45 43 43 ALA ALA A . n A 1 46 PHE 46 44 44 PHE PHE A . n A 1 47 ALA 47 45 45 ALA ALA A . n A 1 48 ASN 48 46 46 ASN ASN A . n A 1 49 PRO 49 47 47 PRO PRO A . n A 1 50 GLU 50 48 48 GLU GLU A . n A 1 51 ASP 51 49 49 ASP ASP A . n A 1 52 ALA 52 50 50 ALA ALA A . n A 1 53 LEU 53 51 51 LEU LEU A . n A 1 54 ARG 54 52 52 ARG ARG A . n A 1 55 HIS 55 53 53 HIS HIS A . n A 1 56 GLY 56 54 54 GLY GLY A . n A 1 57 GLY 57 55 55 GLY GLY A . n A 1 58 PRO 58 56 56 PRO PRO A . n A 1 59 GLN 59 57 57 GLN GLN A . n A 1 60 TYR 60 58 58 TYR TYR A . n A 1 61 CSO 61 59 59 CSO CSO A . n A 1 62 ARG 62 60 60 ARG ARG A . n A 1 63 SER 63 61 61 SER SER A . n A 1 64 ASP 64 62 62 ASP ASP A . n A 1 65 PRO 65 63 63 PRO PRO A . n A 1 66 ASP 66 64 64 ASP ASP A . n A 1 67 VAL 67 65 65 VAL VAL A . n A 1 68 GLU 68 66 66 GLU GLU A . n A 1 69 ARG 69 67 67 ARG ARG A . n A 1 70 CYS 70 68 68 CYS CYS A . n A 1 71 LEU 71 69 69 LEU LEU A . n A 1 72 ARG 72 70 70 ARG ARG A . n A 1 73 ALA 73 71 71 ALA ALA A . n A 1 74 HIS 74 72 72 HIS HIS A . n A 1 75 ARG 75 73 73 ARG ARG A . n A 1 76 ASN 76 74 74 ASN ASN A . n A 1 77 ASP 77 75 75 ASP ASP A . n A 1 78 MET 78 76 76 MET MET A . n A 1 79 GLU 79 77 77 GLU GLU A . n A 1 80 THR 80 78 78 THR THR A . n A 1 81 ILE 81 79 79 ILE ILE A . n A 1 82 TYR 82 80 80 TYR TYR A . n A 1 83 PRO 83 81 81 PRO PRO A . n A 1 84 PHE 84 82 82 PHE PHE A . n A 1 85 LEU 85 83 83 LEU LEU A . n A 1 86 PHE 86 84 84 PHE PHE A . n A 1 87 LEU 87 85 85 LEU LEU A . n A 1 88 GLY 88 86 86 GLY GLY A . n A 1 89 PHE 89 87 87 PHE PHE A . n A 1 90 VAL 90 88 88 VAL VAL A . n A 1 91 TYR 91 89 89 TYR TYR A . n A 1 92 SER 92 90 90 SER SER A . n A 1 93 PHE 93 91 91 PHE PHE A . n A 1 94 LEU 94 92 92 LEU LEU A . n A 1 95 GLY 95 93 93 GLY GLY A . n A 1 96 PRO 96 94 94 PRO PRO A . n A 1 97 ASN 97 95 95 ASN ASN A . n A 1 98 PRO 98 96 96 PRO PRO A . n A 1 99 PHE 99 97 97 PHE PHE A . n A 1 100 VAL 100 98 98 VAL VAL A . n A 1 101 ALA 101 99 99 ALA ALA A . n A 1 102 TRP 102 100 100 TRP TRP A . n A 1 103 MET 103 101 101 MET MET A . n A 1 104 HIS 104 102 102 HIS HIS A . n A 1 105 PHE 105 103 103 PHE PHE A . n A 1 106 LEU 106 104 104 LEU LEU A . n A 1 107 VAL 107 105 105 VAL VAL A . n A 1 108 PHE 108 106 106 PHE PHE A . n A 1 109 LEU 109 107 107 LEU LEU A . n A 1 110 VAL 110 108 108 VAL VAL A . n A 1 111 GLY 111 109 109 GLY GLY A . n A 1 112 ARG 112 110 110 ARG ARG A . n A 1 113 VAL 113 111 111 VAL VAL A . n A 1 114 ALA 114 112 112 ALA ALA A . n A 1 115 HIS 115 113 113 HIS HIS A . n A 1 116 THR 116 114 114 THR THR A . n A 1 117 VAL 117 115 115 VAL VAL A . n A 1 118 ALA 118 116 116 ALA ALA A . n A 1 119 TYR 119 117 117 TYR TYR A . n A 1 120 LEU 120 118 118 LEU LEU A . n A 1 121 GLY 121 119 119 GLY GLY A . n A 1 122 LYS 122 120 120 LYS LYS A . n A 1 123 LEU 123 121 121 LEU LEU A . n A 1 124 ARG 124 122 122 ARG ARG A . n A 1 125 ALA 125 123 123 ALA ALA A . n A 1 126 PRO 126 124 124 PRO PRO A . n A 1 127 ILE 127 125 125 ILE ILE A . n A 1 128 ARG 128 126 126 ARG ARG A . n A 1 129 SER 129 127 127 SER SER A . n A 1 130 VAL 130 128 128 VAL VAL A . n A 1 131 THR 131 129 129 THR THR A . n A 1 132 TYR 132 130 130 TYR TYR A . n A 1 133 THR 133 131 131 THR THR A . n A 1 134 LEU 134 132 132 LEU LEU A . n A 1 135 ALA 135 133 133 ALA ALA A . n A 1 136 GLN 136 134 134 GLN GLN A . n A 1 137 LEU 137 135 135 LEU LEU A . n A 1 138 PRO 138 136 136 PRO PRO A . n A 1 139 CYS 139 137 137 CYS CYS A . n A 1 140 ALA 140 138 138 ALA ALA A . n A 1 141 SER 141 139 139 SER SER A . n A 1 142 MET 142 140 140 MET MET A . n A 1 143 ALA 143 141 141 ALA ALA A . n A 1 144 LEU 144 142 142 LEU LEU A . n A 1 145 GLN 145 143 143 GLN GLN A . n A 1 146 ILE 146 144 144 ILE ILE A . n A 1 147 LEU 147 145 145 LEU LEU A . n A 1 148 TRP 148 146 146 TRP TRP A . n A 1 149 GLU 149 147 147 GLU GLU A . n A 1 150 ALA 150 148 148 ALA ALA A . n A 1 151 ALA 151 149 149 ALA ALA A . n A 1 152 ARG 152 150 150 ARG ARG A . n A 1 153 HIS 153 151 151 HIS HIS A . n A 1 154 LEU 154 152 152 LEU LEU A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id QY1 _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id QY1 _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 QY1 1 201 1 QY1 SX1 A . C 3 BOG 1 202 1 BOG BOG A . D 4 PG4 1 203 2 PG4 PG4 A . E 4 PG4 1 204 3 PG4 PG4 A . F 5 HOH 1 301 47 HOH HOH A . F 5 HOH 2 302 21 HOH HOH A . F 5 HOH 3 303 25 HOH HOH A . F 5 HOH 4 304 15 HOH HOH A . F 5 HOH 5 305 27 HOH HOH A . F 5 HOH 6 306 13 HOH HOH A . F 5 HOH 7 307 49 HOH HOH A . F 5 HOH 8 308 6 HOH HOH A . F 5 HOH 9 309 28 HOH HOH A . F 5 HOH 10 310 14 HOH HOH A . F 5 HOH 11 311 30 HOH HOH A . F 5 HOH 12 312 34 HOH HOH A . F 5 HOH 13 313 56 HOH HOH A . F 5 HOH 14 314 31 HOH HOH A . F 5 HOH 15 315 52 HOH HOH A . F 5 HOH 16 316 39 HOH HOH A . F 5 HOH 17 317 18 HOH HOH A . F 5 HOH 18 318 20 HOH HOH A . F 5 HOH 19 319 40 HOH HOH A . F 5 HOH 20 320 60 HOH HOH A . F 5 HOH 21 321 29 HOH HOH A . F 5 HOH 22 322 44 HOH HOH A . F 5 HOH 23 323 48 HOH HOH A . F 5 HOH 24 324 5 HOH HOH A . F 5 HOH 25 325 54 HOH HOH A . F 5 HOH 26 326 26 HOH HOH A . F 5 HOH 27 327 61 HOH HOH A . F 5 HOH 28 328 16 HOH HOH A . F 5 HOH 29 329 12 HOH HOH A . F 5 HOH 30 330 43 HOH HOH A . F 5 HOH 31 331 42 HOH HOH A . F 5 HOH 32 332 38 HOH HOH A . F 5 HOH 33 333 22 HOH HOH A . F 5 HOH 34 334 46 HOH HOH A . F 5 HOH 35 335 23 HOH HOH A . F 5 HOH 36 336 19 HOH HOH A . F 5 HOH 37 337 32 HOH HOH A . F 5 HOH 38 338 8 HOH HOH A . F 5 HOH 39 339 36 HOH HOH A . F 5 HOH 40 340 2 HOH HOH A . F 5 HOH 41 341 24 HOH HOH A . F 5 HOH 42 342 53 HOH HOH A . F 5 HOH 43 343 57 HOH HOH A . F 5 HOH 44 344 50 HOH HOH A . F 5 HOH 45 345 55 HOH HOH A . F 5 HOH 46 346 11 HOH HOH A . F 5 HOH 47 347 10 HOH HOH A . F 5 HOH 48 348 59 HOH HOH A . F 5 HOH 49 349 7 HOH HOH A . F 5 HOH 50 350 17 HOH HOH A . F 5 HOH 51 351 9 HOH HOH A . F 5 HOH 52 352 35 HOH HOH A . F 5 HOH 53 353 41 HOH HOH A . F 5 HOH 54 354 1 HOH HOH A . F 5 HOH 55 355 58 HOH HOH A . F 5 HOH 56 356 45 HOH HOH A . F 5 HOH 57 357 3 HOH HOH A . F 5 HOH 58 358 33 HOH HOH A . F 5 HOH 59 359 37 HOH HOH A . F 5 HOH 60 360 51 HOH HOH A . F 5 HOH 61 361 4 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A SER 10 ? OG ? A SER 12 OG 2 1 N 1 A PG4 204 ? C5 ? E PG4 1 C5 3 1 N 1 A PG4 204 ? C6 ? E PG4 1 C6 4 1 N 1 A PG4 204 ? O4 ? E PG4 1 O4 5 1 N 1 A PG4 204 ? C7 ? E PG4 1 C7 6 1 N 1 A PG4 204 ? C8 ? E PG4 1 C8 7 1 N 1 A PG4 204 ? O5 ? E PG4 1 O5 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0103 1 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? MOSFLM ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALA ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 6VL4 _cell.details ? _cell.formula_units_Z ? _cell.length_a 76.417 _cell.length_a_esd ? _cell.length_b 76.417 _cell.length_b_esd ? _cell.length_c 123.784 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 9 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6VL4 _symmetry.cell_setting ? _symmetry.Int_Tables_number 146 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'H 3' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6VL4 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.2 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '100mM Tris HCl pH 8.2, 29% PEG 1K, 1mM DG-031' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'RAYONIX MX-225' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2013-05-30 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9793 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 31-ID' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9793 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 31-ID _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6VL4 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.4 _reflns.d_resolution_low 23.19 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 52754 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.3 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 5.6 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value 0.082 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 10.3 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.4 _reflns_shell.d_res_low 1.48 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.4 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 7803 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value 0.72 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] 2.5100 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][2] 2.5100 _refine.aniso_B[2][3] 0.0000 _refine.aniso_B[3][3] -5.0200 _refine.B_iso_max 81.660 _refine.B_iso_mean 19.1960 _refine.B_iso_min 5.220 _refine.correlation_coeff_Fo_to_Fc 0.9730 _refine.correlation_coeff_Fo_to_Fc_free 0.9730 _refine.details 'HYDROGENS HAVE BEEN USED IF PRESENT IN THE INPUT U VALUES : REFINED INDIVIDUALLY' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6VL4 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.4000 _refine.ls_d_res_low 17.6000 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 50099 _refine.ls_number_reflns_R_free 2652 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.3600 _refine.ls_percent_reflns_R_free 5.0000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1398 _refine.ls_R_factor_R_free 0.1450 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1396 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.0070 _refine.pdbx_overall_ESU_R_Free 0.0070 _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 0.3400 _refine.overall_SU_ML 0.0150 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 1.4000 _refine_hist.d_res_low 17.6000 _refine_hist.number_atoms_solvent 61 _refine_hist.number_atoms_total 1267 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 143 _refine_hist.pdbx_B_iso_mean_ligand 42.26 _refine_hist.pdbx_B_iso_mean_solvent 24.77 _refine_hist.pdbx_number_atoms_protein 1139 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 67 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.003 0.012 1277 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 1.002 1.701 1736 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 4.006 5.000 152 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 41.093 21.176 51 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 13.066 15.000 194 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 11.019 15.000 11 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.091 0.200 161 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.004 0.020 930 ? r_gen_planes_refined ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.4000 _refine_ls_shell.d_res_low 1.4360 _refine_ls_shell.number_reflns_all 3934 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 196 _refine_ls_shell.number_reflns_R_work 3738 _refine_ls_shell.percent_reflns_obs 99.9700 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.2650 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.2430 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 6VL4 _struct.title 'Crystal Structure of mPGES-1 bound to DG-031' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6VL4 _struct_keywords.text 'mPGES-1, MEMBRANE PROTEIN, ISOMERASE' _struct_keywords.pdbx_keywords 'ISOMERASE, MEMBRANE PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 4 ? F N N 5 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PTGES_HUMAN _struct_ref.pdbx_db_accession O14684 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;PAHSLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCRSDPDVERCLRAHRNDMETIYP FLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGKLRAPIRSVTYTLAQLPCASMALQILWEAARHL ; _struct_ref.pdbx_align_begin 2 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6VL4 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 154 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O14684 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 152 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 152 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6VL4 MET A 1 ? UNP O14684 ? ? 'initiating methionine' -1 1 1 6VL4 ALA A 2 ? UNP O14684 ? ? 'expression tag' 0 2 1 6VL4 LEU A 3 ? UNP O14684 ? ? 'expression tag' 1 3 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details trimeric _pdbx_struct_assembly.oligomeric_count 3 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 11370 ? 1 MORE -23 ? 1 'SSA (A^2)' 18130 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_555 -y,x-y,z -0.5000000000 -0.8660254038 0.0000000000 0.0000000000 0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_555 -x+y,-x,z -0.5000000000 0.8660254038 0.0000000000 0.0000000000 -0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ALA A 14 ? LYS A 44 ? ALA A 12 LYS A 42 1 ? 31 HELX_P HELX_P2 AA2 ASN A 48 ? HIS A 55 ? ASN A 46 HIS A 53 1 ? 8 HELX_P HELX_P3 AA3 GLY A 57 ? CSO A 61 ? GLY A 55 CSO A 59 5 ? 5 HELX_P HELX_P4 AA4 ASP A 64 ? PHE A 93 ? ASP A 62 PHE A 91 1 ? 30 HELX_P HELX_P5 AA5 ASN A 97 ? GLY A 121 ? ASN A 95 GLY A 119 1 ? 25 HELX_P HELX_P6 AA6 PRO A 126 ? HIS A 153 ? PRO A 124 HIS A 151 1 ? 28 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A TYR 60 C ? ? ? 1_555 A CSO 61 N ? ? A TYR 58 A CSO 59 1_555 ? ? ? ? ? ? ? 1.341 ? ? covale2 covale both ? A CSO 61 C ? ? ? 1_555 A ARG 62 N ? ? A CSO 59 A ARG 60 1_555 ? ? ? ? ? ? ? 1.338 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id CSO _pdbx_modification_feature.label_asym_id A _pdbx_modification_feature.label_seq_id 61 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id . _pdbx_modification_feature.modified_residue_label_asym_id . _pdbx_modification_feature.modified_residue_label_seq_id . _pdbx_modification_feature.modified_residue_label_alt_id . _pdbx_modification_feature.auth_comp_id CSO _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 59 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id . _pdbx_modification_feature.modified_residue_auth_asym_id . _pdbx_modification_feature.modified_residue_auth_seq_id . _pdbx_modification_feature.modified_residue_PDB_ins_code . _pdbx_modification_feature.modified_residue_symmetry . _pdbx_modification_feature.comp_id_linking_atom . _pdbx_modification_feature.modified_residue_id_linking_atom . _pdbx_modification_feature.modified_residue_id CYS _pdbx_modification_feature.ref_pcm_id 1 _pdbx_modification_feature.ref_comp_id CSO _pdbx_modification_feature.type Hydroxylation _pdbx_modification_feature.category 'Named protein modification' # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ALA _struct_mon_prot_cis.label_seq_id 125 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ALA _struct_mon_prot_cis.auth_seq_id 123 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 126 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 124 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 7.33 # _pdbx_entry_details.entry_id 6VL4 _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_protein_modification Y # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id CSO _pdbx_struct_mod_residue.label_seq_id 61 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id CSO _pdbx_struct_mod_residue.auth_seq_id 59 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id CYS _pdbx_struct_mod_residue.details 'modified residue' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -1 ? A MET 1 2 1 Y 1 A ALA 0 ? A ALA 2 3 1 Y 1 A LEU 1 ? A LEU 3 4 1 Y 1 A PRO 2 ? A PRO 4 5 1 Y 1 A ALA 3 ? A ALA 5 6 1 Y 1 A HIS 4 ? A HIS 6 7 1 Y 1 A SER 5 ? A SER 7 8 1 Y 1 A LEU 6 ? A LEU 8 9 1 Y 1 A VAL 7 ? A VAL 9 10 1 Y 1 A MET 8 ? A MET 10 11 1 Y 1 A SER 9 ? A SER 11 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 BOG C1 C N R 74 BOG O1 O N N 75 BOG C2 C N R 76 BOG O2 O N N 77 BOG C3 C N S 78 BOG O3 O N N 79 BOG C4 C N S 80 BOG O4 O N N 81 BOG C5 C N R 82 BOG O5 O N N 83 BOG C6 C N N 84 BOG O6 O N N 85 BOG "C1'" C N N 86 BOG "C2'" C N N 87 BOG "C3'" C N N 88 BOG "C4'" C N N 89 BOG "C5'" C N N 90 BOG "C6'" C N N 91 BOG "C7'" C N N 92 BOG "C8'" C N N 93 BOG H1 H N N 94 BOG H2 H N N 95 BOG HO2 H N N 96 BOG H3 H N N 97 BOG HO3 H N N 98 BOG H4 H N N 99 BOG HO4 H N N 100 BOG H5 H N N 101 BOG H61 H N N 102 BOG H62 H N N 103 BOG HO6 H N N 104 BOG "H1'1" H N N 105 BOG "H1'2" H N N 106 BOG "H2'1" H N N 107 BOG "H2'2" H N N 108 BOG "H3'1" H N N 109 BOG "H3'2" H N N 110 BOG "H4'1" H N N 111 BOG "H4'2" H N N 112 BOG "H5'1" H N N 113 BOG "H5'2" H N N 114 BOG "H6'1" H N N 115 BOG "H6'2" H N N 116 BOG "H7'1" H N N 117 BOG "H7'2" H N N 118 BOG "H8'1" H N N 119 BOG "H8'2" H N N 120 BOG "H8'3" H N N 121 CSO N N N N 122 CSO CA C N R 123 CSO CB C N N 124 CSO SG S N N 125 CSO C C N N 126 CSO O O N N 127 CSO OXT O N N 128 CSO OD O N N 129 CSO H H N N 130 CSO H2 H N N 131 CSO HA H N N 132 CSO HB2 H N N 133 CSO HB3 H N N 134 CSO HXT H N N 135 CSO HD H N N 136 CYS N N N N 137 CYS CA C N R 138 CYS C C N N 139 CYS O O N N 140 CYS CB C N N 141 CYS SG S N N 142 CYS OXT O N N 143 CYS H H N N 144 CYS H2 H N N 145 CYS HA H N N 146 CYS HB2 H N N 147 CYS HB3 H N N 148 CYS HG H N N 149 CYS HXT H N N 150 GLN N N N N 151 GLN CA C N S 152 GLN C C N N 153 GLN O O N N 154 GLN CB C N N 155 GLN CG C N N 156 GLN CD C N N 157 GLN OE1 O N N 158 GLN NE2 N N N 159 GLN OXT O N N 160 GLN H H N N 161 GLN H2 H N N 162 GLN HA H N N 163 GLN HB2 H N N 164 GLN HB3 H N N 165 GLN HG2 H N N 166 GLN HG3 H N N 167 GLN HE21 H N N 168 GLN HE22 H N N 169 GLN HXT H N N 170 GLU N N N N 171 GLU CA C N S 172 GLU C C N N 173 GLU O O N N 174 GLU CB C N N 175 GLU CG C N N 176 GLU CD C N N 177 GLU OE1 O N N 178 GLU OE2 O N N 179 GLU OXT O N N 180 GLU H H N N 181 GLU H2 H N N 182 GLU HA H N N 183 GLU HB2 H N N 184 GLU HB3 H N N 185 GLU HG2 H N N 186 GLU HG3 H N N 187 GLU HE2 H N N 188 GLU HXT H N N 189 GLY N N N N 190 GLY CA C N N 191 GLY C C N N 192 GLY O O N N 193 GLY OXT O N N 194 GLY H H N N 195 GLY H2 H N N 196 GLY HA2 H N N 197 GLY HA3 H N N 198 GLY HXT H N N 199 HIS N N N N 200 HIS CA C N S 201 HIS C C N N 202 HIS O O N N 203 HIS CB C N N 204 HIS CG C Y N 205 HIS ND1 N Y N 206 HIS CD2 C Y N 207 HIS CE1 C Y N 208 HIS NE2 N Y N 209 HIS OXT O N N 210 HIS H H N N 211 HIS H2 H N N 212 HIS HA H N N 213 HIS HB2 H N N 214 HIS HB3 H N N 215 HIS HD1 H N N 216 HIS HD2 H N N 217 HIS HE1 H N N 218 HIS HE2 H N N 219 HIS HXT H N N 220 HOH O O N N 221 HOH H1 H N N 222 HOH H2 H N N 223 ILE N N N N 224 ILE CA C N S 225 ILE C C N N 226 ILE O O N N 227 ILE CB C N S 228 ILE CG1 C N N 229 ILE CG2 C N N 230 ILE CD1 C N N 231 ILE OXT O N N 232 ILE H H N N 233 ILE H2 H N N 234 ILE HA H N N 235 ILE HB H N N 236 ILE HG12 H N N 237 ILE HG13 H N N 238 ILE HG21 H N N 239 ILE HG22 H N N 240 ILE HG23 H N N 241 ILE HD11 H N N 242 ILE HD12 H N N 243 ILE HD13 H N N 244 ILE HXT H N N 245 LEU N N N N 246 LEU CA C N S 247 LEU C C N N 248 LEU O O N N 249 LEU CB C N N 250 LEU CG C N N 251 LEU CD1 C N N 252 LEU CD2 C N N 253 LEU OXT O N N 254 LEU H H N N 255 LEU H2 H N N 256 LEU HA H N N 257 LEU HB2 H N N 258 LEU HB3 H N N 259 LEU HG H N N 260 LEU HD11 H N N 261 LEU HD12 H N N 262 LEU HD13 H N N 263 LEU HD21 H N N 264 LEU HD22 H N N 265 LEU HD23 H N N 266 LEU HXT H N N 267 LYS N N N N 268 LYS CA C N S 269 LYS C C N N 270 LYS O O N N 271 LYS CB C N N 272 LYS CG C N N 273 LYS CD C N N 274 LYS CE C N N 275 LYS NZ N N N 276 LYS OXT O N N 277 LYS H H N N 278 LYS H2 H N N 279 LYS HA H N N 280 LYS HB2 H N N 281 LYS HB3 H N N 282 LYS HG2 H N N 283 LYS HG3 H N N 284 LYS HD2 H N N 285 LYS HD3 H N N 286 LYS HE2 H N N 287 LYS HE3 H N N 288 LYS HZ1 H N N 289 LYS HZ2 H N N 290 LYS HZ3 H N N 291 LYS HXT H N N 292 MET N N N N 293 MET CA C N S 294 MET C C N N 295 MET O O N N 296 MET CB C N N 297 MET CG C N N 298 MET SD S N N 299 MET CE C N N 300 MET OXT O N N 301 MET H H N N 302 MET H2 H N N 303 MET HA H N N 304 MET HB2 H N N 305 MET HB3 H N N 306 MET HG2 H N N 307 MET HG3 H N N 308 MET HE1 H N N 309 MET HE2 H N N 310 MET HE3 H N N 311 MET HXT H N N 312 PG4 O1 O N N 313 PG4 C1 C N N 314 PG4 C2 C N N 315 PG4 O2 O N N 316 PG4 C3 C N N 317 PG4 C4 C N N 318 PG4 O3 O N N 319 PG4 C5 C N N 320 PG4 C6 C N N 321 PG4 O4 O N N 322 PG4 C7 C N N 323 PG4 C8 C N N 324 PG4 O5 O N N 325 PG4 HO1 H N N 326 PG4 H11 H N N 327 PG4 H12 H N N 328 PG4 H21 H N N 329 PG4 H22 H N N 330 PG4 H31 H N N 331 PG4 H32 H N N 332 PG4 H41 H N N 333 PG4 H42 H N N 334 PG4 H51 H N N 335 PG4 H52 H N N 336 PG4 H61 H N N 337 PG4 H62 H N N 338 PG4 H71 H N N 339 PG4 H72 H N N 340 PG4 H81 H N N 341 PG4 H82 H N N 342 PG4 HO5 H N N 343 PHE N N N N 344 PHE CA C N S 345 PHE C C N N 346 PHE O O N N 347 PHE CB C N N 348 PHE CG C Y N 349 PHE CD1 C Y N 350 PHE CD2 C Y N 351 PHE CE1 C Y N 352 PHE CE2 C Y N 353 PHE CZ C Y N 354 PHE OXT O N N 355 PHE H H N N 356 PHE H2 H N N 357 PHE HA H N N 358 PHE HB2 H N N 359 PHE HB3 H N N 360 PHE HD1 H N N 361 PHE HD2 H N N 362 PHE HE1 H N N 363 PHE HE2 H N N 364 PHE HZ H N N 365 PHE HXT H N N 366 PRO N N N N 367 PRO CA C N S 368 PRO C C N N 369 PRO O O N N 370 PRO CB C N N 371 PRO CG C N N 372 PRO CD C N N 373 PRO OXT O N N 374 PRO H H N N 375 PRO HA H N N 376 PRO HB2 H N N 377 PRO HB3 H N N 378 PRO HG2 H N N 379 PRO HG3 H N N 380 PRO HD2 H N N 381 PRO HD3 H N N 382 PRO HXT H N N 383 QY1 C7 C Y N 384 QY1 C6 C Y N 385 QY1 C1 C Y N 386 QY1 C5 C Y N 387 QY1 C4 C Y N 388 QY1 C3 C Y N 389 QY1 C2 C Y N 390 QY1 C8 C Y N 391 QY1 C9 C Y N 392 QY1 C10 C Y N 393 QY1 C11 C Y N 394 QY1 C12 C Y N 395 QY1 C13 C Y N 396 QY1 C14 C Y N 397 QY1 C15 C Y N 398 QY1 C16 C N N 399 QY1 C17 C N N 400 QY1 C18 C N N 401 QY1 C19 C N N 402 QY1 C20 C N N 403 QY1 C21 C N N 404 QY1 C22 C N N 405 QY1 C23 C N R 406 QY1 N24 N Y N 407 QY1 O25 O N N 408 QY1 O26 O N N 409 QY1 O27 O N N 410 QY1 H1 H N N 411 QY1 H2 H N N 412 QY1 H3 H N N 413 QY1 H4 H N N 414 QY1 H5 H N N 415 QY1 H6 H N N 416 QY1 H7 H N N 417 QY1 H8 H N N 418 QY1 H9 H N N 419 QY1 H10 H N N 420 QY1 H11 H N N 421 QY1 H12 H N N 422 QY1 H13 H N N 423 QY1 H14 H N N 424 QY1 H15 H N N 425 QY1 H16 H N N 426 QY1 H17 H N N 427 QY1 H18 H N N 428 QY1 H19 H N N 429 QY1 H20 H N N 430 QY1 H21 H N N 431 QY1 H22 H N N 432 QY1 H23 H N N 433 SER N N N N 434 SER CA C N S 435 SER C C N N 436 SER O O N N 437 SER CB C N N 438 SER OG O N N 439 SER OXT O N N 440 SER H H N N 441 SER H2 H N N 442 SER HA H N N 443 SER HB2 H N N 444 SER HB3 H N N 445 SER HG H N N 446 SER HXT H N N 447 THR N N N N 448 THR CA C N S 449 THR C C N N 450 THR O O N N 451 THR CB C N R 452 THR OG1 O N N 453 THR CG2 C N N 454 THR OXT O N N 455 THR H H N N 456 THR H2 H N N 457 THR HA H N N 458 THR HB H N N 459 THR HG1 H N N 460 THR HG21 H N N 461 THR HG22 H N N 462 THR HG23 H N N 463 THR HXT H N N 464 TRP N N N N 465 TRP CA C N S 466 TRP C C N N 467 TRP O O N N 468 TRP CB C N N 469 TRP CG C Y N 470 TRP CD1 C Y N 471 TRP CD2 C Y N 472 TRP NE1 N Y N 473 TRP CE2 C Y N 474 TRP CE3 C Y N 475 TRP CZ2 C Y N 476 TRP CZ3 C Y N 477 TRP CH2 C Y N 478 TRP OXT O N N 479 TRP H H N N 480 TRP H2 H N N 481 TRP HA H N N 482 TRP HB2 H N N 483 TRP HB3 H N N 484 TRP HD1 H N N 485 TRP HE1 H N N 486 TRP HE3 H N N 487 TRP HZ2 H N N 488 TRP HZ3 H N N 489 TRP HH2 H N N 490 TRP HXT H N N 491 TYR N N N N 492 TYR CA C N S 493 TYR C C N N 494 TYR O O N N 495 TYR CB C N N 496 TYR CG C Y N 497 TYR CD1 C Y N 498 TYR CD2 C Y N 499 TYR CE1 C Y N 500 TYR CE2 C Y N 501 TYR CZ C Y N 502 TYR OH O N N 503 TYR OXT O N N 504 TYR H H N N 505 TYR H2 H N N 506 TYR HA H N N 507 TYR HB2 H N N 508 TYR HB3 H N N 509 TYR HD1 H N N 510 TYR HD2 H N N 511 TYR HE1 H N N 512 TYR HE2 H N N 513 TYR HH H N N 514 TYR HXT H N N 515 VAL N N N N 516 VAL CA C N S 517 VAL C C N N 518 VAL O O N N 519 VAL CB C N N 520 VAL CG1 C N N 521 VAL CG2 C N N 522 VAL OXT O N N 523 VAL H H N N 524 VAL H2 H N N 525 VAL HA H N N 526 VAL HB H N N 527 VAL HG11 H N N 528 VAL HG12 H N N 529 VAL HG13 H N N 530 VAL HG21 H N N 531 VAL HG22 H N N 532 VAL HG23 H N N 533 VAL HXT H N N 534 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 BOG C1 O1 sing N N 70 BOG C1 C2 sing N N 71 BOG C1 O5 sing N N 72 BOG C1 H1 sing N N 73 BOG O1 "C1'" sing N N 74 BOG C2 O2 sing N N 75 BOG C2 C3 sing N N 76 BOG C2 H2 sing N N 77 BOG O2 HO2 sing N N 78 BOG C3 O3 sing N N 79 BOG C3 C4 sing N N 80 BOG C3 H3 sing N N 81 BOG O3 HO3 sing N N 82 BOG C4 O4 sing N N 83 BOG C4 C5 sing N N 84 BOG C4 H4 sing N N 85 BOG O4 HO4 sing N N 86 BOG C5 O5 sing N N 87 BOG C5 C6 sing N N 88 BOG C5 H5 sing N N 89 BOG C6 O6 sing N N 90 BOG C6 H61 sing N N 91 BOG C6 H62 sing N N 92 BOG O6 HO6 sing N N 93 BOG "C1'" "C2'" sing N N 94 BOG "C1'" "H1'1" sing N N 95 BOG "C1'" "H1'2" sing N N 96 BOG "C2'" "C3'" sing N N 97 BOG "C2'" "H2'1" sing N N 98 BOG "C2'" "H2'2" sing N N 99 BOG "C3'" "C4'" sing N N 100 BOG "C3'" "H3'1" sing N N 101 BOG "C3'" "H3'2" sing N N 102 BOG "C4'" "C5'" sing N N 103 BOG "C4'" "H4'1" sing N N 104 BOG "C4'" "H4'2" sing N N 105 BOG "C5'" "C6'" sing N N 106 BOG "C5'" "H5'1" sing N N 107 BOG "C5'" "H5'2" sing N N 108 BOG "C6'" "C7'" sing N N 109 BOG "C6'" "H6'1" sing N N 110 BOG "C6'" "H6'2" sing N N 111 BOG "C7'" "C8'" sing N N 112 BOG "C7'" "H7'1" sing N N 113 BOG "C7'" "H7'2" sing N N 114 BOG "C8'" "H8'1" sing N N 115 BOG "C8'" "H8'2" sing N N 116 BOG "C8'" "H8'3" sing N N 117 CSO N CA sing N N 118 CSO N H sing N N 119 CSO N H2 sing N N 120 CSO CA CB sing N N 121 CSO CA C sing N N 122 CSO CA HA sing N N 123 CSO CB SG sing N N 124 CSO CB HB2 sing N N 125 CSO CB HB3 sing N N 126 CSO SG OD sing N N 127 CSO C O doub N N 128 CSO C OXT sing N N 129 CSO OXT HXT sing N N 130 CSO OD HD sing N N 131 CYS N CA sing N N 132 CYS N H sing N N 133 CYS N H2 sing N N 134 CYS CA C sing N N 135 CYS CA CB sing N N 136 CYS CA HA sing N N 137 CYS C O doub N N 138 CYS C OXT sing N N 139 CYS CB SG sing N N 140 CYS CB HB2 sing N N 141 CYS CB HB3 sing N N 142 CYS SG HG sing N N 143 CYS OXT HXT sing N N 144 GLN N CA sing N N 145 GLN N H sing N N 146 GLN N H2 sing N N 147 GLN CA C sing N N 148 GLN CA CB sing N N 149 GLN CA HA sing N N 150 GLN C O doub N N 151 GLN C OXT sing N N 152 GLN CB CG sing N N 153 GLN CB HB2 sing N N 154 GLN CB HB3 sing N N 155 GLN CG CD sing N N 156 GLN CG HG2 sing N N 157 GLN CG HG3 sing N N 158 GLN CD OE1 doub N N 159 GLN CD NE2 sing N N 160 GLN NE2 HE21 sing N N 161 GLN NE2 HE22 sing N N 162 GLN OXT HXT sing N N 163 GLU N CA sing N N 164 GLU N H sing N N 165 GLU N H2 sing N N 166 GLU CA C sing N N 167 GLU CA CB sing N N 168 GLU CA HA sing N N 169 GLU C O doub N N 170 GLU C OXT sing N N 171 GLU CB CG sing N N 172 GLU CB HB2 sing N N 173 GLU CB HB3 sing N N 174 GLU CG CD sing N N 175 GLU CG HG2 sing N N 176 GLU CG HG3 sing N N 177 GLU CD OE1 doub N N 178 GLU CD OE2 sing N N 179 GLU OE2 HE2 sing N N 180 GLU OXT HXT sing N N 181 GLY N CA sing N N 182 GLY N H sing N N 183 GLY N H2 sing N N 184 GLY CA C sing N N 185 GLY CA HA2 sing N N 186 GLY CA HA3 sing N N 187 GLY C O doub N N 188 GLY C OXT sing N N 189 GLY OXT HXT sing N N 190 HIS N CA sing N N 191 HIS N H sing N N 192 HIS N H2 sing N N 193 HIS CA C sing N N 194 HIS CA CB sing N N 195 HIS CA HA sing N N 196 HIS C O doub N N 197 HIS C OXT sing N N 198 HIS CB CG sing N N 199 HIS CB HB2 sing N N 200 HIS CB HB3 sing N N 201 HIS CG ND1 sing Y N 202 HIS CG CD2 doub Y N 203 HIS ND1 CE1 doub Y N 204 HIS ND1 HD1 sing N N 205 HIS CD2 NE2 sing Y N 206 HIS CD2 HD2 sing N N 207 HIS CE1 NE2 sing Y N 208 HIS CE1 HE1 sing N N 209 HIS NE2 HE2 sing N N 210 HIS OXT HXT sing N N 211 HOH O H1 sing N N 212 HOH O H2 sing N N 213 ILE N CA sing N N 214 ILE N H sing N N 215 ILE N H2 sing N N 216 ILE CA C sing N N 217 ILE CA CB sing N N 218 ILE CA HA sing N N 219 ILE C O doub N N 220 ILE C OXT sing N N 221 ILE CB CG1 sing N N 222 ILE CB CG2 sing N N 223 ILE CB HB sing N N 224 ILE CG1 CD1 sing N N 225 ILE CG1 HG12 sing N N 226 ILE CG1 HG13 sing N N 227 ILE CG2 HG21 sing N N 228 ILE CG2 HG22 sing N N 229 ILE CG2 HG23 sing N N 230 ILE CD1 HD11 sing N N 231 ILE CD1 HD12 sing N N 232 ILE CD1 HD13 sing N N 233 ILE OXT HXT sing N N 234 LEU N CA sing N N 235 LEU N H sing N N 236 LEU N H2 sing N N 237 LEU CA C sing N N 238 LEU CA CB sing N N 239 LEU CA HA sing N N 240 LEU C O doub N N 241 LEU C OXT sing N N 242 LEU CB CG sing N N 243 LEU CB HB2 sing N N 244 LEU CB HB3 sing N N 245 LEU CG CD1 sing N N 246 LEU CG CD2 sing N N 247 LEU CG HG sing N N 248 LEU CD1 HD11 sing N N 249 LEU CD1 HD12 sing N N 250 LEU CD1 HD13 sing N N 251 LEU CD2 HD21 sing N N 252 LEU CD2 HD22 sing N N 253 LEU CD2 HD23 sing N N 254 LEU OXT HXT sing N N 255 LYS N CA sing N N 256 LYS N H sing N N 257 LYS N H2 sing N N 258 LYS CA C sing N N 259 LYS CA CB sing N N 260 LYS CA HA sing N N 261 LYS C O doub N N 262 LYS C OXT sing N N 263 LYS CB CG sing N N 264 LYS CB HB2 sing N N 265 LYS CB HB3 sing N N 266 LYS CG CD sing N N 267 LYS CG HG2 sing N N 268 LYS CG HG3 sing N N 269 LYS CD CE sing N N 270 LYS CD HD2 sing N N 271 LYS CD HD3 sing N N 272 LYS CE NZ sing N N 273 LYS CE HE2 sing N N 274 LYS CE HE3 sing N N 275 LYS NZ HZ1 sing N N 276 LYS NZ HZ2 sing N N 277 LYS NZ HZ3 sing N N 278 LYS OXT HXT sing N N 279 MET N CA sing N N 280 MET N H sing N N 281 MET N H2 sing N N 282 MET CA C sing N N 283 MET CA CB sing N N 284 MET CA HA sing N N 285 MET C O doub N N 286 MET C OXT sing N N 287 MET CB CG sing N N 288 MET CB HB2 sing N N 289 MET CB HB3 sing N N 290 MET CG SD sing N N 291 MET CG HG2 sing N N 292 MET CG HG3 sing N N 293 MET SD CE sing N N 294 MET CE HE1 sing N N 295 MET CE HE2 sing N N 296 MET CE HE3 sing N N 297 MET OXT HXT sing N N 298 PG4 O1 C1 sing N N 299 PG4 O1 HO1 sing N N 300 PG4 C1 C2 sing N N 301 PG4 C1 H11 sing N N 302 PG4 C1 H12 sing N N 303 PG4 C2 O2 sing N N 304 PG4 C2 H21 sing N N 305 PG4 C2 H22 sing N N 306 PG4 O2 C3 sing N N 307 PG4 C3 C4 sing N N 308 PG4 C3 H31 sing N N 309 PG4 C3 H32 sing N N 310 PG4 C4 O3 sing N N 311 PG4 C4 H41 sing N N 312 PG4 C4 H42 sing N N 313 PG4 O3 C5 sing N N 314 PG4 C5 C6 sing N N 315 PG4 C5 H51 sing N N 316 PG4 C5 H52 sing N N 317 PG4 C6 O4 sing N N 318 PG4 C6 H61 sing N N 319 PG4 C6 H62 sing N N 320 PG4 O4 C7 sing N N 321 PG4 C7 C8 sing N N 322 PG4 C7 H71 sing N N 323 PG4 C7 H72 sing N N 324 PG4 C8 O5 sing N N 325 PG4 C8 H81 sing N N 326 PG4 C8 H82 sing N N 327 PG4 O5 HO5 sing N N 328 PHE N CA sing N N 329 PHE N H sing N N 330 PHE N H2 sing N N 331 PHE CA C sing N N 332 PHE CA CB sing N N 333 PHE CA HA sing N N 334 PHE C O doub N N 335 PHE C OXT sing N N 336 PHE CB CG sing N N 337 PHE CB HB2 sing N N 338 PHE CB HB3 sing N N 339 PHE CG CD1 doub Y N 340 PHE CG CD2 sing Y N 341 PHE CD1 CE1 sing Y N 342 PHE CD1 HD1 sing N N 343 PHE CD2 CE2 doub Y N 344 PHE CD2 HD2 sing N N 345 PHE CE1 CZ doub Y N 346 PHE CE1 HE1 sing N N 347 PHE CE2 CZ sing Y N 348 PHE CE2 HE2 sing N N 349 PHE CZ HZ sing N N 350 PHE OXT HXT sing N N 351 PRO N CA sing N N 352 PRO N CD sing N N 353 PRO N H sing N N 354 PRO CA C sing N N 355 PRO CA CB sing N N 356 PRO CA HA sing N N 357 PRO C O doub N N 358 PRO C OXT sing N N 359 PRO CB CG sing N N 360 PRO CB HB2 sing N N 361 PRO CB HB3 sing N N 362 PRO CG CD sing N N 363 PRO CG HG2 sing N N 364 PRO CG HG3 sing N N 365 PRO CD HD2 sing N N 366 PRO CD HD3 sing N N 367 PRO OXT HXT sing N N 368 QY1 C18 C20 sing N N 369 QY1 C18 C17 sing N N 370 QY1 C8 C5 doub Y N 371 QY1 C8 C14 sing Y N 372 QY1 C20 C21 sing N N 373 QY1 C5 C12 sing Y N 374 QY1 O27 C14 sing N N 375 QY1 O27 C22 sing N N 376 QY1 C10 C4 doub Y N 377 QY1 C10 C15 sing Y N 378 QY1 C4 C11 sing Y N 379 QY1 C14 C9 doub Y N 380 QY1 C17 C19 sing N N 381 QY1 C12 C23 sing N N 382 QY1 C12 C6 doub Y N 383 QY1 C21 C23 sing N N 384 QY1 C21 C19 sing N N 385 QY1 C22 C15 sing N N 386 QY1 C15 N24 doub Y N 387 QY1 C23 C16 sing N N 388 QY1 C11 C3 doub Y N 389 QY1 C11 C13 sing Y N 390 QY1 C9 C6 sing Y N 391 QY1 C3 C1 sing Y N 392 QY1 N24 C13 sing Y N 393 QY1 C13 C7 doub Y N 394 QY1 C16 O25 doub N N 395 QY1 C16 O26 sing N N 396 QY1 C1 C2 doub Y N 397 QY1 C7 C2 sing Y N 398 QY1 C7 H1 sing N N 399 QY1 C6 H2 sing N N 400 QY1 C1 H3 sing N N 401 QY1 C5 H4 sing N N 402 QY1 C4 H5 sing N N 403 QY1 C3 H6 sing N N 404 QY1 C2 H7 sing N N 405 QY1 C8 H8 sing N N 406 QY1 C9 H9 sing N N 407 QY1 C10 H10 sing N N 408 QY1 C17 H11 sing N N 409 QY1 C17 H12 sing N N 410 QY1 C18 H13 sing N N 411 QY1 C18 H14 sing N N 412 QY1 C19 H15 sing N N 413 QY1 C19 H16 sing N N 414 QY1 C20 H17 sing N N 415 QY1 C20 H18 sing N N 416 QY1 C21 H19 sing N N 417 QY1 C22 H20 sing N N 418 QY1 C22 H21 sing N N 419 QY1 C23 H22 sing N N 420 QY1 O26 H23 sing N N 421 SER N CA sing N N 422 SER N H sing N N 423 SER N H2 sing N N 424 SER CA C sing N N 425 SER CA CB sing N N 426 SER CA HA sing N N 427 SER C O doub N N 428 SER C OXT sing N N 429 SER CB OG sing N N 430 SER CB HB2 sing N N 431 SER CB HB3 sing N N 432 SER OG HG sing N N 433 SER OXT HXT sing N N 434 THR N CA sing N N 435 THR N H sing N N 436 THR N H2 sing N N 437 THR CA C sing N N 438 THR CA CB sing N N 439 THR CA HA sing N N 440 THR C O doub N N 441 THR C OXT sing N N 442 THR CB OG1 sing N N 443 THR CB CG2 sing N N 444 THR CB HB sing N N 445 THR OG1 HG1 sing N N 446 THR CG2 HG21 sing N N 447 THR CG2 HG22 sing N N 448 THR CG2 HG23 sing N N 449 THR OXT HXT sing N N 450 TRP N CA sing N N 451 TRP N H sing N N 452 TRP N H2 sing N N 453 TRP CA C sing N N 454 TRP CA CB sing N N 455 TRP CA HA sing N N 456 TRP C O doub N N 457 TRP C OXT sing N N 458 TRP CB CG sing N N 459 TRP CB HB2 sing N N 460 TRP CB HB3 sing N N 461 TRP CG CD1 doub Y N 462 TRP CG CD2 sing Y N 463 TRP CD1 NE1 sing Y N 464 TRP CD1 HD1 sing N N 465 TRP CD2 CE2 doub Y N 466 TRP CD2 CE3 sing Y N 467 TRP NE1 CE2 sing Y N 468 TRP NE1 HE1 sing N N 469 TRP CE2 CZ2 sing Y N 470 TRP CE3 CZ3 doub Y N 471 TRP CE3 HE3 sing N N 472 TRP CZ2 CH2 doub Y N 473 TRP CZ2 HZ2 sing N N 474 TRP CZ3 CH2 sing Y N 475 TRP CZ3 HZ3 sing N N 476 TRP CH2 HH2 sing N N 477 TRP OXT HXT sing N N 478 TYR N CA sing N N 479 TYR N H sing N N 480 TYR N H2 sing N N 481 TYR CA C sing N N 482 TYR CA CB sing N N 483 TYR CA HA sing N N 484 TYR C O doub N N 485 TYR C OXT sing N N 486 TYR CB CG sing N N 487 TYR CB HB2 sing N N 488 TYR CB HB3 sing N N 489 TYR CG CD1 doub Y N 490 TYR CG CD2 sing Y N 491 TYR CD1 CE1 sing Y N 492 TYR CD1 HD1 sing N N 493 TYR CD2 CE2 doub Y N 494 TYR CD2 HD2 sing N N 495 TYR CE1 CZ doub Y N 496 TYR CE1 HE1 sing N N 497 TYR CE2 CZ sing Y N 498 TYR CE2 HE2 sing N N 499 TYR CZ OH sing N N 500 TYR OH HH sing N N 501 TYR OXT HXT sing N N 502 VAL N CA sing N N 503 VAL N H sing N N 504 VAL N H2 sing N N 505 VAL CA C sing N N 506 VAL CA CB sing N N 507 VAL CA HA sing N N 508 VAL C O doub N N 509 VAL C OXT sing N N 510 VAL CB CG1 sing N N 511 VAL CB CG2 sing N N 512 VAL CB HB sing N N 513 VAL CG1 HG11 sing N N 514 VAL CG1 HG12 sing N N 515 VAL CG1 HG13 sing N N 516 VAL CG2 HG21 sing N N 517 VAL CG2 HG22 sing N N 518 VAL CG2 HG23 sing N N 519 VAL OXT HXT sing N N 520 # _pdbx_initial_refinement_model.accession_code 2Q7M _pdbx_initial_refinement_model.details ? _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.type 'experimental model' # loop_ _pdbx_reflns_twin.domain_id _pdbx_reflns_twin.crystal_id _pdbx_reflns_twin.diffrn_id _pdbx_reflns_twin.fraction _pdbx_reflns_twin.operator _pdbx_reflns_twin.type _pdbx_reflns_twin.mean_F_square_over_mean_F2 _pdbx_reflns_twin.mean_I2_over_mean_I_square 1 1 1 0.439 'H, K, L' ? ? ? 2 1 1 0.561 'K, H, -L' ? ? ? # _atom_sites.entry_id 6VL4 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.013086 _atom_sites.fract_transf_matrix[1][2] 0.007555 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015111 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008079 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_