data_6VWU # _entry.id 6VWU # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6VWU pdb_00006vwu 10.2210/pdb6vwu/pdb WWPDB D_1000247227 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6VWU _pdbx_database_status.recvd_initial_deposition_date 2020-02-20 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _audit_author.name 'Losey, H.C.' _audit_author.pdbx_ordinal 1 _audit_author.identifier_ORCID 0000-0001-6363-1166 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'J Immunother Cancer' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2051-1426 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 8 _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'ALKS 4230: a novel engineered IL-2 fusion protein with an improved cellular selectivity profile for cancer immunotherapy.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1136/jitc-2020-000673 _citation.pdbx_database_id_PubMed 32317293 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Lopes, J.E.' 1 ? primary 'Fisher, J.L.' 2 ? primary 'Flick, H.L.' 3 ? primary 'Wang, C.' 4 ? primary 'Sun, L.' 5 ? primary 'Ernstoff, M.S.' 6 ? primary 'Alvarez, J.C.' 7 ? primary 'Losey, H.C.' 8 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 6VWU _cell.details ? _cell.formula_units_Z ? _cell.length_a 86.809 _cell.length_a_esd ? _cell.length_b 86.809 _cell.length_b_esd ? _cell.length_c 119.576 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6VWU _symmetry.cell_setting ? _symmetry.Int_Tables_number 154 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 32 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Interleukin-2,Interleukin-2 receptor subunit alpha' _entity.formula_weight 34464.320 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'IL-2,IL-2,T-cell growth factor,TCGF,IL2-RA,TAC antigen,p55' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SKNFHLRPRDLISNINVIVLELKGSETTFMCEYADETATIVEFLNRWITFSQSIISTLTGGSSSTKKTQLQLEHLLLDLQ MILNGINNYKNPKLTRMLTFKFYMPKKATELKHLQCLEEELKPLEEVLNLAQGSGGGSELCDDDPPEIPHATFKAMAYKE GTMLNCECKRGFRRIKSGSLYMLCTGNSSHSSWDNQCQCTSSATRNTTKQVTPQPEEQKERKTTEMQSPMQPVDQASLPG HCREPPPWENEATERIYHFVVGQMVYYQCVQGYRALHRGPAESVCKMTHGKTRWTQPQLICTG ; _entity_poly.pdbx_seq_one_letter_code_can ;SKNFHLRPRDLISNINVIVLELKGSETTFMCEYADETATIVEFLNRWITFSQSIISTLTGGSSSTKKTQLQLEHLLLDLQ MILNGINNYKNPKLTRMLTFKFYMPKKATELKHLQCLEEELKPLEEVLNLAQGSGGGSELCDDDPPEIPHATFKAMAYKE GTMLNCECKRGFRRIKSGSLYMLCTGNSSHSSWDNQCQCTSSATRNTTKQVTPQPEEQKERKTTEMQSPMQPVDQASLPG HCREPPPWENEATERIYHFVVGQMVYYQCVQGYRALHRGPAESVCKMTHGKTRWTQPQLICTG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 LYS n 1 3 ASN n 1 4 PHE n 1 5 HIS n 1 6 LEU n 1 7 ARG n 1 8 PRO n 1 9 ARG n 1 10 ASP n 1 11 LEU n 1 12 ILE n 1 13 SER n 1 14 ASN n 1 15 ILE n 1 16 ASN n 1 17 VAL n 1 18 ILE n 1 19 VAL n 1 20 LEU n 1 21 GLU n 1 22 LEU n 1 23 LYS n 1 24 GLY n 1 25 SER n 1 26 GLU n 1 27 THR n 1 28 THR n 1 29 PHE n 1 30 MET n 1 31 CYS n 1 32 GLU n 1 33 TYR n 1 34 ALA n 1 35 ASP n 1 36 GLU n 1 37 THR n 1 38 ALA n 1 39 THR n 1 40 ILE n 1 41 VAL n 1 42 GLU n 1 43 PHE n 1 44 LEU n 1 45 ASN n 1 46 ARG n 1 47 TRP n 1 48 ILE n 1 49 THR n 1 50 PHE n 1 51 SER n 1 52 GLN n 1 53 SER n 1 54 ILE n 1 55 ILE n 1 56 SER n 1 57 THR n 1 58 LEU n 1 59 THR n 1 60 GLY n 1 61 GLY n 1 62 SER n 1 63 SER n 1 64 SER n 1 65 THR n 1 66 LYS n 1 67 LYS n 1 68 THR n 1 69 GLN n 1 70 LEU n 1 71 GLN n 1 72 LEU n 1 73 GLU n 1 74 HIS n 1 75 LEU n 1 76 LEU n 1 77 LEU n 1 78 ASP n 1 79 LEU n 1 80 GLN n 1 81 MET n 1 82 ILE n 1 83 LEU n 1 84 ASN n 1 85 GLY n 1 86 ILE n 1 87 ASN n 1 88 ASN n 1 89 TYR n 1 90 LYS n 1 91 ASN n 1 92 PRO n 1 93 LYS n 1 94 LEU n 1 95 THR n 1 96 ARG n 1 97 MET n 1 98 LEU n 1 99 THR n 1 100 PHE n 1 101 LYS n 1 102 PHE n 1 103 TYR n 1 104 MET n 1 105 PRO n 1 106 LYS n 1 107 LYS n 1 108 ALA n 1 109 THR n 1 110 GLU n 1 111 LEU n 1 112 LYS n 1 113 HIS n 1 114 LEU n 1 115 GLN n 1 116 CYS n 1 117 LEU n 1 118 GLU n 1 119 GLU n 1 120 GLU n 1 121 LEU n 1 122 LYS n 1 123 PRO n 1 124 LEU n 1 125 GLU n 1 126 GLU n 1 127 VAL n 1 128 LEU n 1 129 ASN n 1 130 LEU n 1 131 ALA n 1 132 GLN n 1 133 GLY n 1 134 SER n 1 135 GLY n 1 136 GLY n 1 137 GLY n 1 138 SER n 1 139 GLU n 1 140 LEU n 1 141 CYS n 1 142 ASP n 1 143 ASP n 1 144 ASP n 1 145 PRO n 1 146 PRO n 1 147 GLU n 1 148 ILE n 1 149 PRO n 1 150 HIS n 1 151 ALA n 1 152 THR n 1 153 PHE n 1 154 LYS n 1 155 ALA n 1 156 MET n 1 157 ALA n 1 158 TYR n 1 159 LYS n 1 160 GLU n 1 161 GLY n 1 162 THR n 1 163 MET n 1 164 LEU n 1 165 ASN n 1 166 CYS n 1 167 GLU n 1 168 CYS n 1 169 LYS n 1 170 ARG n 1 171 GLY n 1 172 PHE n 1 173 ARG n 1 174 ARG n 1 175 ILE n 1 176 LYS n 1 177 SER n 1 178 GLY n 1 179 SER n 1 180 LEU n 1 181 TYR n 1 182 MET n 1 183 LEU n 1 184 CYS n 1 185 THR n 1 186 GLY n 1 187 ASN n 1 188 SER n 1 189 SER n 1 190 HIS n 1 191 SER n 1 192 SER n 1 193 TRP n 1 194 ASP n 1 195 ASN n 1 196 GLN n 1 197 CYS n 1 198 GLN n 1 199 CYS n 1 200 THR n 1 201 SER n 1 202 SER n 1 203 ALA n 1 204 THR n 1 205 ARG n 1 206 ASN n 1 207 THR n 1 208 THR n 1 209 LYS n 1 210 GLN n 1 211 VAL n 1 212 THR n 1 213 PRO n 1 214 GLN n 1 215 PRO n 1 216 GLU n 1 217 GLU n 1 218 GLN n 1 219 LYS n 1 220 GLU n 1 221 ARG n 1 222 LYS n 1 223 THR n 1 224 THR n 1 225 GLU n 1 226 MET n 1 227 GLN n 1 228 SER n 1 229 PRO n 1 230 MET n 1 231 GLN n 1 232 PRO n 1 233 VAL n 1 234 ASP n 1 235 GLN n 1 236 ALA n 1 237 SER n 1 238 LEU n 1 239 PRO n 1 240 GLY n 1 241 HIS n 1 242 CYS n 1 243 ARG n 1 244 GLU n 1 245 PRO n 1 246 PRO n 1 247 PRO n 1 248 TRP n 1 249 GLU n 1 250 ASN n 1 251 GLU n 1 252 ALA n 1 253 THR n 1 254 GLU n 1 255 ARG n 1 256 ILE n 1 257 TYR n 1 258 HIS n 1 259 PHE n 1 260 VAL n 1 261 VAL n 1 262 GLY n 1 263 GLN n 1 264 MET n 1 265 VAL n 1 266 TYR n 1 267 TYR n 1 268 GLN n 1 269 CYS n 1 270 VAL n 1 271 GLN n 1 272 GLY n 1 273 TYR n 1 274 ARG n 1 275 ALA n 1 276 LEU n 1 277 HIS n 1 278 ARG n 1 279 GLY n 1 280 PRO n 1 281 ALA n 1 282 GLU n 1 283 SER n 1 284 VAL n 1 285 CYS n 1 286 LYS n 1 287 MET n 1 288 THR n 1 289 HIS n 1 290 GLY n 1 291 LYS n 1 292 THR n 1 293 ARG n 1 294 TRP n 1 295 THR n 1 296 GLN n 1 297 PRO n 1 298 GLN n 1 299 LEU n 1 300 ILE n 1 301 CYS n 1 302 THR n 1 303 GLY n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 61 Human ? IL2 ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? 'Chinese hamster' 'Cricetulus griseus' 10029 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 1 2 sample 'Biological sequence' 62 138 Human ? IL2 ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? 'Chinese hamster' 'Cricetulus griseus' 10029 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 1 3 sample 'Biological sequence' 139 303 Human ? IL2RA ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? 'Chinese hamster' 'Cricetulus griseus' 10029 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP Q6QWN0_HUMAN Q6QWN0 ? 1 SKNFHLRPRDLISNINVIVLELKGSETTFMCEYADETATIVEFLNRWITFSQSIISTLT 75 2 UNP IL2_HUMAN P60568 ? 1 SSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRMLTFKFYMPKKATELKHLQCLEEELKPLEEVLNLAQ 24 3 UNP IL2RA_HUMAN P01589 ? 1 ;ELCDDDPPEIPHATFKAMAYKEGTMLNCECKRGFRRIKSGSLYMLCTGNSSHSSWDNQCQCTSSATRNTTKQVTPQPEEQ KERKTTEMQSPMQPVDQASLPGHCREPPPWENEATERIYHFVVGQMVYYQCVQGYRALHRGPAESVCKMTHGKTRWTQPQ LICTG ; 22 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 6VWU A 1 ? 59 ? Q6QWN0 75 ? 133 ? 1 59 2 2 6VWU A 62 ? 132 ? P60568 24 ? 94 ? 62 132 3 3 6VWU A 139 ? 303 ? P01589 22 ? 186 ? 139 303 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6VWU GLY A 60 ? UNP Q6QWN0 ? ? linker 60 1 1 6VWU GLY A 61 ? UNP Q6QWN0 ? ? linker 61 2 2 6VWU GLY A 133 ? UNP P60568 ? ? linker 133 3 2 6VWU SER A 134 ? UNP P60568 ? ? linker 134 4 2 6VWU GLY A 135 ? UNP P60568 ? ? linker 135 5 2 6VWU GLY A 136 ? UNP P60568 ? ? linker 136 6 2 6VWU GLY A 137 ? UNP P60568 ? ? linker 137 7 2 6VWU SER A 138 ? UNP P60568 ? ? linker 138 8 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6VWU _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.77 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 67.41 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details 'room temperature' _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;An equal volume of protein was mixed with crystallization buffer, 25 % (w/v) PEG 3350, 0.2 M MgCl2, 0.1 M Hepes 7.5. Large crystals appeared within 48-72 hours, and were frozen in a cryoprotectant consisting of mother liquor with 10 % glycerol ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CMOS _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'RDI CMOS_8M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2015-08-12 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ALS BEAMLINE 4.2.2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 4.2.2 _diffrn_source.pdbx_synchrotron_site ALS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6VWU _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 3.4 _reflns.d_resolution_low 63.645 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 7538 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 10.9 _reflns.pdbx_Rmerge_I_obs 0.185 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 12.8 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 3.4 _reflns_shell.d_res_low 3.522 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 750 _reflns_shell.percent_possible_all 100 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.185 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 306.760 _refine.B_iso_mean 171.9539 _refine.B_iso_min 79.590 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6VWU _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3.4000 _refine.ls_d_res_low 63.6450 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 7517 _refine.ls_number_reflns_R_free 421 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.6600 _refine.ls_percent_reflns_R_free 5.6000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2768 _refine.ls_R_factor_R_free 0.2973 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2754 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.340 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1Z92 _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 46.9300 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.7400 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 3.4000 _refine_hist.d_res_low 63.6450 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 2057 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 258 _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 2057 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.002 ? 2106 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.654 ? 2846 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.030 ? 313 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.003 ? 361 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 15.152 ? 805 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 3.4003 3.8923 . . 141 2311 100.0000 . . . 0.4490 0.0000 0.4054 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.8923 4.9036 . . 144 2330 100.0000 . . . 0.3076 0.0000 0.2688 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.9036 63.645 . . 136 2455 100.0000 . . . 0.2772 0.0000 0.2314 . . . . . . . . . . . # _struct.entry_id 6VWU _struct.title 'X-ray structure of ALKS 4230, a fusion of circularly permuted human Interleukin-2 and Interleukin-2 Receptor alpha' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6VWU _struct_keywords.text 'circular permutation, ALKS 4230, CYTOKINE' _struct_keywords.pdbx_keywords CYTOKINE # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ARG A 7 ? GLY A 24 ? ARG A 7 GLY A 24 1 ? 18 HELX_P HELX_P2 AA2 THR A 39 ? THR A 57 ? THR A 39 THR A 57 1 ? 19 HELX_P HELX_P3 AA3 SER A 62 ? GLY A 85 ? SER A 62 GLY A 85 1 ? 24 HELX_P HELX_P4 AA4 LYS A 90 ? LEU A 98 ? LYS A 90 LEU A 98 1 ? 9 HELX_P HELX_P5 AA5 GLU A 110 ? LYS A 112 ? GLU A 110 LYS A 112 5 ? 3 HELX_P HELX_P6 AA6 HIS A 113 ? GLU A 120 ? HIS A 113 GLU A 120 1 ? 8 HELX_P HELX_P7 AA7 GLU A 120 ? ALA A 131 ? GLU A 120 ALA A 131 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 31 SG ? ? ? 1_555 A CYS 116 SG ? ? A CYS 31 A CYS 116 1_555 ? ? ? ? ? ? ? 2.030 ? ? disulf2 disulf ? ? A CYS 141 SG ? ? ? 1_555 A CYS 285 SG ? ? A CYS 141 A CYS 285 1_555 ? ? ? ? ? ? ? 2.031 ? ? disulf3 disulf ? ? A CYS 166 SG ? ? ? 1_555 A CYS 197 SG ? ? A CYS 166 A CYS 197 1_555 ? ? ? ? ? ? ? 2.030 ? ? disulf4 disulf ? ? A CYS 168 SG ? ? ? 1_555 A CYS 199 SG ? ? A CYS 168 A CYS 199 1_555 ? ? ? ? ? ? ? 2.031 ? ? disulf5 disulf ? ? A CYS 184 SG ? ? ? 1_555 A CYS 242 SG ? ? A CYS 184 A CYS 242 1_555 ? ? ? ? ? ? ? 2.029 ? ? disulf6 disulf ? ? A CYS 269 SG ? ? ? 1_555 A CYS 301 SG ? ? A CYS 269 A CYS 301 1_555 ? ? ? ? ? ? ? 2.030 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 4 ? AA3 ? 2 ? AA4 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA3 1 2 ? anti-parallel AA4 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ALA A 151 ? ALA A 155 ? ALA A 151 ALA A 155 AA1 2 MET A 264 ? CYS A 269 ? MET A 264 CYS A 269 AA1 3 GLU A 282 ? MET A 287 ? GLU A 282 MET A 287 AA1 4 THR A 292 ? TRP A 294 ? THR A 292 TRP A 294 AA2 1 SER A 192 ? TRP A 193 ? SER A 192 TRP A 193 AA2 2 TYR A 181 ? THR A 185 ? TYR A 181 THR A 185 AA2 3 MET A 163 ? ASN A 165 ? MET A 163 ASN A 165 AA2 4 TYR A 257 ? HIS A 258 ? TYR A 257 HIS A 258 AA3 1 PHE A 172 ? ARG A 174 ? PHE A 172 ARG A 174 AA3 2 CYS A 199 ? SER A 201 ? CYS A 199 SER A 201 AA4 1 ARG A 274 ? ALA A 275 ? ARG A 274 ALA A 275 AA4 2 CYS A 301 ? THR A 302 ? CYS A 301 THR A 302 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N THR A 152 ? N THR A 152 O GLN A 268 ? O GLN A 268 AA1 2 3 N VAL A 265 ? N VAL A 265 O SER A 283 ? O SER A 283 AA1 3 4 N LYS A 286 ? N LYS A 286 O ARG A 293 ? O ARG A 293 AA2 1 2 O SER A 192 ? O SER A 192 N THR A 185 ? N THR A 185 AA2 2 3 O MET A 182 ? O MET A 182 N LEU A 164 ? N LEU A 164 AA2 3 4 N MET A 163 ? N MET A 163 O HIS A 258 ? O HIS A 258 AA3 1 2 N ARG A 173 ? N ARG A 173 O THR A 200 ? O THR A 200 AA4 1 2 N ARG A 274 ? N ARG A 274 O THR A 302 ? O THR A 302 # _atom_sites.entry_id 6VWU _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.011520 _atom_sites.fract_transf_matrix[1][2] 0.006651 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013302 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008363 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1 ? ? ? A . n A 1 2 LYS 2 2 ? ? ? A . n A 1 3 ASN 3 3 3 ASN ASN A . n A 1 4 PHE 4 4 4 PHE PHE A . n A 1 5 HIS 5 5 5 HIS HIS A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 ARG 7 7 7 ARG ARG A . n A 1 8 PRO 8 8 8 PRO PRO A . n A 1 9 ARG 9 9 9 ARG ARG A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 ASN 14 14 14 ASN ASN A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 ASN 16 16 16 ASN ASN A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 SER 25 25 ? ? ? A . n A 1 26 GLU 26 26 ? ? ? A . n A 1 27 THR 27 27 ? ? ? A . n A 1 28 THR 28 28 28 THR THR A . n A 1 29 PHE 29 29 29 PHE PHE A . n A 1 30 MET 30 30 30 MET MET A . n A 1 31 CYS 31 31 31 CYS CYS A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 TYR 33 33 33 TYR TYR A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 ASP 35 35 35 ASP ASP A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 THR 37 37 37 THR THR A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 THR 39 39 39 THR THR A . n A 1 40 ILE 40 40 40 ILE ILE A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 PHE 43 43 43 PHE PHE A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 ASN 45 45 45 ASN ASN A . n A 1 46 ARG 46 46 46 ARG ARG A . n A 1 47 TRP 47 47 47 TRP TRP A . n A 1 48 ILE 48 48 48 ILE ILE A . n A 1 49 THR 49 49 49 THR THR A . n A 1 50 PHE 50 50 50 PHE PHE A . n A 1 51 SER 51 51 51 SER SER A . n A 1 52 GLN 52 52 52 GLN GLN A . n A 1 53 SER 53 53 53 SER SER A . n A 1 54 ILE 54 54 54 ILE ILE A . n A 1 55 ILE 55 55 55 ILE ILE A . n A 1 56 SER 56 56 56 SER SER A . n A 1 57 THR 57 57 57 THR THR A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 THR 59 59 59 THR THR A . n A 1 60 GLY 60 60 60 GLY GLY A . n A 1 61 GLY 61 61 61 GLY GLY A . n A 1 62 SER 62 62 62 SER SER A . n A 1 63 SER 63 63 63 SER SER A . n A 1 64 SER 64 64 64 SER SER A . n A 1 65 THR 65 65 65 THR THR A . n A 1 66 LYS 66 66 66 LYS LYS A . n A 1 67 LYS 67 67 67 LYS LYS A . n A 1 68 THR 68 68 68 THR THR A . n A 1 69 GLN 69 69 69 GLN GLN A . n A 1 70 LEU 70 70 70 LEU LEU A . n A 1 71 GLN 71 71 71 GLN GLN A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 GLU 73 73 73 GLU GLU A . n A 1 74 HIS 74 74 74 HIS HIS A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 ASP 78 78 78 ASP ASP A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 GLN 80 80 80 GLN GLN A . n A 1 81 MET 81 81 81 MET MET A . n A 1 82 ILE 82 82 82 ILE ILE A . n A 1 83 LEU 83 83 83 LEU LEU A . n A 1 84 ASN 84 84 84 ASN ASN A . n A 1 85 GLY 85 85 85 GLY GLY A . n A 1 86 ILE 86 86 86 ILE ILE A . n A 1 87 ASN 87 87 87 ASN ASN A . n A 1 88 ASN 88 88 88 ASN ASN A . n A 1 89 TYR 89 89 89 TYR TYR A . n A 1 90 LYS 90 90 90 LYS LYS A . n A 1 91 ASN 91 91 91 ASN ASN A . n A 1 92 PRO 92 92 92 PRO PRO A . n A 1 93 LYS 93 93 93 LYS LYS A . n A 1 94 LEU 94 94 94 LEU LEU A . n A 1 95 THR 95 95 95 THR THR A . n A 1 96 ARG 96 96 96 ARG ARG A . n A 1 97 MET 97 97 97 MET MET A . n A 1 98 LEU 98 98 98 LEU LEU A . n A 1 99 THR 99 99 99 THR THR A . n A 1 100 PHE 100 100 100 PHE PHE A . n A 1 101 LYS 101 101 101 LYS LYS A . n A 1 102 PHE 102 102 102 PHE PHE A . n A 1 103 TYR 103 103 103 TYR TYR A . n A 1 104 MET 104 104 104 MET MET A . n A 1 105 PRO 105 105 105 PRO PRO A . n A 1 106 LYS 106 106 106 LYS LYS A . n A 1 107 LYS 107 107 107 LYS LYS A . n A 1 108 ALA 108 108 108 ALA ALA A . n A 1 109 THR 109 109 109 THR THR A . n A 1 110 GLU 110 110 110 GLU GLU A . n A 1 111 LEU 111 111 111 LEU LEU A . n A 1 112 LYS 112 112 112 LYS LYS A . n A 1 113 HIS 113 113 113 HIS HIS A . n A 1 114 LEU 114 114 114 LEU LEU A . n A 1 115 GLN 115 115 115 GLN GLN A . n A 1 116 CYS 116 116 116 CYS CYS A . n A 1 117 LEU 117 117 117 LEU LEU A . n A 1 118 GLU 118 118 118 GLU GLU A . n A 1 119 GLU 119 119 119 GLU GLU A . n A 1 120 GLU 120 120 120 GLU GLU A . n A 1 121 LEU 121 121 121 LEU LEU A . n A 1 122 LYS 122 122 122 LYS LYS A . n A 1 123 PRO 123 123 123 PRO PRO A . n A 1 124 LEU 124 124 124 LEU LEU A . n A 1 125 GLU 125 125 125 GLU GLU A . n A 1 126 GLU 126 126 126 GLU GLU A . n A 1 127 VAL 127 127 127 VAL VAL A . n A 1 128 LEU 128 128 128 LEU LEU A . n A 1 129 ASN 129 129 129 ASN ASN A . n A 1 130 LEU 130 130 130 LEU LEU A . n A 1 131 ALA 131 131 131 ALA ALA A . n A 1 132 GLN 132 132 132 GLN GLN A . n A 1 133 GLY 133 133 133 GLY GLY A . n A 1 134 SER 134 134 134 SER SER A . n A 1 135 GLY 135 135 ? ? ? A . n A 1 136 GLY 136 136 ? ? ? A . n A 1 137 GLY 137 137 137 GLY GLY A . n A 1 138 SER 138 138 138 SER SER A . n A 1 139 GLU 139 139 139 GLU GLU A . n A 1 140 LEU 140 140 140 LEU LEU A . n A 1 141 CYS 141 141 141 CYS CYS A . n A 1 142 ASP 142 142 142 ASP ASP A . n A 1 143 ASP 143 143 143 ASP ASP A . n A 1 144 ASP 144 144 144 ASP ASP A . n A 1 145 PRO 145 145 145 PRO PRO A . n A 1 146 PRO 146 146 146 PRO PRO A . n A 1 147 GLU 147 147 147 GLU GLU A . n A 1 148 ILE 148 148 148 ILE ILE A . n A 1 149 PRO 149 149 149 PRO PRO A . n A 1 150 HIS 150 150 150 HIS HIS A . n A 1 151 ALA 151 151 151 ALA ALA A . n A 1 152 THR 152 152 152 THR THR A . n A 1 153 PHE 153 153 153 PHE PHE A . n A 1 154 LYS 154 154 154 LYS LYS A . n A 1 155 ALA 155 155 155 ALA ALA A . n A 1 156 MET 156 156 156 MET MET A . n A 1 157 ALA 157 157 157 ALA ALA A . n A 1 158 TYR 158 158 158 TYR TYR A . n A 1 159 LYS 159 159 159 LYS LYS A . n A 1 160 GLU 160 160 160 GLU GLU A . n A 1 161 GLY 161 161 161 GLY GLY A . n A 1 162 THR 162 162 162 THR THR A . n A 1 163 MET 163 163 163 MET MET A . n A 1 164 LEU 164 164 164 LEU LEU A . n A 1 165 ASN 165 165 165 ASN ASN A . n A 1 166 CYS 166 166 166 CYS CYS A . n A 1 167 GLU 167 167 167 GLU GLU A . n A 1 168 CYS 168 168 168 CYS CYS A . n A 1 169 LYS 169 169 169 LYS LYS A . n A 1 170 ARG 170 170 170 ARG ARG A . n A 1 171 GLY 171 171 171 GLY GLY A . n A 1 172 PHE 172 172 172 PHE PHE A . n A 1 173 ARG 173 173 173 ARG ARG A . n A 1 174 ARG 174 174 174 ARG ARG A . n A 1 175 ILE 175 175 175 ILE ILE A . n A 1 176 LYS 176 176 176 LYS LYS A . n A 1 177 SER 177 177 177 SER SER A . n A 1 178 GLY 178 178 178 GLY GLY A . n A 1 179 SER 179 179 179 SER SER A . n A 1 180 LEU 180 180 180 LEU LEU A . n A 1 181 TYR 181 181 181 TYR TYR A . n A 1 182 MET 182 182 182 MET MET A . n A 1 183 LEU 183 183 183 LEU LEU A . n A 1 184 CYS 184 184 184 CYS CYS A . n A 1 185 THR 185 185 185 THR THR A . n A 1 186 GLY 186 186 186 GLY GLY A . n A 1 187 ASN 187 187 187 ASN ASN A . n A 1 188 SER 188 188 188 SER SER A . n A 1 189 SER 189 189 189 SER SER A . n A 1 190 HIS 190 190 190 HIS HIS A . n A 1 191 SER 191 191 191 SER SER A . n A 1 192 SER 192 192 192 SER SER A . n A 1 193 TRP 193 193 193 TRP TRP A . n A 1 194 ASP 194 194 194 ASP ASP A . n A 1 195 ASN 195 195 195 ASN ASN A . n A 1 196 GLN 196 196 196 GLN GLN A . n A 1 197 CYS 197 197 197 CYS CYS A . n A 1 198 GLN 198 198 198 GLN GLN A . n A 1 199 CYS 199 199 199 CYS CYS A . n A 1 200 THR 200 200 200 THR THR A . n A 1 201 SER 201 201 201 SER SER A . n A 1 202 SER 202 202 202 SER SER A . n A 1 203 ALA 203 203 ? ? ? A . n A 1 204 THR 204 204 ? ? ? A . n A 1 205 ARG 205 205 ? ? ? A . n A 1 206 ASN 206 206 ? ? ? A . n A 1 207 THR 207 207 ? ? ? A . n A 1 208 THR 208 208 ? ? ? A . n A 1 209 LYS 209 209 ? ? ? A . n A 1 210 GLN 210 210 ? ? ? A . n A 1 211 VAL 211 211 ? ? ? A . n A 1 212 THR 212 212 ? ? ? A . n A 1 213 PRO 213 213 ? ? ? A . n A 1 214 GLN 214 214 ? ? ? A . n A 1 215 PRO 215 215 ? ? ? A . n A 1 216 GLU 216 216 ? ? ? A . n A 1 217 GLU 217 217 ? ? ? A . n A 1 218 GLN 218 218 ? ? ? A . n A 1 219 LYS 219 219 ? ? ? A . n A 1 220 GLU 220 220 ? ? ? A . n A 1 221 ARG 221 221 ? ? ? A . n A 1 222 LYS 222 222 ? ? ? A . n A 1 223 THR 223 223 ? ? ? A . n A 1 224 THR 224 224 ? ? ? A . n A 1 225 GLU 225 225 ? ? ? A . n A 1 226 MET 226 226 ? ? ? A . n A 1 227 GLN 227 227 ? ? ? A . n A 1 228 SER 228 228 ? ? ? A . n A 1 229 PRO 229 229 ? ? ? A . n A 1 230 MET 230 230 ? ? ? A . n A 1 231 GLN 231 231 ? ? ? A . n A 1 232 PRO 232 232 ? ? ? A . n A 1 233 VAL 233 233 ? ? ? A . n A 1 234 ASP 234 234 ? ? ? A . n A 1 235 GLN 235 235 ? ? ? A . n A 1 236 ALA 236 236 ? ? ? A . n A 1 237 SER 237 237 ? ? ? A . n A 1 238 LEU 238 238 ? ? ? A . n A 1 239 PRO 239 239 ? ? ? A . n A 1 240 GLY 240 240 ? ? ? A . n A 1 241 HIS 241 241 241 HIS HIS A . n A 1 242 CYS 242 242 242 CYS CYS A . n A 1 243 ARG 243 243 243 ARG ARG A . n A 1 244 GLU 244 244 244 GLU GLU A . n A 1 245 PRO 245 245 245 PRO PRO A . n A 1 246 PRO 246 246 246 PRO PRO A . n A 1 247 PRO 247 247 247 PRO PRO A . n A 1 248 TRP 248 248 248 TRP TRP A . n A 1 249 GLU 249 249 249 GLU GLU A . n A 1 250 ASN 250 250 250 ASN ASN A . n A 1 251 GLU 251 251 251 GLU GLU A . n A 1 252 ALA 252 252 252 ALA ALA A . n A 1 253 THR 253 253 253 THR THR A . n A 1 254 GLU 254 254 254 GLU GLU A . n A 1 255 ARG 255 255 255 ARG ARG A . n A 1 256 ILE 256 256 256 ILE ILE A . n A 1 257 TYR 257 257 257 TYR TYR A . n A 1 258 HIS 258 258 258 HIS HIS A . n A 1 259 PHE 259 259 259 PHE PHE A . n A 1 260 VAL 260 260 260 VAL VAL A . n A 1 261 VAL 261 261 261 VAL VAL A . n A 1 262 GLY 262 262 262 GLY GLY A . n A 1 263 GLN 263 263 263 GLN GLN A . n A 1 264 MET 264 264 264 MET MET A . n A 1 265 VAL 265 265 265 VAL VAL A . n A 1 266 TYR 266 266 266 TYR TYR A . n A 1 267 TYR 267 267 267 TYR TYR A . n A 1 268 GLN 268 268 268 GLN GLN A . n A 1 269 CYS 269 269 269 CYS CYS A . n A 1 270 VAL 270 270 270 VAL VAL A . n A 1 271 GLN 271 271 271 GLN GLN A . n A 1 272 GLY 272 272 272 GLY GLY A . n A 1 273 TYR 273 273 273 TYR TYR A . n A 1 274 ARG 274 274 274 ARG ARG A . n A 1 275 ALA 275 275 275 ALA ALA A . n A 1 276 LEU 276 276 276 LEU LEU A . n A 1 277 HIS 277 277 277 HIS HIS A . n A 1 278 ARG 278 278 278 ARG ARG A . n A 1 279 GLY 279 279 279 GLY GLY A . n A 1 280 PRO 280 280 280 PRO PRO A . n A 1 281 ALA 281 281 281 ALA ALA A . n A 1 282 GLU 282 282 282 GLU GLU A . n A 1 283 SER 283 283 283 SER SER A . n A 1 284 VAL 284 284 284 VAL VAL A . n A 1 285 CYS 285 285 285 CYS CYS A . n A 1 286 LYS 286 286 286 LYS LYS A . n A 1 287 MET 287 287 287 MET MET A . n A 1 288 THR 288 288 288 THR THR A . n A 1 289 HIS 289 289 289 HIS HIS A . n A 1 290 GLY 290 290 290 GLY GLY A . n A 1 291 LYS 291 291 291 LYS LYS A . n A 1 292 THR 292 292 292 THR THR A . n A 1 293 ARG 293 293 293 ARG ARG A . n A 1 294 TRP 294 294 294 TRP TRP A . n A 1 295 THR 295 295 295 THR THR A . n A 1 296 GLN 296 296 296 GLN GLN A . n A 1 297 PRO 297 297 297 PRO PRO A . n A 1 298 GLN 298 298 298 GLN GLN A . n A 1 299 LEU 299 299 299 LEU LEU A . n A 1 300 ILE 300 300 300 ILE ILE A . n A 1 301 CYS 301 301 301 CYS CYS A . n A 1 302 THR 302 302 302 THR THR A . n A 1 303 GLY 303 303 303 GLY GLY A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 14370 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-04-29 2 'Structure model' 1 1 2020-05-06 3 'Structure model' 1 2 2023-10-11 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' citation 6 3 'Structure model' database_2 7 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_id_ISSN' 2 2 'Structure model' '_citation.journal_volume' 3 2 'Structure model' '_citation.pdbx_database_id_PubMed' 4 2 'Structure model' '_citation.title' 5 2 'Structure model' '_citation_author.identifier_ORCID' 6 2 'Structure model' '_citation_author.name' 7 3 'Structure model' '_citation.country' 8 3 'Structure model' '_database_2.pdbx_DOI' 9 3 'Structure model' '_database_2.pdbx_database_accession' # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined -73.6912 101.3924 31.1216 1.1089 ? -0.2754 ? 0.0246 ? 1.4069 ? 0.0366 ? 1.1580 ? 0.0039 ? -0.0678 ? 0.0101 ? 0.0488 ? -0.0411 ? -0.0043 ? 0.1808 ? -0.1242 ? -0.5137 ? 0.2153 ? -0.1027 ? 0.2779 ? -0.1763 ? -0.1797 ? -0.0000 ? 2 'X-RAY DIFFRACTION' ? refined -63.1702 95.9118 35.4087 0.9298 ? -0.0024 ? 0.1089 ? 0.9396 ? 0.0231 ? 0.9020 ? 0.2983 ? -0.0220 ? 0.2957 ? 0.4100 ? -0.1108 ? 0.2494 ? 0.1465 ? -0.0847 ? 0.1476 ? 0.0112 ? -0.2072 ? 0.0602 ? 0.4863 ? 0.9080 ? 0.0000 ? 3 'X-RAY DIFFRACTION' ? refined -70.9074 91.9037 32.9970 1.2750 ? -0.4368 ? -0.0536 ? 1.3152 ? -0.1836 ? 1.2079 ? 0.0390 ? 0.0394 ? 0.0926 ? -0.0447 ? -0.0074 ? 0.0863 ? 0.2046 ? -0.3101 ? -0.7790 ? -0.4664 ? 0.3764 ? -0.5618 ? 0.3964 ? -0.0623 ? 0.0000 ? 4 'X-RAY DIFFRACTION' ? refined -80.2224 87.5754 58.3227 -0.7991 ? -1.7469 ? 1.5952 ? 0.4802 ? -0.4221 ? -1.0532 ? 0.3423 ? 0.1188 ? -0.0769 ? 0.1590 ? 0.5022 ? 0.2291 ? -0.3537 ? 1.6052 ? 4.3502 ? -2.9794 ? -1.5133 ? 0.6876 ? -3.2224 ? -1.1702 ? 0.0000 ? 5 'X-RAY DIFFRACTION' ? refined -83.2122 83.7342 43.5191 1.8943 ? -0.2613 ? 0.0219 ? 1.1196 ? -0.0341 ? 1.1920 ? 0.1007 ? 0.1359 ? 0.2825 ? 0.2580 ? 0.2346 ? 0.1384 ? 0.1926 ? 0.1569 ? 0.2026 ? -0.5917 ? 0.2735 ? 0.1886 ? 0.0267 ? 0.0977 ? -0.0000 ? 6 'X-RAY DIFFRACTION' ? refined -81.7546 76.1242 45.2196 1.5836 ? -0.3029 ? -0.0796 ? 1.2241 ? 0.2076 ? 2.1699 ? -0.0165 ? -0.0157 ? -0.1442 ? 0.0213 ? -0.0785 ? -0.0397 ? -0.4594 ? -0.3720 ? -0.3344 ? 0.0943 ? 0.0872 ? -0.3924 ? -0.2111 ? -0.2371 ? 0.0000 ? 7 'X-RAY DIFFRACTION' ? refined -83.5810 79.2417 64.1216 1.3425 ? -0.0563 ? 0.0730 ? 1.0174 ? 0.0206 ? 1.1586 ? -0.0069 ? -0.0930 ? 0.0192 ? 0.0647 ? 0.0412 ? 0.0363 ? 0.3323 ? -0.2074 ? -0.3410 ? -0.3611 ? 0.3685 ? -0.2573 ? 0.1146 ? -0.0434 ? 0.0000 ? 8 'X-RAY DIFFRACTION' ? refined -82.1317 89.3171 67.1503 1.7152 ? -0.2389 ? 0.1138 ? 1.1378 ? 0.0420 ? 1.2250 ? 0.0135 ? 0.0779 ? -0.0606 ? 0.0393 ? 0.0657 ? 0.1124 ? 0.1629 ? 0.1221 ? 0.4215 ? 0.1454 ? 0.3029 ? 0.5096 ? 0.1798 ? 0.6522 ? -0.0000 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? A 3 ? ? A 23 ? ;chain 'A' and (resid 3 through 23 ) ; 2 'X-RAY DIFFRACTION' 2 ? ? A 24 ? ? A 110 ? ;chain 'A' and (resid 24 through 110 ) ; 3 'X-RAY DIFFRACTION' 3 ? ? A 111 ? ? A 130 ? ;chain 'A' and (resid 111 through 130 ) ; 4 'X-RAY DIFFRACTION' 4 ? ? A 131 ? ? A 155 ? ;chain 'A' and (resid 131 through 155 ) ; 5 'X-RAY DIFFRACTION' 5 ? ? A 156 ? ? A 198 ? ;chain 'A' and (resid 156 through 198 ) ; 6 'X-RAY DIFFRACTION' 6 ? ? A 199 ? ? A 254 ? ;chain 'A' and (resid 199 through 254 ) ; 7 'X-RAY DIFFRACTION' 7 ? ? A 255 ? ? A 281 ? ;chain 'A' and (resid 255 through 281 ) ; 8 'X-RAY DIFFRACTION' 8 ? ? A 282 ? ? A 303 ? ;chain 'A' and (resid 282 through 303 ) ; # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? dev_1951 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 4 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A ASN 84 ? ? ND2 A ASN 88 ? ? 2.17 2 1 OH A TYR 33 ? ? OE1 A GLU 119 ? ? 2.19 3 1 O A ASN 129 ? ? N A GLY 133 ? ? 2.19 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 5 ? ? -75.40 37.13 2 1 LEU A 6 ? ? -170.05 143.53 3 1 GLU A 21 ? ? -69.33 7.04 4 1 THR A 57 ? ? -82.71 40.54 5 1 THR A 59 ? ? -63.38 98.16 6 1 ILE A 86 ? ? -146.95 -22.68 7 1 ASN A 88 ? ? -75.25 -96.42 8 1 ALA A 108 ? ? -152.36 84.21 9 1 GLN A 132 ? ? -136.35 -31.67 10 1 LYS A 154 ? ? -162.46 119.60 11 1 ASN A 187 ? ? 48.81 -122.19 12 1 SER A 188 ? ? -146.26 -39.79 13 1 SER A 189 ? ? -72.02 -84.18 14 1 SER A 191 ? ? -163.38 113.53 15 1 ASP A 194 ? ? -109.38 -83.84 16 1 TRP A 248 ? ? -120.53 -143.38 17 1 ASN A 250 ? ? -68.87 -176.87 18 1 ALA A 252 ? ? -77.98 41.84 19 1 THR A 253 ? ? -136.37 -67.60 20 1 GLU A 254 ? ? -164.88 -128.57 21 1 HIS A 277 ? ? 76.59 -56.80 22 1 ARG A 278 ? ? 45.70 -111.76 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 7 ? CG ? A ARG 7 CG 2 1 Y 1 A ARG 7 ? CD ? A ARG 7 CD 3 1 Y 1 A ARG 7 ? NE ? A ARG 7 NE 4 1 Y 1 A ARG 7 ? CZ ? A ARG 7 CZ 5 1 Y 1 A ARG 7 ? NH1 ? A ARG 7 NH1 6 1 Y 1 A ARG 7 ? NH2 ? A ARG 7 NH2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 1 ? A SER 1 2 1 Y 1 A LYS 2 ? A LYS 2 3 1 Y 1 A SER 25 ? A SER 25 4 1 Y 1 A GLU 26 ? A GLU 26 5 1 Y 1 A THR 27 ? A THR 27 6 1 Y 1 A GLY 135 ? A GLY 135 7 1 Y 1 A GLY 136 ? A GLY 136 8 1 Y 1 A ALA 203 ? A ALA 203 9 1 Y 1 A THR 204 ? A THR 204 10 1 Y 1 A ARG 205 ? A ARG 205 11 1 Y 1 A ASN 206 ? A ASN 206 12 1 Y 1 A THR 207 ? A THR 207 13 1 Y 1 A THR 208 ? A THR 208 14 1 Y 1 A LYS 209 ? A LYS 209 15 1 Y 1 A GLN 210 ? A GLN 210 16 1 Y 1 A VAL 211 ? A VAL 211 17 1 Y 1 A THR 212 ? A THR 212 18 1 Y 1 A PRO 213 ? A PRO 213 19 1 Y 1 A GLN 214 ? A GLN 214 20 1 Y 1 A PRO 215 ? A PRO 215 21 1 Y 1 A GLU 216 ? A GLU 216 22 1 Y 1 A GLU 217 ? A GLU 217 23 1 Y 1 A GLN 218 ? A GLN 218 24 1 Y 1 A LYS 219 ? A LYS 219 25 1 Y 1 A GLU 220 ? A GLU 220 26 1 Y 1 A ARG 221 ? A ARG 221 27 1 Y 1 A LYS 222 ? A LYS 222 28 1 Y 1 A THR 223 ? A THR 223 29 1 Y 1 A THR 224 ? A THR 224 30 1 Y 1 A GLU 225 ? A GLU 225 31 1 Y 1 A MET 226 ? A MET 226 32 1 Y 1 A GLN 227 ? A GLN 227 33 1 Y 1 A SER 228 ? A SER 228 34 1 Y 1 A PRO 229 ? A PRO 229 35 1 Y 1 A MET 230 ? A MET 230 36 1 Y 1 A GLN 231 ? A GLN 231 37 1 Y 1 A PRO 232 ? A PRO 232 38 1 Y 1 A VAL 233 ? A VAL 233 39 1 Y 1 A ASP 234 ? A ASP 234 40 1 Y 1 A GLN 235 ? A GLN 235 41 1 Y 1 A ALA 236 ? A ALA 236 42 1 Y 1 A SER 237 ? A SER 237 43 1 Y 1 A LEU 238 ? A LEU 238 44 1 Y 1 A PRO 239 ? A PRO 239 45 1 Y 1 A GLY 240 ? A GLY 240 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 VAL N N N N 369 VAL CA C N S 370 VAL C C N N 371 VAL O O N N 372 VAL CB C N N 373 VAL CG1 C N N 374 VAL CG2 C N N 375 VAL OXT O N N 376 VAL H H N N 377 VAL H2 H N N 378 VAL HA H N N 379 VAL HB H N N 380 VAL HG11 H N N 381 VAL HG12 H N N 382 VAL HG13 H N N 383 VAL HG21 H N N 384 VAL HG22 H N N 385 VAL HG23 H N N 386 VAL HXT H N N 387 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1Z92 _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #