data_6W26 # _entry.id 6W26 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6W26 pdb_00006w26 10.2210/pdb6w26/pdb WWPDB D_1000247451 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6W26 _pdbx_database_status.recvd_initial_deposition_date 2020-03-05 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Herbst-Gervasoni, C.J.' 1 0000-0002-7154-4123 'Christianson, D.W.' 2 0000-0002-0194-5212 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nat Commun' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2041-1723 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 11 _citation.language ? _citation.page_first 3958 _citation.page_last 3958 _citation.title 'Discovery of the cryptic function of terpene cyclases as aromatic prenyltransferases.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41467-020-17642-2 _citation.pdbx_database_id_PubMed 32769971 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'He, H.' 1 ? primary 'Bian, G.' 2 ? primary 'Herbst-Gervasoni, C.J.' 3 ? primary 'Mori, T.' 4 0000-0002-2754-5858 primary 'Shinsky, S.A.' 5 ? primary 'Hou, A.' 6 ? primary 'Mu, X.' 7 ? primary 'Huang, M.' 8 ? primary 'Cheng, S.' 9 ? primary 'Deng, Z.' 10 ? primary 'Christianson, D.W.' 11 ? primary 'Abe, I.' 12 0000-0002-3640-888X primary 'Liu, T.' 13 0000-0001-8087-0345 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6W26 _cell.details ? _cell.formula_units_Z ? _cell.length_a 48.860 _cell.length_a_esd ? _cell.length_b 87.201 _cell.length_b_esd ? _cell.length_c 163.730 _cell.length_c_esd ? _cell.volume 697596.156 _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6W26 _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall 'P 2ac 2ab' _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Terpenoid cyclase FgGS' 36188.871 2 ? ? ? ? 2 non-polymer syn 'SULFATE ION' 96.063 1 ? ? ? ? 3 non-polymer syn 'MAGNESIUM ION' 24.305 6 ? ? ? ? 4 non-polymer syn 'SODIUM ION' 22.990 2 ? ? ? ? 5 non-polymer syn 'PYROPHOSPHATE 2-' 175.959 2 ? ? ? ? 6 non-polymer syn IMIDAZOLE 69.085 3 ? ? ? ? 7 non-polymer syn 1,2-ETHANEDIOL 62.068 3 ? ? ? ? 8 non-polymer syn GLYCEROL 92.094 2 ? ? ? ? 9 water nat water 18.015 198 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MDPYSETSDLVDISRFDTHGLGANYKLRRHKFEHLADTGCHKARSDWVKYIGPLTEFGGCNHINGNFSAVVLPLCRPDRL ELIAYVLEFAFLHDSVLESENTSPESEVQAEAGLRLLYERCISRLLQTDEVCAKKIAKTWKDAINTTTKDKNVDFQSIED YLEFRMIDTGAPFVEALMLFGLGMSLSPQEDDALGHVIRPCFAALALTNDYFSFDREIEEVDTSTLINSVAIVMRIQSLD IPTAKTIINETIQKYEREFLRRIDEYKQHKGPISNKIEQYMEAMTYQISGNLVWSLNCPRYNPDYRYGLEACQHEG ; _entity_poly.pdbx_seq_one_letter_code_can ;MDPYSETSDLVDISRFDTHGLGANYKLRRHKFEHLADTGCHKARSDWVKYIGPLTEFGGCNHINGNFSAVVLPLCRPDRL ELIAYVLEFAFLHDSVLESENTSPESEVQAEAGLRLLYERCISRLLQTDEVCAKKIAKTWKDAINTTTKDKNVDFQSIED YLEFRMIDTGAPFVEALMLFGLGMSLSPQEDDALGHVIRPCFAALALTNDYFSFDREIEEVDTSTLINSVAIVMRIQSLD IPTAKTIINETIQKYEREFLRRIDEYKQHKGPISNKIEQYMEAMTYQISGNLVWSLNCPRYNPDYRYGLEACQHEG ; _entity_poly.pdbx_strand_id I,A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASP n 1 3 PRO n 1 4 TYR n 1 5 SER n 1 6 GLU n 1 7 THR n 1 8 SER n 1 9 ASP n 1 10 LEU n 1 11 VAL n 1 12 ASP n 1 13 ILE n 1 14 SER n 1 15 ARG n 1 16 PHE n 1 17 ASP n 1 18 THR n 1 19 HIS n 1 20 GLY n 1 21 LEU n 1 22 GLY n 1 23 ALA n 1 24 ASN n 1 25 TYR n 1 26 LYS n 1 27 LEU n 1 28 ARG n 1 29 ARG n 1 30 HIS n 1 31 LYS n 1 32 PHE n 1 33 GLU n 1 34 HIS n 1 35 LEU n 1 36 ALA n 1 37 ASP n 1 38 THR n 1 39 GLY n 1 40 CYS n 1 41 HIS n 1 42 LYS n 1 43 ALA n 1 44 ARG n 1 45 SER n 1 46 ASP n 1 47 TRP n 1 48 VAL n 1 49 LYS n 1 50 TYR n 1 51 ILE n 1 52 GLY n 1 53 PRO n 1 54 LEU n 1 55 THR n 1 56 GLU n 1 57 PHE n 1 58 GLY n 1 59 GLY n 1 60 CYS n 1 61 ASN n 1 62 HIS n 1 63 ILE n 1 64 ASN n 1 65 GLY n 1 66 ASN n 1 67 PHE n 1 68 SER n 1 69 ALA n 1 70 VAL n 1 71 VAL n 1 72 LEU n 1 73 PRO n 1 74 LEU n 1 75 CYS n 1 76 ARG n 1 77 PRO n 1 78 ASP n 1 79 ARG n 1 80 LEU n 1 81 GLU n 1 82 LEU n 1 83 ILE n 1 84 ALA n 1 85 TYR n 1 86 VAL n 1 87 LEU n 1 88 GLU n 1 89 PHE n 1 90 ALA n 1 91 PHE n 1 92 LEU n 1 93 HIS n 1 94 ASP n 1 95 SER n 1 96 VAL n 1 97 LEU n 1 98 GLU n 1 99 SER n 1 100 GLU n 1 101 ASN n 1 102 THR n 1 103 SER n 1 104 PRO n 1 105 GLU n 1 106 SER n 1 107 GLU n 1 108 VAL n 1 109 GLN n 1 110 ALA n 1 111 GLU n 1 112 ALA n 1 113 GLY n 1 114 LEU n 1 115 ARG n 1 116 LEU n 1 117 LEU n 1 118 TYR n 1 119 GLU n 1 120 ARG n 1 121 CYS n 1 122 ILE n 1 123 SER n 1 124 ARG n 1 125 LEU n 1 126 LEU n 1 127 GLN n 1 128 THR n 1 129 ASP n 1 130 GLU n 1 131 VAL n 1 132 CYS n 1 133 ALA n 1 134 LYS n 1 135 LYS n 1 136 ILE n 1 137 ALA n 1 138 LYS n 1 139 THR n 1 140 TRP n 1 141 LYS n 1 142 ASP n 1 143 ALA n 1 144 ILE n 1 145 ASN n 1 146 THR n 1 147 THR n 1 148 THR n 1 149 LYS n 1 150 ASP n 1 151 LYS n 1 152 ASN n 1 153 VAL n 1 154 ASP n 1 155 PHE n 1 156 GLN n 1 157 SER n 1 158 ILE n 1 159 GLU n 1 160 ASP n 1 161 TYR n 1 162 LEU n 1 163 GLU n 1 164 PHE n 1 165 ARG n 1 166 MET n 1 167 ILE n 1 168 ASP n 1 169 THR n 1 170 GLY n 1 171 ALA n 1 172 PRO n 1 173 PHE n 1 174 VAL n 1 175 GLU n 1 176 ALA n 1 177 LEU n 1 178 MET n 1 179 LEU n 1 180 PHE n 1 181 GLY n 1 182 LEU n 1 183 GLY n 1 184 MET n 1 185 SER n 1 186 LEU n 1 187 SER n 1 188 PRO n 1 189 GLN n 1 190 GLU n 1 191 ASP n 1 192 ASP n 1 193 ALA n 1 194 LEU n 1 195 GLY n 1 196 HIS n 1 197 VAL n 1 198 ILE n 1 199 ARG n 1 200 PRO n 1 201 CYS n 1 202 PHE n 1 203 ALA n 1 204 ALA n 1 205 LEU n 1 206 ALA n 1 207 LEU n 1 208 THR n 1 209 ASN n 1 210 ASP n 1 211 TYR n 1 212 PHE n 1 213 SER n 1 214 PHE n 1 215 ASP n 1 216 ARG n 1 217 GLU n 1 218 ILE n 1 219 GLU n 1 220 GLU n 1 221 VAL n 1 222 ASP n 1 223 THR n 1 224 SER n 1 225 THR n 1 226 LEU n 1 227 ILE n 1 228 ASN n 1 229 SER n 1 230 VAL n 1 231 ALA n 1 232 ILE n 1 233 VAL n 1 234 MET n 1 235 ARG n 1 236 ILE n 1 237 GLN n 1 238 SER n 1 239 LEU n 1 240 ASP n 1 241 ILE n 1 242 PRO n 1 243 THR n 1 244 ALA n 1 245 LYS n 1 246 THR n 1 247 ILE n 1 248 ILE n 1 249 ASN n 1 250 GLU n 1 251 THR n 1 252 ILE n 1 253 GLN n 1 254 LYS n 1 255 TYR n 1 256 GLU n 1 257 ARG n 1 258 GLU n 1 259 PHE n 1 260 LEU n 1 261 ARG n 1 262 ARG n 1 263 ILE n 1 264 ASP n 1 265 GLU n 1 266 TYR n 1 267 LYS n 1 268 GLN n 1 269 HIS n 1 270 LYS n 1 271 GLY n 1 272 PRO n 1 273 ILE n 1 274 SER n 1 275 ASN n 1 276 LYS n 1 277 ILE n 1 278 GLU n 1 279 GLN n 1 280 TYR n 1 281 MET n 1 282 GLU n 1 283 ALA n 1 284 MET n 1 285 THR n 1 286 TYR n 1 287 GLN n 1 288 ILE n 1 289 SER n 1 290 GLY n 1 291 ASN n 1 292 LEU n 1 293 VAL n 1 294 TRP n 1 295 SER n 1 296 LEU n 1 297 ASN n 1 298 CYS n 1 299 PRO n 1 300 ARG n 1 301 TYR n 1 302 ASN n 1 303 PRO n 1 304 ASP n 1 305 TYR n 1 306 ARG n 1 307 TYR n 1 308 GLY n 1 309 LEU n 1 310 GLU n 1 311 ALA n 1 312 CYS n 1 313 GLN n 1 314 HIS n 1 315 GLU n 1 316 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 316 _entity_src_gen.gene_src_common_name 'Wheat head blight fungus' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene FGRAMPH1_01T04331 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 229533 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code I1RDR8_GIBZE _struct_ref.pdbx_db_accession I1RDR8 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MDPYSETSDLVDISRFDTHGLGANYKLRRHKFEHLADTGCHKARSDWVKYIGPLTEFGGCNHINGNFSAVVLPLCRPDRL ELIAYVLEFAFLHDSVLESENTSPESEVQAEAGLRLLYERCISRLLQTDEVCAKKIAKTWKDAINTTTKDKNVDFQSIED YLEFRMIDTGAPFVEALMLFGLGMSLSPQEDDALGHVIRPCFAALALTNDYFSFDREMEEVDTSTLINSVAIVMRIQNLD IPTAKTIINETIQKYEREFLRRIDEYKQHKGPISNKIEQYMEAMTYQISGNLVWSLNCPRYNPDYRYGLEACQHEG ; _struct_ref.pdbx_align_begin 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 6W26 I 1 ? 316 ? I1RDR8 1 ? 316 ? 1 316 2 1 6W26 A 1 ? 316 ? I1RDR8 1 ? 316 ? 1 316 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6W26 ILE I 218 ? UNP I1RDR8 MET 218 conflict 218 1 1 6W26 SER I 238 ? UNP I1RDR8 ASN 238 conflict 238 2 2 6W26 ILE A 218 ? UNP I1RDR8 MET 218 conflict 218 3 2 6W26 SER A 238 ? UNP I1RDR8 ASN 238 conflict 238 4 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 EDO non-polymer . 1,2-ETHANEDIOL 'ETHYLENE GLYCOL' 'C2 H6 O2' 62.068 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 IMD non-polymer . IMIDAZOLE ? 'C3 H5 N2 1' 69.085 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 NA non-polymer . 'SODIUM ION' ? 'Na 1' 22.990 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 POP non-polymer . 'PYROPHOSPHATE 2-' ? 'H2 O7 P2 -2' 175.959 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6W26 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.41 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 48.95 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;5 mg/mL FgGS, 2 mM indole, 10 mM magnesium chloride, 2 mM sodium pyrophosphate, 0.1 M Ammonium sulfate, 0.1 M Imidazole (pH 7.3), 24% (w/v) PEG monomethyl ether 5k, and 2% PEG 400 ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2019-05-17 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97946 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRL BEAMLINE BL9-2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97946 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL9-2 _diffrn_source.pdbx_synchrotron_site SSRL # _reflns.B_iso_Wilson_estimate 19.84 _reflns.entry_id 6W26 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.15 _reflns.d_resolution_low 46.82 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 38801 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.52 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.0 _reflns.pdbx_Rmerge_I_obs 0.09022 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 4.9 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all .09022 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.973 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.15 _reflns_shell.d_res_low 2.227 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.83 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 3834 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs .2517 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all .2517 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half .642 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 21.41 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6W26 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.15 _refine.ls_d_res_low 46.82 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 38778 _refine.ls_number_reflns_R_free 1949 _refine.ls_number_reflns_R_work 36829 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.53 _refine.ls_percent_reflns_R_free 5.03 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2062 _refine.ls_R_factor_R_free 0.2544 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2036 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.35 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 5TD7 _refine.pdbx_stereochemistry_target_values 'CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 23.2009 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2805 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.15 _refine_hist.d_res_low 46.82 _refine_hist.number_atoms_solvent 198 _refine_hist.number_atoms_total 4985 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 4717 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 70 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0061 ? 4938 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.6611 ? 6700 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0445 ? 750 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0038 ? 861 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 22.7456 ? 1825 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.15 2.20 . . 131 2579 99.78 . . . 0.3152 . 0.2577 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.20 2.26 . . 135 2567 98.61 . . . 0.3460 . 0.2717 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.26 2.33 . . 114 2607 98.48 . . . 0.3059 . 0.2474 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.33 2.41 . . 134 2568 99.78 . . . 0.3111 . 0.2310 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.41 2.49 . . 142 2631 99.78 . . . 0.2872 . 0.2202 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.49 2.59 . . 137 2613 99.93 . . . 0.2921 . 0.2248 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.59 2.71 . . 145 2597 99.67 . . . 0.3127 . 0.2142 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.71 2.85 . . 135 2596 98.91 . . . 0.2238 . 0.2076 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.85 3.03 . . 143 2627 100.00 . . . 0.2406 . 0.2098 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.03 3.26 . . 143 2630 99.93 . . . 0.2896 . 0.2156 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.26 3.59 . . 138 2629 99.60 . . . 0.2696 . 0.2016 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.59 4.11 . . 149 2669 99.47 . . . 0.2191 . 0.1777 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.11 5.18 . . 142 2698 99.86 . . . 0.1928 . 0.1594 . . . . . . . . . . . 'X-RAY DIFFRACTION' 5.18 46.82 . . 161 2818 99.53 . . . 0.2070 . 0.1757 . . . . . . . . . . . # loop_ _struct_ncs_dom.id _struct_ncs_dom.pdbx_ens_id _struct_ncs_dom.details 1 1 ? 2 1 ? # loop_ _struct_ncs_dom_lim.pdbx_ens_id _struct_ncs_dom_lim.dom_id _struct_ncs_dom_lim.pdbx_component_id _struct_ncs_dom_lim.beg_label_asym_id _struct_ncs_dom_lim.beg_label_comp_id _struct_ncs_dom_lim.beg_label_seq_id _struct_ncs_dom_lim.beg_label_alt_id _struct_ncs_dom_lim.end_label_asym_id _struct_ncs_dom_lim.end_label_comp_id _struct_ncs_dom_lim.end_label_seq_id _struct_ncs_dom_lim.end_label_alt_id _struct_ncs_dom_lim.beg_auth_asym_id _struct_ncs_dom_lim.beg_auth_comp_id _struct_ncs_dom_lim.beg_auth_seq_id _struct_ncs_dom_lim.end_auth_asym_id _struct_ncs_dom_lim.end_auth_comp_id _struct_ncs_dom_lim.end_auth_seq_id _struct_ncs_dom_lim.pdbx_refine_code _struct_ncs_dom_lim.selection_details 1 1 1 B SER 5 . B ARG 44 . A SER 5 A ARG 44 ? ;(chain 'A' and (resid 5 through 14 or (resid 15 and (name N or name CA or name C or name O or name CB )) or resid 16 through 44 or resid 46 through 53 or resid 55 through 61 or resid 63 through 74 or resid 76 through 110 or (resid 111 and (name N or name CA or name C or name O or name CB or name CG )) or resid 112 through 122 or resid 124 through 126 or (resid 127 and (name N or name CA or name C or name O or name CB or name CG )) or resid 128 through 131 or resid 133 or (resid 134 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 135 through 151 or resid 153 through 166 or resid 168 through 184 or resid 186 through 188 or (resid 189 and (name N or name CA or name C or name O or name CB or name CG )) or resid 190 through 215 or resid 217 through 221 or resid 223 through 263 or resid 265 through 269 or (resid 270 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 272 through 304)) ; 1 1 2 B ASP 46 . B PRO 53 . A ASP 46 A PRO 53 ? ;(chain 'A' and (resid 5 through 14 or (resid 15 and (name N or name CA or name C or name O or name CB )) or resid 16 through 44 or resid 46 through 53 or resid 55 through 61 or resid 63 through 74 or resid 76 through 110 or (resid 111 and (name N or name CA or name C or name O or name CB or name CG )) or resid 112 through 122 or resid 124 through 126 or (resid 127 and (name N or name CA or name C or name O or name CB or name CG )) or resid 128 through 131 or resid 133 or (resid 134 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 135 through 151 or resid 153 through 166 or resid 168 through 184 or resid 186 through 188 or (resid 189 and (name N or name CA or name C or name O or name CB or name CG )) or resid 190 through 215 or resid 217 through 221 or resid 223 through 263 or resid 265 through 269 or (resid 270 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 272 through 304)) ; 1 1 3 B THR 55 . B ASN 61 . A THR 55 A ASN 61 ? ;(chain 'A' and (resid 5 through 14 or (resid 15 and (name N or name CA or name C or name O or name CB )) or resid 16 through 44 or resid 46 through 53 or resid 55 through 61 or resid 63 through 74 or resid 76 through 110 or (resid 111 and (name N or name CA or name C or name O or name CB or name CG )) or resid 112 through 122 or resid 124 through 126 or (resid 127 and (name N or name CA or name C or name O or name CB or name CG )) or resid 128 through 131 or resid 133 or (resid 134 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 135 through 151 or resid 153 through 166 or resid 168 through 184 or resid 186 through 188 or (resid 189 and (name N or name CA or name C or name O or name CB or name CG )) or resid 190 through 215 or resid 217 through 221 or resid 223 through 263 or resid 265 through 269 or (resid 270 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 272 through 304)) ; 1 1 4 B ILE 63 . B LEU 74 . A ILE 63 A LEU 74 ? ;(chain 'A' and (resid 5 through 14 or (resid 15 and (name N or name CA or name C or name O or name CB )) or resid 16 through 44 or resid 46 through 53 or resid 55 through 61 or resid 63 through 74 or resid 76 through 110 or (resid 111 and (name N or name CA or name C or name O or name CB or name CG )) or resid 112 through 122 or resid 124 through 126 or (resid 127 and (name N or name CA or name C or name O or name CB or name CG )) or resid 128 through 131 or resid 133 or (resid 134 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 135 through 151 or resid 153 through 166 or resid 168 through 184 or resid 186 through 188 or (resid 189 and (name N or name CA or name C or name O or name CB or name CG )) or resid 190 through 215 or resid 217 through 221 or resid 223 through 263 or resid 265 through 269 or (resid 270 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 272 through 304)) ; 1 1 5 B ARG 76 . B GLU 100 . A ARG 76 A GLU 100 ? ;(chain 'A' and (resid 5 through 14 or (resid 15 and (name N or name CA or name C or name O or name CB )) or resid 16 through 44 or resid 46 through 53 or resid 55 through 61 or resid 63 through 74 or resid 76 through 110 or (resid 111 and (name N or name CA or name C or name O or name CB or name CG )) or resid 112 through 122 or resid 124 through 126 or (resid 127 and (name N or name CA or name C or name O or name CB or name CG )) or resid 128 through 131 or resid 133 or (resid 134 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 135 through 151 or resid 153 through 166 or resid 168 through 184 or resid 186 through 188 or (resid 189 and (name N or name CA or name C or name O or name CB or name CG )) or resid 190 through 215 or resid 217 through 221 or resid 223 through 263 or resid 265 through 269 or (resid 270 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 272 through 304)) ; 1 1 6 B ALA 110 . B ILE 122 . A ALA 110 A ILE 122 ? ;(chain 'A' and (resid 5 through 14 or (resid 15 and (name N or name CA or name C or name O or name CB )) or resid 16 through 44 or resid 46 through 53 or resid 55 through 61 or resid 63 through 74 or resid 76 through 110 or (resid 111 and (name N or name CA or name C or name O or name CB or name CG )) or resid 112 through 122 or resid 124 through 126 or (resid 127 and (name N or name CA or name C or name O or name CB or name CG )) or resid 128 through 131 or resid 133 or (resid 134 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 135 through 151 or resid 153 through 166 or resid 168 through 184 or resid 186 through 188 or (resid 189 and (name N or name CA or name C or name O or name CB or name CG )) or resid 190 through 215 or resid 217 through 221 or resid 223 through 263 or resid 265 through 269 or (resid 270 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 272 through 304)) ; 1 1 7 B ARG 124 . B VAL 131 . A ARG 124 A VAL 131 ? ;(chain 'A' and (resid 5 through 14 or (resid 15 and (name N or name CA or name C or name O or name CB )) or resid 16 through 44 or resid 46 through 53 or resid 55 through 61 or resid 63 through 74 or resid 76 through 110 or (resid 111 and (name N or name CA or name C or name O or name CB or name CG )) or resid 112 through 122 or resid 124 through 126 or (resid 127 and (name N or name CA or name C or name O or name CB or name CG )) or resid 128 through 131 or resid 133 or (resid 134 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 135 through 151 or resid 153 through 166 or resid 168 through 184 or resid 186 through 188 or (resid 189 and (name N or name CA or name C or name O or name CB or name CG )) or resid 190 through 215 or resid 217 through 221 or resid 223 through 263 or resid 265 through 269 or (resid 270 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 272 through 304)) ; 1 1 8 B ALA 133 . B LYS 151 . A ALA 133 A LYS 151 ? ;(chain 'A' and (resid 5 through 14 or (resid 15 and (name N or name CA or name C or name O or name CB )) or resid 16 through 44 or resid 46 through 53 or resid 55 through 61 or resid 63 through 74 or resid 76 through 110 or (resid 111 and (name N or name CA or name C or name O or name CB or name CG )) or resid 112 through 122 or resid 124 through 126 or (resid 127 and (name N or name CA or name C or name O or name CB or name CG )) or resid 128 through 131 or resid 133 or (resid 134 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 135 through 151 or resid 153 through 166 or resid 168 through 184 or resid 186 through 188 or (resid 189 and (name N or name CA or name C or name O or name CB or name CG )) or resid 190 through 215 or resid 217 through 221 or resid 223 through 263 or resid 265 through 269 or (resid 270 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 272 through 304)) ; 1 1 9 B VAL 153 . B MET 166 . A VAL 153 A MET 166 ? ;(chain 'A' and (resid 5 through 14 or (resid 15 and (name N or name CA or name C or name O or name CB )) or resid 16 through 44 or resid 46 through 53 or resid 55 through 61 or resid 63 through 74 or resid 76 through 110 or (resid 111 and (name N or name CA or name C or name O or name CB or name CG )) or resid 112 through 122 or resid 124 through 126 or (resid 127 and (name N or name CA or name C or name O or name CB or name CG )) or resid 128 through 131 or resid 133 or (resid 134 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 135 through 151 or resid 153 through 166 or resid 168 through 184 or resid 186 through 188 or (resid 189 and (name N or name CA or name C or name O or name CB or name CG )) or resid 190 through 215 or resid 217 through 221 or resid 223 through 263 or resid 265 through 269 or (resid 270 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 272 through 304)) ; 1 1 10 B ASP 168 . B MET 184 . A ASP 168 A MET 184 ? ;(chain 'A' and (resid 5 through 14 or (resid 15 and (name N or name CA or name C or name O or name CB )) or resid 16 through 44 or resid 46 through 53 or resid 55 through 61 or resid 63 through 74 or resid 76 through 110 or (resid 111 and (name N or name CA or name C or name O or name CB or name CG )) or resid 112 through 122 or resid 124 through 126 or (resid 127 and (name N or name CA or name C or name O or name CB or name CG )) or resid 128 through 131 or resid 133 or (resid 134 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 135 through 151 or resid 153 through 166 or resid 168 through 184 or resid 186 through 188 or (resid 189 and (name N or name CA or name C or name O or name CB or name CG )) or resid 190 through 215 or resid 217 through 221 or resid 223 through 263 or resid 265 through 269 or (resid 270 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 272 through 304)) ; 1 1 11 B LEU 186 . B ASP 215 . A LEU 186 A ASP 215 ? ;(chain 'A' and (resid 5 through 14 or (resid 15 and (name N or name CA or name C or name O or name CB )) or resid 16 through 44 or resid 46 through 53 or resid 55 through 61 or resid 63 through 74 or resid 76 through 110 or (resid 111 and (name N or name CA or name C or name O or name CB or name CG )) or resid 112 through 122 or resid 124 through 126 or (resid 127 and (name N or name CA or name C or name O or name CB or name CG )) or resid 128 through 131 or resid 133 or (resid 134 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 135 through 151 or resid 153 through 166 or resid 168 through 184 or resid 186 through 188 or (resid 189 and (name N or name CA or name C or name O or name CB or name CG )) or resid 190 through 215 or resid 217 through 221 or resid 223 through 263 or resid 265 through 269 or (resid 270 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 272 through 304)) ; 1 1 12 B GLU 217 . B VAL 221 . A GLU 217 A VAL 221 ? ;(chain 'A' and (resid 5 through 14 or (resid 15 and (name N or name CA or name C or name O or name CB )) or resid 16 through 44 or resid 46 through 53 or resid 55 through 61 or resid 63 through 74 or resid 76 through 110 or (resid 111 and (name N or name CA or name C or name O or name CB or name CG )) or resid 112 through 122 or resid 124 through 126 or (resid 127 and (name N or name CA or name C or name O or name CB or name CG )) or resid 128 through 131 or resid 133 or (resid 134 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 135 through 151 or resid 153 through 166 or resid 168 through 184 or resid 186 through 188 or (resid 189 and (name N or name CA or name C or name O or name CB or name CG )) or resid 190 through 215 or resid 217 through 221 or resid 223 through 263 or resid 265 through 269 or (resid 270 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 272 through 304)) ; 1 1 13 B THR 223 . B ILE 263 . A THR 223 A ILE 263 ? ;(chain 'A' and (resid 5 through 14 or (resid 15 and (name N or name CA or name C or name O or name CB )) or resid 16 through 44 or resid 46 through 53 or resid 55 through 61 or resid 63 through 74 or resid 76 through 110 or (resid 111 and (name N or name CA or name C or name O or name CB or name CG )) or resid 112 through 122 or resid 124 through 126 or (resid 127 and (name N or name CA or name C or name O or name CB or name CG )) or resid 128 through 131 or resid 133 or (resid 134 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 135 through 151 or resid 153 through 166 or resid 168 through 184 or resid 186 through 188 or (resid 189 and (name N or name CA or name C or name O or name CB or name CG )) or resid 190 through 215 or resid 217 through 221 or resid 223 through 263 or resid 265 through 269 or (resid 270 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 272 through 304)) ; 1 1 14 B GLU 265 . B LYS 270 . A GLU 265 A LYS 270 ? ;(chain 'A' and (resid 5 through 14 or (resid 15 and (name N or name CA or name C or name O or name CB )) or resid 16 through 44 or resid 46 through 53 or resid 55 through 61 or resid 63 through 74 or resid 76 through 110 or (resid 111 and (name N or name CA or name C or name O or name CB or name CG )) or resid 112 through 122 or resid 124 through 126 or (resid 127 and (name N or name CA or name C or name O or name CB or name CG )) or resid 128 through 131 or resid 133 or (resid 134 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 135 through 151 or resid 153 through 166 or resid 168 through 184 or resid 186 through 188 or (resid 189 and (name N or name CA or name C or name O or name CB or name CG )) or resid 190 through 215 or resid 217 through 221 or resid 223 through 263 or resid 265 through 269 or (resid 270 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 272 through 304)) ; 1 1 15 B PRO 272 . B PRO 303 . A PRO 272 A PRO 303 ? ;(chain 'A' and (resid 5 through 14 or (resid 15 and (name N or name CA or name C or name O or name CB )) or resid 16 through 44 or resid 46 through 53 or resid 55 through 61 or resid 63 through 74 or resid 76 through 110 or (resid 111 and (name N or name CA or name C or name O or name CB or name CG )) or resid 112 through 122 or resid 124 through 126 or (resid 127 and (name N or name CA or name C or name O or name CB or name CG )) or resid 128 through 131 or resid 133 or (resid 134 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 135 through 151 or resid 153 through 166 or resid 168 through 184 or resid 186 through 188 or (resid 189 and (name N or name CA or name C or name O or name CB or name CG )) or resid 190 through 215 or resid 217 through 221 or resid 223 through 263 or resid 265 through 269 or (resid 270 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 272 through 304)) ; 1 2 16 A SER 5 . A ARG 44 . I SER 5 I ARG 44 ? ;(chain 'I' and (resid 5 through 40 or (resid 41 and (name N or name CA or name C or name O or name CB )) or resid 42 through 44 or resid 46 through 48 or (resid 49 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 50 through 53 or resid 55 through 61 or resid 63 through 74 or resid 76 through 100 or resid 110 through 122 or resid 124 through 131 or resid 133 through 137 or (resid 138 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 139 through 148 or (resid 149 and (name N or name CA or name C or name O or name CB or name CG )) or resid 150 through 151 or resid 153 or (resid 154 and (name N or name CA or name C or name O or name CB )) or resid 155 or (resid 156 and (name N or name CA or name C or name O or name CB or name CG )) or resid 157 through 166 or resid 168 through 184 or resid 186 through 215 or resid 217 through 221 or resid 223 through 263 or resid 265 through 303 or (resid 304 and (name N or name CA or name C or name O or name CB )))) ; 1 2 17 A ASP 46 . A PRO 53 . I ASP 46 I PRO 53 ? ;(chain 'I' and (resid 5 through 40 or (resid 41 and (name N or name CA or name C or name O or name CB )) or resid 42 through 44 or resid 46 through 48 or (resid 49 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 50 through 53 or resid 55 through 61 or resid 63 through 74 or resid 76 through 100 or resid 110 through 122 or resid 124 through 131 or resid 133 through 137 or (resid 138 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 139 through 148 or (resid 149 and (name N or name CA or name C or name O or name CB or name CG )) or resid 150 through 151 or resid 153 or (resid 154 and (name N or name CA or name C or name O or name CB )) or resid 155 or (resid 156 and (name N or name CA or name C or name O or name CB or name CG )) or resid 157 through 166 or resid 168 through 184 or resid 186 through 215 or resid 217 through 221 or resid 223 through 263 or resid 265 through 303 or (resid 304 and (name N or name CA or name C or name O or name CB )))) ; 1 2 18 A THR 55 . A ASN 61 . I THR 55 I ASN 61 ? ;(chain 'I' and (resid 5 through 40 or (resid 41 and (name N or name CA or name C or name O or name CB )) or resid 42 through 44 or resid 46 through 48 or (resid 49 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 50 through 53 or resid 55 through 61 or resid 63 through 74 or resid 76 through 100 or resid 110 through 122 or resid 124 through 131 or resid 133 through 137 or (resid 138 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 139 through 148 or (resid 149 and (name N or name CA or name C or name O or name CB or name CG )) or resid 150 through 151 or resid 153 or (resid 154 and (name N or name CA or name C or name O or name CB )) or resid 155 or (resid 156 and (name N or name CA or name C or name O or name CB or name CG )) or resid 157 through 166 or resid 168 through 184 or resid 186 through 215 or resid 217 through 221 or resid 223 through 263 or resid 265 through 303 or (resid 304 and (name N or name CA or name C or name O or name CB )))) ; 1 2 19 A ILE 63 . A LEU 74 . I ILE 63 I LEU 74 ? ;(chain 'I' and (resid 5 through 40 or (resid 41 and (name N or name CA or name C or name O or name CB )) or resid 42 through 44 or resid 46 through 48 or (resid 49 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 50 through 53 or resid 55 through 61 or resid 63 through 74 or resid 76 through 100 or resid 110 through 122 or resid 124 through 131 or resid 133 through 137 or (resid 138 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 139 through 148 or (resid 149 and (name N or name CA or name C or name O or name CB or name CG )) or resid 150 through 151 or resid 153 or (resid 154 and (name N or name CA or name C or name O or name CB )) or resid 155 or (resid 156 and (name N or name CA or name C or name O or name CB or name CG )) or resid 157 through 166 or resid 168 through 184 or resid 186 through 215 or resid 217 through 221 or resid 223 through 263 or resid 265 through 303 or (resid 304 and (name N or name CA or name C or name O or name CB )))) ; 1 2 20 A ARG 76 . A GLU 100 . I ARG 76 I GLU 100 ? ;(chain 'I' and (resid 5 through 40 or (resid 41 and (name N or name CA or name C or name O or name CB )) or resid 42 through 44 or resid 46 through 48 or (resid 49 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 50 through 53 or resid 55 through 61 or resid 63 through 74 or resid 76 through 100 or resid 110 through 122 or resid 124 through 131 or resid 133 through 137 or (resid 138 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 139 through 148 or (resid 149 and (name N or name CA or name C or name O or name CB or name CG )) or resid 150 through 151 or resid 153 or (resid 154 and (name N or name CA or name C or name O or name CB )) or resid 155 or (resid 156 and (name N or name CA or name C or name O or name CB or name CG )) or resid 157 through 166 or resid 168 through 184 or resid 186 through 215 or resid 217 through 221 or resid 223 through 263 or resid 265 through 303 or (resid 304 and (name N or name CA or name C or name O or name CB )))) ; 1 2 21 A ALA 110 . A ILE 122 . I ALA 110 I ILE 122 ? ;(chain 'I' and (resid 5 through 40 or (resid 41 and (name N or name CA or name C or name O or name CB )) or resid 42 through 44 or resid 46 through 48 or (resid 49 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 50 through 53 or resid 55 through 61 or resid 63 through 74 or resid 76 through 100 or resid 110 through 122 or resid 124 through 131 or resid 133 through 137 or (resid 138 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 139 through 148 or (resid 149 and (name N or name CA or name C or name O or name CB or name CG )) or resid 150 through 151 or resid 153 or (resid 154 and (name N or name CA or name C or name O or name CB )) or resid 155 or (resid 156 and (name N or name CA or name C or name O or name CB or name CG )) or resid 157 through 166 or resid 168 through 184 or resid 186 through 215 or resid 217 through 221 or resid 223 through 263 or resid 265 through 303 or (resid 304 and (name N or name CA or name C or name O or name CB )))) ; 1 2 22 A ARG 124 . A VAL 131 . I ARG 124 I VAL 131 ? ;(chain 'I' and (resid 5 through 40 or (resid 41 and (name N or name CA or name C or name O or name CB )) or resid 42 through 44 or resid 46 through 48 or (resid 49 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 50 through 53 or resid 55 through 61 or resid 63 through 74 or resid 76 through 100 or resid 110 through 122 or resid 124 through 131 or resid 133 through 137 or (resid 138 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 139 through 148 or (resid 149 and (name N or name CA or name C or name O or name CB or name CG )) or resid 150 through 151 or resid 153 or (resid 154 and (name N or name CA or name C or name O or name CB )) or resid 155 or (resid 156 and (name N or name CA or name C or name O or name CB or name CG )) or resid 157 through 166 or resid 168 through 184 or resid 186 through 215 or resid 217 through 221 or resid 223 through 263 or resid 265 through 303 or (resid 304 and (name N or name CA or name C or name O or name CB )))) ; 1 2 23 A ALA 133 . A LYS 151 . I ALA 133 I LYS 151 ? ;(chain 'I' and (resid 5 through 40 or (resid 41 and (name N or name CA or name C or name O or name CB )) or resid 42 through 44 or resid 46 through 48 or (resid 49 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 50 through 53 or resid 55 through 61 or resid 63 through 74 or resid 76 through 100 or resid 110 through 122 or resid 124 through 131 or resid 133 through 137 or (resid 138 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 139 through 148 or (resid 149 and (name N or name CA or name C or name O or name CB or name CG )) or resid 150 through 151 or resid 153 or (resid 154 and (name N or name CA or name C or name O or name CB )) or resid 155 or (resid 156 and (name N or name CA or name C or name O or name CB or name CG )) or resid 157 through 166 or resid 168 through 184 or resid 186 through 215 or resid 217 through 221 or resid 223 through 263 or resid 265 through 303 or (resid 304 and (name N or name CA or name C or name O or name CB )))) ; 1 2 24 A VAL 153 . A MET 166 . I VAL 153 I MET 166 ? ;(chain 'I' and (resid 5 through 40 or (resid 41 and (name N or name CA or name C or name O or name CB )) or resid 42 through 44 or resid 46 through 48 or (resid 49 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 50 through 53 or resid 55 through 61 or resid 63 through 74 or resid 76 through 100 or resid 110 through 122 or resid 124 through 131 or resid 133 through 137 or (resid 138 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 139 through 148 or (resid 149 and (name N or name CA or name C or name O or name CB or name CG )) or resid 150 through 151 or resid 153 or (resid 154 and (name N or name CA or name C or name O or name CB )) or resid 155 or (resid 156 and (name N or name CA or name C or name O or name CB or name CG )) or resid 157 through 166 or resid 168 through 184 or resid 186 through 215 or resid 217 through 221 or resid 223 through 263 or resid 265 through 303 or (resid 304 and (name N or name CA or name C or name O or name CB )))) ; 1 2 25 A ASP 168 . A MET 184 . I ASP 168 I MET 184 ? ;(chain 'I' and (resid 5 through 40 or (resid 41 and (name N or name CA or name C or name O or name CB )) or resid 42 through 44 or resid 46 through 48 or (resid 49 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 50 through 53 or resid 55 through 61 or resid 63 through 74 or resid 76 through 100 or resid 110 through 122 or resid 124 through 131 or resid 133 through 137 or (resid 138 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 139 through 148 or (resid 149 and (name N or name CA or name C or name O or name CB or name CG )) or resid 150 through 151 or resid 153 or (resid 154 and (name N or name CA or name C or name O or name CB )) or resid 155 or (resid 156 and (name N or name CA or name C or name O or name CB or name CG )) or resid 157 through 166 or resid 168 through 184 or resid 186 through 215 or resid 217 through 221 or resid 223 through 263 or resid 265 through 303 or (resid 304 and (name N or name CA or name C or name O or name CB )))) ; 1 2 26 A LEU 186 . A ASP 215 . I LEU 186 I ASP 215 ? ;(chain 'I' and (resid 5 through 40 or (resid 41 and (name N or name CA or name C or name O or name CB )) or resid 42 through 44 or resid 46 through 48 or (resid 49 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 50 through 53 or resid 55 through 61 or resid 63 through 74 or resid 76 through 100 or resid 110 through 122 or resid 124 through 131 or resid 133 through 137 or (resid 138 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 139 through 148 or (resid 149 and (name N or name CA or name C or name O or name CB or name CG )) or resid 150 through 151 or resid 153 or (resid 154 and (name N or name CA or name C or name O or name CB )) or resid 155 or (resid 156 and (name N or name CA or name C or name O or name CB or name CG )) or resid 157 through 166 or resid 168 through 184 or resid 186 through 215 or resid 217 through 221 or resid 223 through 263 or resid 265 through 303 or (resid 304 and (name N or name CA or name C or name O or name CB )))) ; 1 2 27 A GLU 217 . A VAL 221 . I GLU 217 I VAL 221 ? ;(chain 'I' and (resid 5 through 40 or (resid 41 and (name N or name CA or name C or name O or name CB )) or resid 42 through 44 or resid 46 through 48 or (resid 49 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 50 through 53 or resid 55 through 61 or resid 63 through 74 or resid 76 through 100 or resid 110 through 122 or resid 124 through 131 or resid 133 through 137 or (resid 138 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 139 through 148 or (resid 149 and (name N or name CA or name C or name O or name CB or name CG )) or resid 150 through 151 or resid 153 or (resid 154 and (name N or name CA or name C or name O or name CB )) or resid 155 or (resid 156 and (name N or name CA or name C or name O or name CB or name CG )) or resid 157 through 166 or resid 168 through 184 or resid 186 through 215 or resid 217 through 221 or resid 223 through 263 or resid 265 through 303 or (resid 304 and (name N or name CA or name C or name O or name CB )))) ; 1 2 28 A THR 223 . A ILE 263 . I THR 223 I ILE 263 ? ;(chain 'I' and (resid 5 through 40 or (resid 41 and (name N or name CA or name C or name O or name CB )) or resid 42 through 44 or resid 46 through 48 or (resid 49 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 50 through 53 or resid 55 through 61 or resid 63 through 74 or resid 76 through 100 or resid 110 through 122 or resid 124 through 131 or resid 133 through 137 or (resid 138 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 139 through 148 or (resid 149 and (name N or name CA or name C or name O or name CB or name CG )) or resid 150 through 151 or resid 153 or (resid 154 and (name N or name CA or name C or name O or name CB )) or resid 155 or (resid 156 and (name N or name CA or name C or name O or name CB or name CG )) or resid 157 through 166 or resid 168 through 184 or resid 186 through 215 or resid 217 through 221 or resid 223 through 263 or resid 265 through 303 or (resid 304 and (name N or name CA or name C or name O or name CB )))) ; 1 2 29 A GLU 265 . A LYS 270 . I GLU 265 I LYS 270 ? ;(chain 'I' and (resid 5 through 40 or (resid 41 and (name N or name CA or name C or name O or name CB )) or resid 42 through 44 or resid 46 through 48 or (resid 49 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 50 through 53 or resid 55 through 61 or resid 63 through 74 or resid 76 through 100 or resid 110 through 122 or resid 124 through 131 or resid 133 through 137 or (resid 138 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 139 through 148 or (resid 149 and (name N or name CA or name C or name O or name CB or name CG )) or resid 150 through 151 or resid 153 or (resid 154 and (name N or name CA or name C or name O or name CB )) or resid 155 or (resid 156 and (name N or name CA or name C or name O or name CB or name CG )) or resid 157 through 166 or resid 168 through 184 or resid 186 through 215 or resid 217 through 221 or resid 223 through 263 or resid 265 through 303 or (resid 304 and (name N or name CA or name C or name O or name CB )))) ; 1 2 30 A PRO 272 . A PRO 303 . I PRO 272 I PRO 303 ? ;(chain 'I' and (resid 5 through 40 or (resid 41 and (name N or name CA or name C or name O or name CB )) or resid 42 through 44 or resid 46 through 48 or (resid 49 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 50 through 53 or resid 55 through 61 or resid 63 through 74 or resid 76 through 100 or resid 110 through 122 or resid 124 through 131 or resid 133 through 137 or (resid 138 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 139 through 148 or (resid 149 and (name N or name CA or name C or name O or name CB or name CG )) or resid 150 through 151 or resid 153 or (resid 154 and (name N or name CA or name C or name O or name CB )) or resid 155 or (resid 156 and (name N or name CA or name C or name O or name CB or name CG )) or resid 157 through 166 or resid 168 through 184 or resid 186 through 215 or resid 217 through 221 or resid 223 through 263 or resid 265 through 303 or (resid 304 and (name N or name CA or name C or name O or name CB )))) ; # _struct_ncs_ens.id 1 _struct_ncs_ens.details ? # _struct.entry_id 6W26 _struct.title 'Terpenoid Cyclase FgGS in Complex with Mg, Inorganic Pyrophosphate, and Imidazole' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6W26 _struct_keywords.text 'terpene, terpenoid, LYASE' _struct_keywords.pdbx_keywords LYASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 3 ? E N N 3 ? F N N 3 ? G N N 4 ? H N N 5 ? I N N 6 ? J N N 6 ? K N N 7 ? L N N 7 ? M N N 8 ? N N N 3 ? O N N 3 ? P N N 3 ? Q N N 4 ? R N N 5 ? S N N 6 ? T N N 7 ? U N N 8 ? V N N 9 ? W N N 9 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 12 ? PHE A 16 ? ASP I 12 PHE I 16 5 ? 5 HELX_P HELX_P2 AA2 PHE A 32 ? ILE A 51 ? PHE I 32 ILE I 51 1 ? 20 HELX_P HELX_P3 AA3 ASN A 66 ? LEU A 72 ? ASN I 66 LEU I 72 1 ? 7 HELX_P HELX_P4 AA4 ARG A 76 ? SER A 99 ? ARG I 76 SER I 99 1 ? 24 HELX_P HELX_P5 AA5 SER A 103 ? ASP A 129 ? SER I 103 ASP I 129 1 ? 27 HELX_P HELX_P6 AA6 ASP A 129 ? LYS A 151 ? ASP I 129 LYS I 151 1 ? 23 HELX_P HELX_P7 AA7 SER A 157 ? THR A 169 ? SER I 157 THR I 169 1 ? 13 HELX_P HELX_P8 AA8 GLY A 170 ? GLY A 183 ? GLY I 170 GLY I 183 1 ? 14 HELX_P HELX_P9 AA9 SER A 187 ? GLU A 220 ? SER I 187 GLU I 220 1 ? 34 HELX_P HELX_P10 AB1 ASN A 228 ? SER A 238 ? ASN I 228 SER I 238 1 ? 11 HELX_P HELX_P11 AB2 ASP A 240 ? LYS A 270 ? ASP I 240 LYS I 270 1 ? 31 HELX_P HELX_P12 AB3 SER A 274 ? CYS A 298 ? SER I 274 CYS I 298 1 ? 25 HELX_P HELX_P13 AB4 ASN A 302 ? ARG A 306 ? ASN I 302 ARG I 306 5 ? 5 HELX_P HELX_P14 AB5 ASP B 12 ? PHE B 16 ? ASP A 12 PHE A 16 5 ? 5 HELX_P HELX_P15 AB6 PHE B 32 ? ILE B 51 ? PHE A 32 ILE A 51 1 ? 20 HELX_P HELX_P16 AB7 ASN B 66 ? LEU B 72 ? ASN A 66 LEU A 72 1 ? 7 HELX_P HELX_P17 AB8 ARG B 76 ? SER B 99 ? ARG A 76 SER A 99 1 ? 24 HELX_P HELX_P18 AB9 GLU B 111 ? ASP B 129 ? GLU A 111 ASP A 129 1 ? 19 HELX_P HELX_P19 AC1 ASP B 129 ? LYS B 151 ? ASP A 129 LYS A 151 1 ? 23 HELX_P HELX_P20 AC2 SER B 157 ? THR B 169 ? SER A 157 THR A 169 1 ? 13 HELX_P HELX_P21 AC3 GLY B 170 ? GLY B 183 ? GLY A 170 GLY A 183 1 ? 14 HELX_P HELX_P22 AC4 SER B 187 ? GLU B 219 ? SER A 187 GLU A 219 1 ? 33 HELX_P HELX_P23 AC5 ASN B 228 ? SER B 238 ? ASN A 228 SER A 238 1 ? 11 HELX_P HELX_P24 AC6 ASP B 240 ? LYS B 270 ? ASP A 240 LYS A 270 1 ? 31 HELX_P HELX_P25 AC7 SER B 274 ? CYS B 298 ? SER A 274 CYS A 298 1 ? 25 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A ASP 94 OD2 ? ? ? 1_555 D MG . MG ? ? I ASP 94 I MG 402 1_555 ? ? ? ? ? ? ? 2.154 ? ? metalc2 metalc ? ? A ASP 94 OD1 ? ? ? 1_555 E MG . MG ? ? I ASP 94 I MG 403 1_555 ? ? ? ? ? ? ? 2.053 ? ? metalc3 metalc ? ? A GLU 98 OE2 ? ? ? 1_555 D MG . MG ? ? I GLU 98 I MG 402 1_555 ? ? ? ? ? ? ? 2.325 ? ? metalc4 metalc ? ? A GLU 98 OE2 ? ? ? 1_555 E MG . MG ? ? I GLU 98 I MG 403 1_555 ? ? ? ? ? ? ? 2.086 ? ? metalc5 metalc ? ? A GLU 98 OE1 ? ? ? 1_555 G NA . NA ? ? I GLU 98 I NA 405 1_555 ? ? ? ? ? ? ? 2.508 ? ? metalc6 metalc ? ? A SER 213 OG ? ? ? 1_555 F MG . MG ? ? I SER 213 I MG 404 1_555 ? ? ? ? ? ? ? 2.179 ? ? metalc7 metalc ? ? A GLU 217 OE1 ? ? ? 1_555 F MG . MG ? ? I GLU 217 I MG 404 1_555 ? ? ? ? ? ? ? 2.031 ? ? metalc8 metalc ? ? A SER 224 OG ? ? ? 1_555 G NA . NA ? ? I SER 224 I NA 405 1_555 ? ? ? ? ? ? ? 2.440 ? ? metalc9 metalc ? ? A THR 225 O ? ? ? 1_555 G NA . NA ? ? I THR 225 I NA 405 1_555 ? ? ? ? ? ? ? 2.429 ? ? metalc10 metalc ? ? D MG . MG ? ? ? 1_555 H POP . O3 ? ? I MG 402 I POP 406 1_555 ? ? ? ? ? ? ? 2.151 ? ? metalc11 metalc ? ? D MG . MG ? ? ? 1_555 H POP . O6 ? ? I MG 402 I POP 406 1_555 ? ? ? ? ? ? ? 2.147 ? ? metalc12 metalc ? ? D MG . MG ? ? ? 1_555 V HOH . O ? ? I MG 402 I HOH 528 1_555 ? ? ? ? ? ? ? 2.142 ? ? metalc13 metalc ? ? D MG . MG ? ? ? 1_555 V HOH . O ? ? I MG 402 I HOH 568 1_555 ? ? ? ? ? ? ? 2.190 ? ? metalc14 metalc ? ? E MG . MG ? ? ? 1_555 H POP . O6 ? ? I MG 403 I POP 406 1_555 ? ? ? ? ? ? ? 2.100 ? ? metalc15 metalc ? ? E MG . MG ? ? ? 1_555 V HOH . O ? ? I MG 403 I HOH 516 1_555 ? ? ? ? ? ? ? 2.105 ? ? metalc16 metalc ? ? E MG . MG ? ? ? 1_555 V HOH . O ? ? I MG 403 I HOH 525 1_555 ? ? ? ? ? ? ? 2.162 ? ? metalc17 metalc ? ? E MG . MG ? ? ? 1_555 V HOH . O ? ? I MG 403 I HOH 557 1_555 ? ? ? ? ? ? ? 1.998 ? ? metalc18 metalc ? ? F MG . MG ? ? ? 1_555 H POP . O2 ? ? I MG 404 I POP 406 1_555 ? ? ? ? ? ? ? 2.076 ? ? metalc19 metalc ? ? F MG . MG ? ? ? 1_555 H POP . O4 ? ? I MG 404 I POP 406 1_555 ? ? ? ? ? ? ? 2.138 ? ? metalc20 metalc ? ? F MG . MG ? ? ? 1_555 V HOH . O ? ? I MG 404 I HOH 531 1_555 ? ? ? ? ? ? ? 2.120 ? ? metalc21 metalc ? ? G NA . NA ? ? ? 1_555 V HOH . O ? ? I NA 405 I HOH 578 1_555 ? ? ? ? ? ? ? 2.647 ? ? metalc22 metalc ? ? G NA . NA ? ? ? 1_555 V HOH . O ? ? I NA 405 I HOH 580 1_555 ? ? ? ? ? ? ? 2.567 ? ? metalc23 metalc ? ? B ASP 94 OD1 ? ? ? 1_555 N MG . MG ? ? A ASP 94 A MG 401 1_555 ? ? ? ? ? ? ? 2.014 ? ? metalc24 metalc ? ? B ASP 94 OD2 ? ? ? 1_555 P MG . MG ? ? A ASP 94 A MG 403 1_555 ? ? ? ? ? ? ? 2.103 ? ? metalc25 metalc ? ? B GLU 98 OE2 ? ? ? 1_555 N MG . MG ? ? A GLU 98 A MG 401 1_555 ? ? ? ? ? ? ? 2.249 ? ? metalc26 metalc ? ? B GLU 98 OE2 ? ? ? 1_555 P MG . MG ? ? A GLU 98 A MG 403 1_555 ? ? ? ? ? ? ? 2.032 ? ? metalc27 metalc ? ? B GLU 98 OE1 ? ? ? 1_555 Q NA . NA ? ? A GLU 98 A NA 404 1_555 ? ? ? ? ? ? ? 2.535 ? ? metalc28 metalc ? ? B SER 213 OG ? ? ? 1_555 O MG . MG ? ? A SER 213 A MG 402 1_555 ? ? ? ? ? ? ? 2.245 ? ? metalc29 metalc ? ? B GLU 217 OE2 ? ? ? 1_555 O MG . MG ? ? A GLU 217 A MG 402 1_555 ? ? ? ? ? ? ? 2.015 ? ? metalc30 metalc ? ? B THR 225 O ? ? ? 1_555 Q NA . NA ? ? A THR 225 A NA 404 1_555 ? ? ? ? ? ? ? 2.504 ? ? metalc31 metalc ? ? N MG . MG ? ? ? 1_555 R POP . O2 ? ? A MG 401 A POP 405 1_555 ? ? ? ? ? ? ? 2.050 ? ? metalc32 metalc ? ? N MG . MG ? ? ? 1_555 W HOH . O ? ? A MG 401 A HOH 503 1_555 ? ? ? ? ? ? ? 2.003 ? ? metalc33 metalc ? ? N MG . MG ? ? ? 1_555 W HOH . O ? ? A MG 401 A HOH 514 1_555 ? ? ? ? ? ? ? 2.105 ? ? metalc34 metalc ? ? N MG . MG ? ? ? 1_555 W HOH . O ? ? A MG 401 A HOH 534 1_555 ? ? ? ? ? ? ? 2.137 ? ? metalc35 metalc ? ? O MG . MG ? ? ? 1_555 R POP . O3 ? ? A MG 402 A POP 405 1_555 ? ? ? ? ? ? ? 2.131 ? ? metalc36 metalc ? ? O MG . MG ? ? ? 1_555 R POP . O6 ? ? A MG 402 A POP 405 1_555 ? ? ? ? ? ? ? 2.099 ? ? metalc37 metalc ? ? O MG . MG ? ? ? 1_555 W HOH . O ? ? A MG 402 A HOH 530 1_555 ? ? ? ? ? ? ? 2.055 ? ? metalc38 metalc ? ? P MG . MG ? ? ? 1_555 R POP . O2 ? ? A MG 403 A POP 405 1_555 ? ? ? ? ? ? ? 1.981 ? ? metalc39 metalc ? ? P MG . MG ? ? ? 1_555 R POP . O5 ? ? A MG 403 A POP 405 1_555 ? ? ? ? ? ? ? 2.061 ? ? metalc40 metalc ? ? P MG . MG ? ? ? 1_555 W HOH . O ? ? A MG 403 A HOH 526 1_555 ? ? ? ? ? ? ? 2.116 ? ? metalc41 metalc ? ? P MG . MG ? ? ? 1_555 W HOH . O ? ? A MG 403 A HOH 550 1_555 ? ? ? ? ? ? ? 2.346 ? ? metalc42 metalc ? ? Q NA . NA ? ? ? 1_555 W HOH . O ? ? A NA 404 A HOH 519 1_555 ? ? ? ? ? ? ? 2.395 ? ? metalc43 metalc ? ? Q NA . NA ? ? ? 1_555 W HOH . O ? ? A NA 404 A HOH 549 1_555 ? ? ? ? ? ? ? 2.427 ? ? metalc44 metalc ? ? Q NA . NA ? ? ? 1_555 W HOH . O ? ? A NA 404 A HOH 563 1_555 ? ? ? ? ? ? ? 2.727 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id GLY _struct_mon_prot_cis.label_seq_id 271 _struct_mon_prot_cis.label_asym_id B _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id GLY _struct_mon_prot_cis.auth_seq_id 271 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 272 _struct_mon_prot_cis.pdbx_label_asym_id_2 B _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 272 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -9.70 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 2 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 SER A 8 ? VAL A 11 ? SER I 8 VAL I 11 AA1 2 LEU A 27 ? HIS A 30 ? LEU I 27 HIS I 30 AA2 1 SER B 8 ? VAL B 11 ? SER A 8 VAL A 11 AA2 2 LEU B 27 ? HIS B 30 ? LEU A 27 HIS A 30 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ASP A 9 ? N ASP I 9 O ARG A 29 ? O ARG I 29 AA2 1 2 N VAL B 11 ? N VAL A 11 O LEU B 27 ? O LEU A 27 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software I SO4 401 ? 6 'binding site for residue SO4 I 401' AC2 Software I MG 402 ? 6 'binding site for residue MG I 402' AC3 Software I MG 403 ? 7 'binding site for residue MG I 403' AC4 Software I MG 404 ? 6 'binding site for residue MG I 404' AC5 Software I NA 405 ? 5 'binding site for residue NA I 405' AC6 Software I POP 406 ? 20 'binding site for residue POP I 406' AC7 Software I IMD 407 ? 7 'binding site for residue IMD I 407' AC8 Software I IMD 408 ? 7 'binding site for residue IMD I 408' AC9 Software I EDO 409 ? 6 'binding site for residue EDO I 409' AD1 Software I EDO 410 ? 5 'binding site for residue EDO I 410' AD2 Software I GOL 411 ? 2 'binding site for residue GOL I 411' AD3 Software A MG 401 ? 7 'binding site for residue MG A 401' AD4 Software A MG 402 ? 6 'binding site for residue MG A 402' AD5 Software A MG 403 ? 6 'binding site for residue MG A 403' AD6 Software A NA 404 ? 6 'binding site for residue NA A 404' AD7 Software A POP 405 ? 18 'binding site for residue POP A 405' AD8 Software A IMD 406 ? 6 'binding site for residue IMD A 406' AD9 Software A EDO 407 ? 5 'binding site for residue EDO A 407' AE1 Software A GOL 408 ? 1 'binding site for residue GOL A 408' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 SER B 274 ? SER A 274 . ? 2_455 ? 2 AC1 6 ASN B 275 ? ASN A 275 . ? 2_455 ? 3 AC1 6 ARG A 199 ? ARG I 199 . ? 1_555 ? 4 AC1 6 ARG A 262 ? ARG I 262 . ? 1_555 ? 5 AC1 6 HOH V . ? HOH I 506 . ? 1_555 ? 6 AC1 6 HOH V . ? HOH I 577 . ? 1_555 ? 7 AC2 6 ASP A 94 ? ASP I 94 . ? 1_555 ? 8 AC2 6 GLU A 98 ? GLU I 98 . ? 1_555 ? 9 AC2 6 MG E . ? MG I 403 . ? 1_555 ? 10 AC2 6 POP H . ? POP I 406 . ? 1_555 ? 11 AC2 6 HOH V . ? HOH I 528 . ? 1_555 ? 12 AC2 6 HOH V . ? HOH I 568 . ? 1_555 ? 13 AC3 7 ASP A 94 ? ASP I 94 . ? 1_555 ? 14 AC3 7 GLU A 98 ? GLU I 98 . ? 1_555 ? 15 AC3 7 MG D . ? MG I 402 . ? 1_555 ? 16 AC3 7 POP H . ? POP I 406 . ? 1_555 ? 17 AC3 7 HOH V . ? HOH I 516 . ? 1_555 ? 18 AC3 7 HOH V . ? HOH I 525 . ? 1_555 ? 19 AC3 7 HOH V . ? HOH I 557 . ? 1_555 ? 20 AC4 6 ARG A 165 ? ARG I 165 . ? 1_555 ? 21 AC4 6 ASN A 209 ? ASN I 209 . ? 1_555 ? 22 AC4 6 SER A 213 ? SER I 213 . ? 1_555 ? 23 AC4 6 GLU A 217 ? GLU I 217 . ? 1_555 ? 24 AC4 6 POP H . ? POP I 406 . ? 1_555 ? 25 AC4 6 HOH V . ? HOH I 531 . ? 1_555 ? 26 AC5 5 GLU A 98 ? GLU I 98 . ? 1_555 ? 27 AC5 5 SER A 224 ? SER I 224 . ? 1_555 ? 28 AC5 5 THR A 225 ? THR I 225 . ? 1_555 ? 29 AC5 5 HOH V . ? HOH I 578 . ? 1_555 ? 30 AC5 5 HOH V . ? HOH I 580 . ? 1_555 ? 31 AC6 20 ASP A 94 ? ASP I 94 . ? 1_555 ? 32 AC6 20 GLU A 98 ? GLU I 98 . ? 1_555 ? 33 AC6 20 ARG A 165 ? ARG I 165 . ? 1_555 ? 34 AC6 20 THR A 169 ? THR I 169 . ? 1_555 ? 35 AC6 20 ASN A 209 ? ASN I 209 . ? 1_555 ? 36 AC6 20 SER A 213 ? SER I 213 . ? 1_555 ? 37 AC6 20 ARG A 216 ? ARG I 216 . ? 1_555 ? 38 AC6 20 GLU A 217 ? GLU I 217 . ? 1_555 ? 39 AC6 20 ARG A 300 ? ARG I 300 . ? 1_555 ? 40 AC6 20 TYR A 301 ? TYR I 301 . ? 1_555 ? 41 AC6 20 MG D . ? MG I 402 . ? 1_555 ? 42 AC6 20 MG E . ? MG I 403 . ? 1_555 ? 43 AC6 20 MG F . ? MG I 404 . ? 1_555 ? 44 AC6 20 IMD I . ? IMD I 407 . ? 1_555 ? 45 AC6 20 HOH V . ? HOH I 525 . ? 1_555 ? 46 AC6 20 HOH V . ? HOH I 528 . ? 1_555 ? 47 AC6 20 HOH V . ? HOH I 531 . ? 1_555 ? 48 AC6 20 HOH V . ? HOH I 551 . ? 1_555 ? 49 AC6 20 HOH V . ? HOH I 557 . ? 1_555 ? 50 AC6 20 HOH V . ? HOH I 568 . ? 1_555 ? 51 AC7 7 PHE A 91 ? PHE I 91 . ? 1_555 ? 52 AC7 7 THR A 169 ? THR I 169 . ? 1_555 ? 53 AC7 7 ASN A 209 ? ASN I 209 . ? 1_555 ? 54 AC7 7 TYR A 301 ? TYR I 301 . ? 1_555 ? 55 AC7 7 POP H . ? POP I 406 . ? 1_555 ? 56 AC7 7 GOL M . ? GOL I 411 . ? 1_555 ? 57 AC7 7 HOH V . ? HOH I 601 . ? 1_555 ? 58 AC8 7 GLU B 130 ? GLU A 130 . ? 3_544 ? 59 AC8 7 LYS A 151 ? LYS I 151 . ? 1_555 ? 60 AC8 7 ASN A 152 ? ASN I 152 . ? 1_555 ? 61 AC8 7 VAL A 153 ? VAL I 153 . ? 1_555 ? 62 AC8 7 ASP A 154 ? ASP I 154 . ? 1_555 ? 63 AC8 7 THR A 225 ? THR I 225 . ? 1_555 ? 64 AC8 7 LEU A 226 ? LEU I 226 . ? 1_555 ? 65 AC9 6 HIS B 269 ? HIS A 269 . ? 2_455 ? 66 AC9 6 LYS B 270 ? LYS A 270 . ? 2_455 ? 67 AC9 6 THR A 146 ? THR I 146 . ? 1_555 ? 68 AC9 6 ILE A 167 ? ILE I 167 . ? 1_555 ? 69 AC9 6 HOH V . ? HOH I 502 . ? 1_555 ? 70 AC9 6 HOH V . ? HOH I 563 . ? 1_555 ? 71 AD1 5 ALA A 23 ? ALA I 23 . ? 1_555 ? 72 AD1 5 VAL A 48 ? VAL I 48 . ? 1_455 ? 73 AD1 5 GLN A 253 ? GLN I 253 . ? 1_555 ? 74 AD1 5 ARG A 257 ? ARG I 257 . ? 1_555 ? 75 AD1 5 HOH V . ? HOH I 595 . ? 1_555 ? 76 AD2 2 THR A 169 ? THR I 169 . ? 1_555 ? 77 AD2 2 IMD I . ? IMD I 407 . ? 1_555 ? 78 AD3 7 ASP B 94 ? ASP A 94 . ? 1_555 ? 79 AD3 7 GLU B 98 ? GLU A 98 . ? 1_555 ? 80 AD3 7 MG P . ? MG A 403 . ? 1_555 ? 81 AD3 7 POP R . ? POP A 405 . ? 1_555 ? 82 AD3 7 HOH W . ? HOH A 503 . ? 1_555 ? 83 AD3 7 HOH W . ? HOH A 514 . ? 1_555 ? 84 AD3 7 HOH W . ? HOH A 534 . ? 1_555 ? 85 AD4 6 ARG B 165 ? ARG A 165 . ? 1_555 ? 86 AD4 6 ASN B 209 ? ASN A 209 . ? 1_555 ? 87 AD4 6 SER B 213 ? SER A 213 . ? 1_555 ? 88 AD4 6 GLU B 217 ? GLU A 217 . ? 1_555 ? 89 AD4 6 POP R . ? POP A 405 . ? 1_555 ? 90 AD4 6 HOH W . ? HOH A 530 . ? 1_555 ? 91 AD5 6 ASP B 94 ? ASP A 94 . ? 1_555 ? 92 AD5 6 GLU B 98 ? GLU A 98 . ? 1_555 ? 93 AD5 6 MG N . ? MG A 401 . ? 1_555 ? 94 AD5 6 POP R . ? POP A 405 . ? 1_555 ? 95 AD5 6 HOH W . ? HOH A 526 . ? 1_555 ? 96 AD5 6 HOH W . ? HOH A 550 . ? 1_555 ? 97 AD6 6 GLU B 98 ? GLU A 98 . ? 1_555 ? 98 AD6 6 SER B 224 ? SER A 224 . ? 1_555 ? 99 AD6 6 THR B 225 ? THR A 225 . ? 1_555 ? 100 AD6 6 HOH W . ? HOH A 519 . ? 1_555 ? 101 AD6 6 HOH W . ? HOH A 549 . ? 1_555 ? 102 AD6 6 HOH W . ? HOH A 563 . ? 1_555 ? 103 AD7 18 ASP B 94 ? ASP A 94 . ? 1_555 ? 104 AD7 18 GLU B 98 ? GLU A 98 . ? 1_555 ? 105 AD7 18 ARG B 165 ? ARG A 165 . ? 1_555 ? 106 AD7 18 THR B 169 ? THR A 169 . ? 1_555 ? 107 AD7 18 ASN B 209 ? ASN A 209 . ? 1_555 ? 108 AD7 18 SER B 213 ? SER A 213 . ? 1_555 ? 109 AD7 18 ARG B 216 ? ARG A 216 . ? 1_555 ? 110 AD7 18 GLU B 217 ? GLU A 217 . ? 1_555 ? 111 AD7 18 ARG B 300 ? ARG A 300 . ? 1_555 ? 112 AD7 18 TYR B 301 ? TYR A 301 . ? 1_555 ? 113 AD7 18 MG N . ? MG A 401 . ? 1_555 ? 114 AD7 18 MG O . ? MG A 402 . ? 1_555 ? 115 AD7 18 MG P . ? MG A 403 . ? 1_555 ? 116 AD7 18 IMD S . ? IMD A 406 . ? 1_555 ? 117 AD7 18 HOH W . ? HOH A 514 . ? 1_555 ? 118 AD7 18 HOH W . ? HOH A 523 . ? 1_555 ? 119 AD7 18 HOH W . ? HOH A 526 . ? 1_555 ? 120 AD7 18 HOH W . ? HOH A 530 . ? 1_555 ? 121 AD8 6 PHE B 91 ? PHE A 91 . ? 1_555 ? 122 AD8 6 THR B 169 ? THR A 169 . ? 1_555 ? 123 AD8 6 ASN B 209 ? ASN A 209 . ? 1_555 ? 124 AD8 6 TYR B 301 ? TYR A 301 . ? 1_555 ? 125 AD8 6 POP R . ? POP A 405 . ? 1_555 ? 126 AD8 6 EDO T . ? EDO A 407 . ? 1_555 ? 127 AD9 5 PHE B 67 ? PHE A 67 . ? 1_555 ? 128 AD9 5 VAL B 174 ? VAL A 174 . ? 1_555 ? 129 AD9 5 GLN B 287 ? GLN A 287 . ? 1_555 ? 130 AD9 5 ASN B 291 ? ASN A 291 . ? 1_555 ? 131 AD9 5 IMD S . ? IMD A 406 . ? 1_555 ? 132 AE1 1 ALA B 90 ? ALA A 90 . ? 1_555 ? # _atom_sites.entry_id 6W26 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.020467 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011468 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006108 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? MG ? ? 9.41153 2.53737 ? ? 2.59044 63.03566 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? NA ? ? 9.38062 1.54875 ? ? 3.38349 72.32734 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? P ? ? 9.51135 5.44231 ? ? 1.42069 35.72801 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? I . n A 1 2 ASP 2 2 ? ? ? I . n A 1 3 PRO 3 3 ? ? ? I . n A 1 4 TYR 4 4 ? ? ? I . n A 1 5 SER 5 5 5 SER SER I . n A 1 6 GLU 6 6 6 GLU GLU I . n A 1 7 THR 7 7 7 THR THR I . n A 1 8 SER 8 8 8 SER SER I . n A 1 9 ASP 9 9 9 ASP ASP I . n A 1 10 LEU 10 10 10 LEU LEU I . n A 1 11 VAL 11 11 11 VAL VAL I . n A 1 12 ASP 12 12 12 ASP ASP I . n A 1 13 ILE 13 13 13 ILE ILE I . n A 1 14 SER 14 14 14 SER SER I . n A 1 15 ARG 15 15 15 ARG ARG I . n A 1 16 PHE 16 16 16 PHE PHE I . n A 1 17 ASP 17 17 17 ASP ASP I . n A 1 18 THR 18 18 18 THR THR I . n A 1 19 HIS 19 19 19 HIS HIS I . n A 1 20 GLY 20 20 20 GLY GLY I . n A 1 21 LEU 21 21 21 LEU LEU I . n A 1 22 GLY 22 22 22 GLY GLY I . n A 1 23 ALA 23 23 23 ALA ALA I . n A 1 24 ASN 24 24 24 ASN ASN I . n A 1 25 TYR 25 25 25 TYR TYR I . n A 1 26 LYS 26 26 26 LYS LYS I . n A 1 27 LEU 27 27 27 LEU LEU I . n A 1 28 ARG 28 28 28 ARG ARG I . n A 1 29 ARG 29 29 29 ARG ARG I . n A 1 30 HIS 30 30 30 HIS HIS I . n A 1 31 LYS 31 31 31 LYS LYS I . n A 1 32 PHE 32 32 32 PHE PHE I . n A 1 33 GLU 33 33 33 GLU GLU I . n A 1 34 HIS 34 34 34 HIS HIS I . n A 1 35 LEU 35 35 35 LEU LEU I . n A 1 36 ALA 36 36 36 ALA ALA I . n A 1 37 ASP 37 37 37 ASP ASP I . n A 1 38 THR 38 38 38 THR THR I . n A 1 39 GLY 39 39 39 GLY GLY I . n A 1 40 CYS 40 40 40 CYS CYS I . n A 1 41 HIS 41 41 41 HIS HIS I . n A 1 42 LYS 42 42 42 LYS LYS I . n A 1 43 ALA 43 43 43 ALA ALA I . n A 1 44 ARG 44 44 44 ARG ARG I . n A 1 45 SER 45 45 45 SER SER I . n A 1 46 ASP 46 46 46 ASP ASP I . n A 1 47 TRP 47 47 47 TRP TRP I . n A 1 48 VAL 48 48 48 VAL VAL I . n A 1 49 LYS 49 49 49 LYS LYS I . n A 1 50 TYR 50 50 50 TYR TYR I . n A 1 51 ILE 51 51 51 ILE ILE I . n A 1 52 GLY 52 52 52 GLY GLY I . n A 1 53 PRO 53 53 53 PRO PRO I . n A 1 54 LEU 54 54 54 LEU LEU I . n A 1 55 THR 55 55 55 THR THR I . n A 1 56 GLU 56 56 56 GLU GLU I . n A 1 57 PHE 57 57 57 PHE PHE I . n A 1 58 GLY 58 58 58 GLY GLY I . n A 1 59 GLY 59 59 59 GLY GLY I . n A 1 60 CYS 60 60 60 CYS CYS I . n A 1 61 ASN 61 61 61 ASN ASN I . n A 1 62 HIS 62 62 62 HIS HIS I . n A 1 63 ILE 63 63 63 ILE ILE I . n A 1 64 ASN 64 64 64 ASN ASN I . n A 1 65 GLY 65 65 65 GLY GLY I . n A 1 66 ASN 66 66 66 ASN ASN I . n A 1 67 PHE 67 67 67 PHE PHE I . n A 1 68 SER 68 68 68 SER SER I . n A 1 69 ALA 69 69 69 ALA ALA I . n A 1 70 VAL 70 70 70 VAL VAL I . n A 1 71 VAL 71 71 71 VAL VAL I . n A 1 72 LEU 72 72 72 LEU LEU I . n A 1 73 PRO 73 73 73 PRO PRO I . n A 1 74 LEU 74 74 74 LEU LEU I . n A 1 75 CYS 75 75 75 CYS CYS I . n A 1 76 ARG 76 76 76 ARG ARG I . n A 1 77 PRO 77 77 77 PRO PRO I . n A 1 78 ASP 78 78 78 ASP ASP I . n A 1 79 ARG 79 79 79 ARG ARG I . n A 1 80 LEU 80 80 80 LEU LEU I . n A 1 81 GLU 81 81 81 GLU GLU I . n A 1 82 LEU 82 82 82 LEU LEU I . n A 1 83 ILE 83 83 83 ILE ILE I . n A 1 84 ALA 84 84 84 ALA ALA I . n A 1 85 TYR 85 85 85 TYR TYR I . n A 1 86 VAL 86 86 86 VAL VAL I . n A 1 87 LEU 87 87 87 LEU LEU I . n A 1 88 GLU 88 88 88 GLU GLU I . n A 1 89 PHE 89 89 89 PHE PHE I . n A 1 90 ALA 90 90 90 ALA ALA I . n A 1 91 PHE 91 91 91 PHE PHE I . n A 1 92 LEU 92 92 92 LEU LEU I . n A 1 93 HIS 93 93 93 HIS HIS I . n A 1 94 ASP 94 94 94 ASP ASP I . n A 1 95 SER 95 95 95 SER SER I . n A 1 96 VAL 96 96 96 VAL VAL I . n A 1 97 LEU 97 97 97 LEU LEU I . n A 1 98 GLU 98 98 98 GLU GLU I . n A 1 99 SER 99 99 99 SER SER I . n A 1 100 GLU 100 100 100 GLU GLU I . n A 1 101 ASN 101 101 101 ASN ASN I . n A 1 102 THR 102 102 102 THR THR I . n A 1 103 SER 103 103 103 SER SER I . n A 1 104 PRO 104 104 104 PRO PRO I . n A 1 105 GLU 105 105 105 GLU GLU I . n A 1 106 SER 106 106 106 SER SER I . n A 1 107 GLU 107 107 107 GLU GLU I . n A 1 108 VAL 108 108 108 VAL VAL I . n A 1 109 GLN 109 109 109 GLN GLN I . n A 1 110 ALA 110 110 110 ALA ALA I . n A 1 111 GLU 111 111 111 GLU GLU I . n A 1 112 ALA 112 112 112 ALA ALA I . n A 1 113 GLY 113 113 113 GLY GLY I . n A 1 114 LEU 114 114 114 LEU LEU I . n A 1 115 ARG 115 115 115 ARG ARG I . n A 1 116 LEU 116 116 116 LEU LEU I . n A 1 117 LEU 117 117 117 LEU LEU I . n A 1 118 TYR 118 118 118 TYR TYR I . n A 1 119 GLU 119 119 119 GLU GLU I . n A 1 120 ARG 120 120 120 ARG ARG I . n A 1 121 CYS 121 121 121 CYS CYS I . n A 1 122 ILE 122 122 122 ILE ILE I . n A 1 123 SER 123 123 123 SER SER I . n A 1 124 ARG 124 124 124 ARG ARG I . n A 1 125 LEU 125 125 125 LEU LEU I . n A 1 126 LEU 126 126 126 LEU LEU I . n A 1 127 GLN 127 127 127 GLN GLN I . n A 1 128 THR 128 128 128 THR THR I . n A 1 129 ASP 129 129 129 ASP ASP I . n A 1 130 GLU 130 130 130 GLU GLU I . n A 1 131 VAL 131 131 131 VAL VAL I . n A 1 132 CYS 132 132 132 CYS CYS I . n A 1 133 ALA 133 133 133 ALA ALA I . n A 1 134 LYS 134 134 134 LYS LYS I . n A 1 135 LYS 135 135 135 LYS LYS I . n A 1 136 ILE 136 136 136 ILE ILE I . n A 1 137 ALA 137 137 137 ALA ALA I . n A 1 138 LYS 138 138 138 LYS LYS I . n A 1 139 THR 139 139 139 THR THR I . n A 1 140 TRP 140 140 140 TRP TRP I . n A 1 141 LYS 141 141 141 LYS LYS I . n A 1 142 ASP 142 142 142 ASP ASP I . n A 1 143 ALA 143 143 143 ALA ALA I . n A 1 144 ILE 144 144 144 ILE ILE I . n A 1 145 ASN 145 145 145 ASN ASN I . n A 1 146 THR 146 146 146 THR THR I . n A 1 147 THR 147 147 147 THR THR I . n A 1 148 THR 148 148 148 THR THR I . n A 1 149 LYS 149 149 149 LYS LYS I . n A 1 150 ASP 150 150 150 ASP ASP I . n A 1 151 LYS 151 151 151 LYS LYS I . n A 1 152 ASN 152 152 152 ASN ASN I . n A 1 153 VAL 153 153 153 VAL VAL I . n A 1 154 ASP 154 154 154 ASP ASP I . n A 1 155 PHE 155 155 155 PHE PHE I . n A 1 156 GLN 156 156 156 GLN GLN I . n A 1 157 SER 157 157 157 SER SER I . n A 1 158 ILE 158 158 158 ILE ILE I . n A 1 159 GLU 159 159 159 GLU GLU I . n A 1 160 ASP 160 160 160 ASP ASP I . n A 1 161 TYR 161 161 161 TYR TYR I . n A 1 162 LEU 162 162 162 LEU LEU I . n A 1 163 GLU 163 163 163 GLU GLU I . n A 1 164 PHE 164 164 164 PHE PHE I . n A 1 165 ARG 165 165 165 ARG ARG I . n A 1 166 MET 166 166 166 MET MET I . n A 1 167 ILE 167 167 167 ILE ILE I . n A 1 168 ASP 168 168 168 ASP ASP I . n A 1 169 THR 169 169 169 THR THR I . n A 1 170 GLY 170 170 170 GLY GLY I . n A 1 171 ALA 171 171 171 ALA ALA I . n A 1 172 PRO 172 172 172 PRO PRO I . n A 1 173 PHE 173 173 173 PHE PHE I . n A 1 174 VAL 174 174 174 VAL VAL I . n A 1 175 GLU 175 175 175 GLU GLU I . n A 1 176 ALA 176 176 176 ALA ALA I . n A 1 177 LEU 177 177 177 LEU LEU I . n A 1 178 MET 178 178 178 MET MET I . n A 1 179 LEU 179 179 179 LEU LEU I . n A 1 180 PHE 180 180 180 PHE PHE I . n A 1 181 GLY 181 181 181 GLY GLY I . n A 1 182 LEU 182 182 182 LEU LEU I . n A 1 183 GLY 183 183 183 GLY GLY I . n A 1 184 MET 184 184 184 MET MET I . n A 1 185 SER 185 185 185 SER SER I . n A 1 186 LEU 186 186 186 LEU LEU I . n A 1 187 SER 187 187 187 SER SER I . n A 1 188 PRO 188 188 188 PRO PRO I . n A 1 189 GLN 189 189 189 GLN GLN I . n A 1 190 GLU 190 190 190 GLU GLU I . n A 1 191 ASP 191 191 191 ASP ASP I . n A 1 192 ASP 192 192 192 ASP ASP I . n A 1 193 ALA 193 193 193 ALA ALA I . n A 1 194 LEU 194 194 194 LEU LEU I . n A 1 195 GLY 195 195 195 GLY GLY I . n A 1 196 HIS 196 196 196 HIS HIS I . n A 1 197 VAL 197 197 197 VAL VAL I . n A 1 198 ILE 198 198 198 ILE ILE I . n A 1 199 ARG 199 199 199 ARG ARG I . n A 1 200 PRO 200 200 200 PRO PRO I . n A 1 201 CYS 201 201 201 CYS CYS I . n A 1 202 PHE 202 202 202 PHE PHE I . n A 1 203 ALA 203 203 203 ALA ALA I . n A 1 204 ALA 204 204 204 ALA ALA I . n A 1 205 LEU 205 205 205 LEU LEU I . n A 1 206 ALA 206 206 206 ALA ALA I . n A 1 207 LEU 207 207 207 LEU LEU I . n A 1 208 THR 208 208 208 THR THR I . n A 1 209 ASN 209 209 209 ASN ASN I . n A 1 210 ASP 210 210 210 ASP ASP I . n A 1 211 TYR 211 211 211 TYR TYR I . n A 1 212 PHE 212 212 212 PHE PHE I . n A 1 213 SER 213 213 213 SER SER I . n A 1 214 PHE 214 214 214 PHE PHE I . n A 1 215 ASP 215 215 215 ASP ASP I . n A 1 216 ARG 216 216 216 ARG ARG I . n A 1 217 GLU 217 217 217 GLU GLU I . n A 1 218 ILE 218 218 218 ILE ILE I . n A 1 219 GLU 219 219 219 GLU GLU I . n A 1 220 GLU 220 220 220 GLU GLU I . n A 1 221 VAL 221 221 221 VAL VAL I . n A 1 222 ASP 222 222 222 ASP ASP I . n A 1 223 THR 223 223 223 THR THR I . n A 1 224 SER 224 224 224 SER SER I . n A 1 225 THR 225 225 225 THR THR I . n A 1 226 LEU 226 226 226 LEU LEU I . n A 1 227 ILE 227 227 227 ILE ILE I . n A 1 228 ASN 228 228 228 ASN ASN I . n A 1 229 SER 229 229 229 SER SER I . n A 1 230 VAL 230 230 230 VAL VAL I . n A 1 231 ALA 231 231 231 ALA ALA I . n A 1 232 ILE 232 232 232 ILE ILE I . n A 1 233 VAL 233 233 233 VAL VAL I . n A 1 234 MET 234 234 234 MET MET I . n A 1 235 ARG 235 235 235 ARG ARG I . n A 1 236 ILE 236 236 236 ILE ILE I . n A 1 237 GLN 237 237 237 GLN GLN I . n A 1 238 SER 238 238 238 SER SER I . n A 1 239 LEU 239 239 239 LEU LEU I . n A 1 240 ASP 240 240 240 ASP ASP I . n A 1 241 ILE 241 241 241 ILE ILE I . n A 1 242 PRO 242 242 242 PRO PRO I . n A 1 243 THR 243 243 243 THR THR I . n A 1 244 ALA 244 244 244 ALA ALA I . n A 1 245 LYS 245 245 245 LYS LYS I . n A 1 246 THR 246 246 246 THR THR I . n A 1 247 ILE 247 247 247 ILE ILE I . n A 1 248 ILE 248 248 248 ILE ILE I . n A 1 249 ASN 249 249 249 ASN ASN I . n A 1 250 GLU 250 250 250 GLU GLU I . n A 1 251 THR 251 251 251 THR THR I . n A 1 252 ILE 252 252 252 ILE ILE I . n A 1 253 GLN 253 253 253 GLN GLN I . n A 1 254 LYS 254 254 254 LYS LYS I . n A 1 255 TYR 255 255 255 TYR TYR I . n A 1 256 GLU 256 256 256 GLU GLU I . n A 1 257 ARG 257 257 257 ARG ARG I . n A 1 258 GLU 258 258 258 GLU GLU I . n A 1 259 PHE 259 259 259 PHE PHE I . n A 1 260 LEU 260 260 260 LEU LEU I . n A 1 261 ARG 261 261 261 ARG ARG I . n A 1 262 ARG 262 262 262 ARG ARG I . n A 1 263 ILE 263 263 263 ILE ILE I . n A 1 264 ASP 264 264 264 ASP ASP I . n A 1 265 GLU 265 265 265 GLU GLU I . n A 1 266 TYR 266 266 266 TYR TYR I . n A 1 267 LYS 267 267 267 LYS LYS I . n A 1 268 GLN 268 268 268 GLN GLN I . n A 1 269 HIS 269 269 269 HIS HIS I . n A 1 270 LYS 270 270 270 LYS LYS I . n A 1 271 GLY 271 271 ? ? ? I . n A 1 272 PRO 272 272 272 PRO PRO I . n A 1 273 ILE 273 273 273 ILE ILE I . n A 1 274 SER 274 274 274 SER SER I . n A 1 275 ASN 275 275 275 ASN ASN I . n A 1 276 LYS 276 276 276 LYS LYS I . n A 1 277 ILE 277 277 277 ILE ILE I . n A 1 278 GLU 278 278 278 GLU GLU I . n A 1 279 GLN 279 279 279 GLN GLN I . n A 1 280 TYR 280 280 280 TYR TYR I . n A 1 281 MET 281 281 281 MET MET I . n A 1 282 GLU 282 282 282 GLU GLU I . n A 1 283 ALA 283 283 283 ALA ALA I . n A 1 284 MET 284 284 284 MET MET I . n A 1 285 THR 285 285 285 THR THR I . n A 1 286 TYR 286 286 286 TYR TYR I . n A 1 287 GLN 287 287 287 GLN GLN I . n A 1 288 ILE 288 288 288 ILE ILE I . n A 1 289 SER 289 289 289 SER SER I . n A 1 290 GLY 290 290 290 GLY GLY I . n A 1 291 ASN 291 291 291 ASN ASN I . n A 1 292 LEU 292 292 292 LEU LEU I . n A 1 293 VAL 293 293 293 VAL VAL I . n A 1 294 TRP 294 294 294 TRP TRP I . n A 1 295 SER 295 295 295 SER SER I . n A 1 296 LEU 296 296 296 LEU LEU I . n A 1 297 ASN 297 297 297 ASN ASN I . n A 1 298 CYS 298 298 298 CYS CYS I . n A 1 299 PRO 299 299 299 PRO PRO I . n A 1 300 ARG 300 300 300 ARG ARG I . n A 1 301 TYR 301 301 301 TYR TYR I . n A 1 302 ASN 302 302 302 ASN ASN I . n A 1 303 PRO 303 303 303 PRO PRO I . n A 1 304 ASP 304 304 304 ASP ASP I . n A 1 305 TYR 305 305 305 TYR TYR I . n A 1 306 ARG 306 306 306 ARG ARG I . n A 1 307 TYR 307 307 307 TYR TYR I . n A 1 308 GLY 308 308 308 GLY GLY I . n A 1 309 LEU 309 309 ? ? ? I . n A 1 310 GLU 310 310 ? ? ? I . n A 1 311 ALA 311 311 ? ? ? I . n A 1 312 CYS 312 312 ? ? ? I . n A 1 313 GLN 313 313 ? ? ? I . n A 1 314 HIS 314 314 ? ? ? I . n A 1 315 GLU 315 315 ? ? ? I . n A 1 316 GLY 316 316 ? ? ? I . n B 1 1 MET 1 1 ? ? ? A . n B 1 2 ASP 2 2 ? ? ? A . n B 1 3 PRO 3 3 ? ? ? A . n B 1 4 TYR 4 4 4 TYR TYR A . n B 1 5 SER 5 5 5 SER SER A . n B 1 6 GLU 6 6 6 GLU GLU A . n B 1 7 THR 7 7 7 THR THR A . n B 1 8 SER 8 8 8 SER SER A . n B 1 9 ASP 9 9 9 ASP ASP A . n B 1 10 LEU 10 10 10 LEU LEU A . n B 1 11 VAL 11 11 11 VAL VAL A . n B 1 12 ASP 12 12 12 ASP ASP A . n B 1 13 ILE 13 13 13 ILE ILE A . n B 1 14 SER 14 14 14 SER SER A . n B 1 15 ARG 15 15 15 ARG ARG A . n B 1 16 PHE 16 16 16 PHE PHE A . n B 1 17 ASP 17 17 17 ASP ASP A . n B 1 18 THR 18 18 18 THR THR A . n B 1 19 HIS 19 19 19 HIS HIS A . n B 1 20 GLY 20 20 20 GLY GLY A . n B 1 21 LEU 21 21 21 LEU LEU A . n B 1 22 GLY 22 22 22 GLY GLY A . n B 1 23 ALA 23 23 23 ALA ALA A . n B 1 24 ASN 24 24 24 ASN ASN A . n B 1 25 TYR 25 25 25 TYR TYR A . n B 1 26 LYS 26 26 26 LYS LYS A . n B 1 27 LEU 27 27 27 LEU LEU A . n B 1 28 ARG 28 28 28 ARG ARG A . n B 1 29 ARG 29 29 29 ARG ARG A . n B 1 30 HIS 30 30 30 HIS HIS A . n B 1 31 LYS 31 31 31 LYS LYS A . n B 1 32 PHE 32 32 32 PHE PHE A . n B 1 33 GLU 33 33 33 GLU GLU A . n B 1 34 HIS 34 34 34 HIS HIS A . n B 1 35 LEU 35 35 35 LEU LEU A . n B 1 36 ALA 36 36 36 ALA ALA A . n B 1 37 ASP 37 37 37 ASP ASP A . n B 1 38 THR 38 38 38 THR THR A . n B 1 39 GLY 39 39 39 GLY GLY A . n B 1 40 CYS 40 40 40 CYS CYS A . n B 1 41 HIS 41 41 41 HIS HIS A . n B 1 42 LYS 42 42 42 LYS LYS A . n B 1 43 ALA 43 43 43 ALA ALA A . n B 1 44 ARG 44 44 44 ARG ARG A . n B 1 45 SER 45 45 45 SER SER A . n B 1 46 ASP 46 46 46 ASP ASP A . n B 1 47 TRP 47 47 47 TRP TRP A . n B 1 48 VAL 48 48 48 VAL VAL A . n B 1 49 LYS 49 49 49 LYS LYS A . n B 1 50 TYR 50 50 50 TYR TYR A . n B 1 51 ILE 51 51 51 ILE ILE A . n B 1 52 GLY 52 52 52 GLY GLY A . n B 1 53 PRO 53 53 53 PRO PRO A . n B 1 54 LEU 54 54 54 LEU LEU A . n B 1 55 THR 55 55 55 THR THR A . n B 1 56 GLU 56 56 56 GLU GLU A . n B 1 57 PHE 57 57 57 PHE PHE A . n B 1 58 GLY 58 58 58 GLY GLY A . n B 1 59 GLY 59 59 59 GLY GLY A . n B 1 60 CYS 60 60 60 CYS CYS A . n B 1 61 ASN 61 61 61 ASN ASN A . n B 1 62 HIS 62 62 62 HIS HIS A . n B 1 63 ILE 63 63 63 ILE ILE A . n B 1 64 ASN 64 64 64 ASN ASN A . n B 1 65 GLY 65 65 65 GLY GLY A . n B 1 66 ASN 66 66 66 ASN ASN A . n B 1 67 PHE 67 67 67 PHE PHE A . n B 1 68 SER 68 68 68 SER SER A . n B 1 69 ALA 69 69 69 ALA ALA A . n B 1 70 VAL 70 70 70 VAL VAL A . n B 1 71 VAL 71 71 71 VAL VAL A . n B 1 72 LEU 72 72 72 LEU LEU A . n B 1 73 PRO 73 73 73 PRO PRO A . n B 1 74 LEU 74 74 74 LEU LEU A . n B 1 75 CYS 75 75 75 CYS CYS A . n B 1 76 ARG 76 76 76 ARG ARG A . n B 1 77 PRO 77 77 77 PRO PRO A . n B 1 78 ASP 78 78 78 ASP ASP A . n B 1 79 ARG 79 79 79 ARG ARG A . n B 1 80 LEU 80 80 80 LEU LEU A . n B 1 81 GLU 81 81 81 GLU GLU A . n B 1 82 LEU 82 82 82 LEU LEU A . n B 1 83 ILE 83 83 83 ILE ILE A . n B 1 84 ALA 84 84 84 ALA ALA A . n B 1 85 TYR 85 85 85 TYR TYR A . n B 1 86 VAL 86 86 86 VAL VAL A . n B 1 87 LEU 87 87 87 LEU LEU A . n B 1 88 GLU 88 88 88 GLU GLU A . n B 1 89 PHE 89 89 89 PHE PHE A . n B 1 90 ALA 90 90 90 ALA ALA A . n B 1 91 PHE 91 91 91 PHE PHE A . n B 1 92 LEU 92 92 92 LEU LEU A . n B 1 93 HIS 93 93 93 HIS HIS A . n B 1 94 ASP 94 94 94 ASP ASP A . n B 1 95 SER 95 95 95 SER SER A . n B 1 96 VAL 96 96 96 VAL VAL A . n B 1 97 LEU 97 97 97 LEU LEU A . n B 1 98 GLU 98 98 98 GLU GLU A . n B 1 99 SER 99 99 99 SER SER A . n B 1 100 GLU 100 100 100 GLU GLU A . n B 1 101 ASN 101 101 ? ? ? A . n B 1 102 THR 102 102 ? ? ? A . n B 1 103 SER 103 103 ? ? ? A . n B 1 104 PRO 104 104 ? ? ? A . n B 1 105 GLU 105 105 ? ? ? A . n B 1 106 SER 106 106 ? ? ? A . n B 1 107 GLU 107 107 ? ? ? A . n B 1 108 VAL 108 108 ? ? ? A . n B 1 109 GLN 109 109 ? ? ? A . n B 1 110 ALA 110 110 110 ALA ALA A . n B 1 111 GLU 111 111 111 GLU GLU A . n B 1 112 ALA 112 112 112 ALA ALA A . n B 1 113 GLY 113 113 113 GLY GLY A . n B 1 114 LEU 114 114 114 LEU LEU A . n B 1 115 ARG 115 115 115 ARG ARG A . n B 1 116 LEU 116 116 116 LEU LEU A . n B 1 117 LEU 117 117 117 LEU LEU A . n B 1 118 TYR 118 118 118 TYR TYR A . n B 1 119 GLU 119 119 119 GLU GLU A . n B 1 120 ARG 120 120 120 ARG ARG A . n B 1 121 CYS 121 121 121 CYS CYS A . n B 1 122 ILE 122 122 122 ILE ILE A . n B 1 123 SER 123 123 123 SER SER A . n B 1 124 ARG 124 124 124 ARG ARG A . n B 1 125 LEU 125 125 125 LEU LEU A . n B 1 126 LEU 126 126 126 LEU LEU A . n B 1 127 GLN 127 127 127 GLN GLN A . n B 1 128 THR 128 128 128 THR THR A . n B 1 129 ASP 129 129 129 ASP ASP A . n B 1 130 GLU 130 130 130 GLU GLU A . n B 1 131 VAL 131 131 131 VAL VAL A . n B 1 132 CYS 132 132 132 CYS CYS A . n B 1 133 ALA 133 133 133 ALA ALA A . n B 1 134 LYS 134 134 134 LYS LYS A . n B 1 135 LYS 135 135 135 LYS LYS A . n B 1 136 ILE 136 136 136 ILE ILE A . n B 1 137 ALA 137 137 137 ALA ALA A . n B 1 138 LYS 138 138 138 LYS LYS A . n B 1 139 THR 139 139 139 THR THR A . n B 1 140 TRP 140 140 140 TRP TRP A . n B 1 141 LYS 141 141 141 LYS LYS A . n B 1 142 ASP 142 142 142 ASP ASP A . n B 1 143 ALA 143 143 143 ALA ALA A . n B 1 144 ILE 144 144 144 ILE ILE A . n B 1 145 ASN 145 145 145 ASN ASN A . n B 1 146 THR 146 146 146 THR THR A . n B 1 147 THR 147 147 147 THR THR A . n B 1 148 THR 148 148 148 THR THR A . n B 1 149 LYS 149 149 149 LYS LYS A . n B 1 150 ASP 150 150 150 ASP ASP A . n B 1 151 LYS 151 151 151 LYS LYS A . n B 1 152 ASN 152 152 152 ASN ASN A . n B 1 153 VAL 153 153 153 VAL VAL A . n B 1 154 ASP 154 154 154 ASP ASP A . n B 1 155 PHE 155 155 155 PHE PHE A . n B 1 156 GLN 156 156 156 GLN GLN A . n B 1 157 SER 157 157 157 SER SER A . n B 1 158 ILE 158 158 158 ILE ILE A . n B 1 159 GLU 159 159 159 GLU GLU A . n B 1 160 ASP 160 160 160 ASP ASP A . n B 1 161 TYR 161 161 161 TYR TYR A . n B 1 162 LEU 162 162 162 LEU LEU A . n B 1 163 GLU 163 163 163 GLU GLU A . n B 1 164 PHE 164 164 164 PHE PHE A . n B 1 165 ARG 165 165 165 ARG ARG A . n B 1 166 MET 166 166 166 MET MET A . n B 1 167 ILE 167 167 167 ILE ILE A . n B 1 168 ASP 168 168 168 ASP ASP A . n B 1 169 THR 169 169 169 THR THR A . n B 1 170 GLY 170 170 170 GLY GLY A . n B 1 171 ALA 171 171 171 ALA ALA A . n B 1 172 PRO 172 172 172 PRO PRO A . n B 1 173 PHE 173 173 173 PHE PHE A . n B 1 174 VAL 174 174 174 VAL VAL A . n B 1 175 GLU 175 175 175 GLU GLU A . n B 1 176 ALA 176 176 176 ALA ALA A . n B 1 177 LEU 177 177 177 LEU LEU A . n B 1 178 MET 178 178 178 MET MET A . n B 1 179 LEU 179 179 179 LEU LEU A . n B 1 180 PHE 180 180 180 PHE PHE A . n B 1 181 GLY 181 181 181 GLY GLY A . n B 1 182 LEU 182 182 182 LEU LEU A . n B 1 183 GLY 183 183 183 GLY GLY A . n B 1 184 MET 184 184 184 MET MET A . n B 1 185 SER 185 185 185 SER SER A . n B 1 186 LEU 186 186 186 LEU LEU A . n B 1 187 SER 187 187 187 SER SER A . n B 1 188 PRO 188 188 188 PRO PRO A . n B 1 189 GLN 189 189 189 GLN GLN A . n B 1 190 GLU 190 190 190 GLU GLU A . n B 1 191 ASP 191 191 191 ASP ASP A . n B 1 192 ASP 192 192 192 ASP ASP A . n B 1 193 ALA 193 193 193 ALA ALA A . n B 1 194 LEU 194 194 194 LEU LEU A . n B 1 195 GLY 195 195 195 GLY GLY A . n B 1 196 HIS 196 196 196 HIS HIS A . n B 1 197 VAL 197 197 197 VAL VAL A . n B 1 198 ILE 198 198 198 ILE ILE A . n B 1 199 ARG 199 199 199 ARG ARG A . n B 1 200 PRO 200 200 200 PRO PRO A . n B 1 201 CYS 201 201 201 CYS CYS A . n B 1 202 PHE 202 202 202 PHE PHE A . n B 1 203 ALA 203 203 203 ALA ALA A . n B 1 204 ALA 204 204 204 ALA ALA A . n B 1 205 LEU 205 205 205 LEU LEU A . n B 1 206 ALA 206 206 206 ALA ALA A . n B 1 207 LEU 207 207 207 LEU LEU A . n B 1 208 THR 208 208 208 THR THR A . n B 1 209 ASN 209 209 209 ASN ASN A . n B 1 210 ASP 210 210 210 ASP ASP A . n B 1 211 TYR 211 211 211 TYR TYR A . n B 1 212 PHE 212 212 212 PHE PHE A . n B 1 213 SER 213 213 213 SER SER A . n B 1 214 PHE 214 214 214 PHE PHE A . n B 1 215 ASP 215 215 215 ASP ASP A . n B 1 216 ARG 216 216 216 ARG ARG A . n B 1 217 GLU 217 217 217 GLU GLU A . n B 1 218 ILE 218 218 218 ILE ILE A . n B 1 219 GLU 219 219 219 GLU GLU A . n B 1 220 GLU 220 220 220 GLU GLU A . n B 1 221 VAL 221 221 221 VAL VAL A . n B 1 222 ASP 222 222 222 ASP ASP A . n B 1 223 THR 223 223 223 THR THR A . n B 1 224 SER 224 224 224 SER SER A . n B 1 225 THR 225 225 225 THR THR A . n B 1 226 LEU 226 226 226 LEU LEU A . n B 1 227 ILE 227 227 227 ILE ILE A . n B 1 228 ASN 228 228 228 ASN ASN A . n B 1 229 SER 229 229 229 SER SER A . n B 1 230 VAL 230 230 230 VAL VAL A . n B 1 231 ALA 231 231 231 ALA ALA A . n B 1 232 ILE 232 232 232 ILE ILE A . n B 1 233 VAL 233 233 233 VAL VAL A . n B 1 234 MET 234 234 234 MET MET A . n B 1 235 ARG 235 235 235 ARG ARG A . n B 1 236 ILE 236 236 236 ILE ILE A . n B 1 237 GLN 237 237 237 GLN GLN A . n B 1 238 SER 238 238 238 SER SER A . n B 1 239 LEU 239 239 239 LEU LEU A . n B 1 240 ASP 240 240 240 ASP ASP A . n B 1 241 ILE 241 241 241 ILE ILE A . n B 1 242 PRO 242 242 242 PRO PRO A . n B 1 243 THR 243 243 243 THR THR A . n B 1 244 ALA 244 244 244 ALA ALA A . n B 1 245 LYS 245 245 245 LYS LYS A . n B 1 246 THR 246 246 246 THR THR A . n B 1 247 ILE 247 247 247 ILE ILE A . n B 1 248 ILE 248 248 248 ILE ILE A . n B 1 249 ASN 249 249 249 ASN ASN A . n B 1 250 GLU 250 250 250 GLU GLU A . n B 1 251 THR 251 251 251 THR THR A . n B 1 252 ILE 252 252 252 ILE ILE A . n B 1 253 GLN 253 253 253 GLN GLN A . n B 1 254 LYS 254 254 254 LYS LYS A . n B 1 255 TYR 255 255 255 TYR TYR A . n B 1 256 GLU 256 256 256 GLU GLU A . n B 1 257 ARG 257 257 257 ARG ARG A . n B 1 258 GLU 258 258 258 GLU GLU A . n B 1 259 PHE 259 259 259 PHE PHE A . n B 1 260 LEU 260 260 260 LEU LEU A . n B 1 261 ARG 261 261 261 ARG ARG A . n B 1 262 ARG 262 262 262 ARG ARG A . n B 1 263 ILE 263 263 263 ILE ILE A . n B 1 264 ASP 264 264 264 ASP ASP A . n B 1 265 GLU 265 265 265 GLU GLU A . n B 1 266 TYR 266 266 266 TYR TYR A . n B 1 267 LYS 267 267 267 LYS LYS A . n B 1 268 GLN 268 268 268 GLN GLN A . n B 1 269 HIS 269 269 269 HIS HIS A . n B 1 270 LYS 270 270 270 LYS LYS A . n B 1 271 GLY 271 271 271 GLY GLY A . n B 1 272 PRO 272 272 272 PRO PRO A . n B 1 273 ILE 273 273 273 ILE ILE A . n B 1 274 SER 274 274 274 SER SER A . n B 1 275 ASN 275 275 275 ASN ASN A . n B 1 276 LYS 276 276 276 LYS LYS A . n B 1 277 ILE 277 277 277 ILE ILE A . n B 1 278 GLU 278 278 278 GLU GLU A . n B 1 279 GLN 279 279 279 GLN GLN A . n B 1 280 TYR 280 280 280 TYR TYR A . n B 1 281 MET 281 281 281 MET MET A . n B 1 282 GLU 282 282 282 GLU GLU A . n B 1 283 ALA 283 283 283 ALA ALA A . n B 1 284 MET 284 284 284 MET MET A . n B 1 285 THR 285 285 285 THR THR A . n B 1 286 TYR 286 286 286 TYR TYR A . n B 1 287 GLN 287 287 287 GLN GLN A . n B 1 288 ILE 288 288 288 ILE ILE A . n B 1 289 SER 289 289 289 SER SER A . n B 1 290 GLY 290 290 290 GLY GLY A . n B 1 291 ASN 291 291 291 ASN ASN A . n B 1 292 LEU 292 292 292 LEU LEU A . n B 1 293 VAL 293 293 293 VAL VAL A . n B 1 294 TRP 294 294 294 TRP TRP A . n B 1 295 SER 295 295 295 SER SER A . n B 1 296 LEU 296 296 296 LEU LEU A . n B 1 297 ASN 297 297 297 ASN ASN A . n B 1 298 CYS 298 298 298 CYS CYS A . n B 1 299 PRO 299 299 299 PRO PRO A . n B 1 300 ARG 300 300 300 ARG ARG A . n B 1 301 TYR 301 301 301 TYR TYR A . n B 1 302 ASN 302 302 302 ASN ASN A . n B 1 303 PRO 303 303 303 PRO PRO A . n B 1 304 ASP 304 304 304 ASP ASP A . n B 1 305 TYR 305 305 ? ? ? A . n B 1 306 ARG 306 306 ? ? ? A . n B 1 307 TYR 307 307 ? ? ? A . n B 1 308 GLY 308 308 ? ? ? A . n B 1 309 LEU 309 309 ? ? ? A . n B 1 310 GLU 310 310 ? ? ? A . n B 1 311 ALA 311 311 ? ? ? A . n B 1 312 CYS 312 312 ? ? ? A . n B 1 313 GLN 313 313 ? ? ? A . n B 1 314 HIS 314 314 ? ? ? A . n B 1 315 GLU 315 315 ? ? ? A . n B 1 316 GLY 316 316 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 2 SO4 1 401 1 SO4 SO4 I . D 3 MG 1 402 1 MG MG I . E 3 MG 1 403 2 MG MG I . F 3 MG 1 404 4 MG MG I . G 4 NA 1 405 1 NA NA I . H 5 POP 1 406 401 POP POP I . I 6 IMD 1 407 501 IMD IMD I . J 6 IMD 1 408 601 IMD IMD I . K 7 EDO 1 409 701 EDO EGL I . L 7 EDO 1 410 801 EDO EGL I . M 8 GOL 1 411 901 GOL GOL I . N 3 MG 1 401 3 MG MG A . O 3 MG 1 402 5 MG MG A . P 3 MG 1 403 6 MG MG A . Q 4 NA 1 404 2 NA NA A . R 5 POP 1 405 402 POP POP A . S 6 IMD 1 406 603 IMD IMD A . T 7 EDO 1 407 703 EDO EDO A . U 8 GOL 1 408 803 GOL GOL A . V 9 HOH 1 501 205 HOH HOH I . V 9 HOH 2 502 140 HOH HOH I . V 9 HOH 3 503 122 HOH HOH I . V 9 HOH 4 504 214 HOH HOH I . V 9 HOH 5 505 71 HOH HOH I . V 9 HOH 6 506 53 HOH HOH I . V 9 HOH 7 507 40 HOH HOH I . V 9 HOH 8 508 124 HOH HOH I . V 9 HOH 9 509 95 HOH HOH I . V 9 HOH 10 510 201 HOH HOH I . V 9 HOH 11 511 221 HOH HOH I . V 9 HOH 12 512 190 HOH HOH I . V 9 HOH 13 513 173 HOH HOH I . V 9 HOH 14 514 66 HOH HOH I . V 9 HOH 15 515 27 HOH HOH I . V 9 HOH 16 516 23 HOH HOH I . V 9 HOH 17 517 115 HOH HOH I . V 9 HOH 18 518 83 HOH HOH I . V 9 HOH 19 519 184 HOH HOH I . V 9 HOH 20 520 162 HOH HOH I . V 9 HOH 21 521 160 HOH HOH I . V 9 HOH 22 522 69 HOH HOH I . V 9 HOH 23 523 93 HOH HOH I . V 9 HOH 24 524 4 HOH HOH I . V 9 HOH 25 525 22 HOH HOH I . V 9 HOH 26 526 208 HOH HOH I . V 9 HOH 27 527 166 HOH HOH I . V 9 HOH 28 528 24 HOH HOH I . V 9 HOH 29 529 14 HOH HOH I . V 9 HOH 30 530 81 HOH HOH I . V 9 HOH 31 531 73 HOH HOH I . V 9 HOH 32 532 146 HOH HOH I . V 9 HOH 33 533 39 HOH HOH I . V 9 HOH 34 534 90 HOH HOH I . V 9 HOH 35 535 172 HOH HOH I . V 9 HOH 36 536 164 HOH HOH I . V 9 HOH 37 537 11 HOH HOH I . V 9 HOH 38 538 7 HOH HOH I . V 9 HOH 39 539 85 HOH HOH I . V 9 HOH 40 540 195 HOH HOH I . V 9 HOH 41 541 52 HOH HOH I . V 9 HOH 42 542 198 HOH HOH I . V 9 HOH 43 543 167 HOH HOH I . V 9 HOH 44 544 33 HOH HOH I . V 9 HOH 45 545 29 HOH HOH I . V 9 HOH 46 546 43 HOH HOH I . V 9 HOH 47 547 114 HOH HOH I . V 9 HOH 48 548 8 HOH HOH I . V 9 HOH 49 549 51 HOH HOH I . V 9 HOH 50 550 56 HOH HOH I . V 9 HOH 51 551 3 HOH HOH I . V 9 HOH 52 552 187 HOH HOH I . V 9 HOH 53 553 215 HOH HOH I . V 9 HOH 54 554 203 HOH HOH I . V 9 HOH 55 555 34 HOH HOH I . V 9 HOH 56 556 42 HOH HOH I . V 9 HOH 57 557 26 HOH HOH I . V 9 HOH 58 558 213 HOH HOH I . V 9 HOH 59 559 218 HOH HOH I . V 9 HOH 60 560 35 HOH HOH I . V 9 HOH 61 561 75 HOH HOH I . V 9 HOH 62 562 197 HOH HOH I . V 9 HOH 63 563 84 HOH HOH I . V 9 HOH 64 564 169 HOH HOH I . V 9 HOH 65 565 86 HOH HOH I . V 9 HOH 66 566 58 HOH HOH I . V 9 HOH 67 567 180 HOH HOH I . V 9 HOH 68 568 31 HOH HOH I . V 9 HOH 69 569 152 HOH HOH I . V 9 HOH 70 570 48 HOH HOH I . V 9 HOH 71 571 21 HOH HOH I . V 9 HOH 72 572 65 HOH HOH I . V 9 HOH 73 573 76 HOH HOH I . V 9 HOH 74 574 220 HOH HOH I . V 9 HOH 75 575 133 HOH HOH I . V 9 HOH 76 576 212 HOH HOH I . V 9 HOH 77 577 70 HOH HOH I . V 9 HOH 78 578 25 HOH HOH I . V 9 HOH 79 579 196 HOH HOH I . V 9 HOH 80 580 46 HOH HOH I . V 9 HOH 81 581 178 HOH HOH I . V 9 HOH 82 582 55 HOH HOH I . V 9 HOH 83 583 2 HOH HOH I . V 9 HOH 84 584 176 HOH HOH I . V 9 HOH 85 585 170 HOH HOH I . V 9 HOH 86 586 49 HOH HOH I . V 9 HOH 87 587 82 HOH HOH I . V 9 HOH 88 588 145 HOH HOH I . V 9 HOH 89 589 41 HOH HOH I . V 9 HOH 90 590 202 HOH HOH I . V 9 HOH 91 591 147 HOH HOH I . V 9 HOH 92 592 10 HOH HOH I . V 9 HOH 93 593 111 HOH HOH I . V 9 HOH 94 594 20 HOH HOH I . V 9 HOH 95 595 188 HOH HOH I . V 9 HOH 96 596 171 HOH HOH I . V 9 HOH 97 597 163 HOH HOH I . V 9 HOH 98 598 12 HOH HOH I . V 9 HOH 99 599 92 HOH HOH I . V 9 HOH 100 600 135 HOH HOH I . V 9 HOH 101 601 87 HOH HOH I . V 9 HOH 102 602 157 HOH HOH I . V 9 HOH 103 603 194 HOH HOH I . V 9 HOH 104 604 209 HOH HOH I . V 9 HOH 105 605 61 HOH HOH I . V 9 HOH 106 606 50 HOH HOH I . V 9 HOH 107 607 108 HOH HOH I . V 9 HOH 108 608 18 HOH HOH I . V 9 HOH 109 609 63 HOH HOH I . V 9 HOH 110 610 130 HOH HOH I . V 9 HOH 111 611 150 HOH HOH I . V 9 HOH 112 612 134 HOH HOH I . V 9 HOH 113 613 181 HOH HOH I . V 9 HOH 114 614 9 HOH HOH I . V 9 HOH 115 615 94 HOH HOH I . V 9 HOH 116 616 1 HOH HOH I . V 9 HOH 117 617 175 HOH HOH I . V 9 HOH 118 618 59 HOH HOH I . V 9 HOH 119 619 158 HOH HOH I . V 9 HOH 120 620 77 HOH HOH I . V 9 HOH 121 621 105 HOH HOH I . V 9 HOH 122 622 44 HOH HOH I . V 9 HOH 123 623 137 HOH HOH I . W 9 HOH 1 501 143 HOH HOH A . W 9 HOH 2 502 54 HOH HOH A . W 9 HOH 3 503 57 HOH HOH A . W 9 HOH 4 504 217 HOH HOH A . W 9 HOH 5 505 182 HOH HOH A . W 9 HOH 6 506 223 HOH HOH A . W 9 HOH 7 507 156 HOH HOH A . W 9 HOH 8 508 80 HOH HOH A . W 9 HOH 9 509 159 HOH HOH A . W 9 HOH 10 510 141 HOH HOH A . W 9 HOH 11 511 47 HOH HOH A . W 9 HOH 12 512 28 HOH HOH A . W 9 HOH 13 513 16 HOH HOH A . W 9 HOH 14 514 45 HOH HOH A . W 9 HOH 15 515 155 HOH HOH A . W 9 HOH 16 516 210 HOH HOH A . W 9 HOH 17 517 6 HOH HOH A . W 9 HOH 18 518 149 HOH HOH A . W 9 HOH 19 519 144 HOH HOH A . W 9 HOH 20 520 136 HOH HOH A . W 9 HOH 21 521 102 HOH HOH A . W 9 HOH 22 522 96 HOH HOH A . W 9 HOH 23 523 17 HOH HOH A . W 9 HOH 24 524 88 HOH HOH A . W 9 HOH 25 525 199 HOH HOH A . W 9 HOH 26 526 37 HOH HOH A . W 9 HOH 27 527 177 HOH HOH A . W 9 HOH 28 528 32 HOH HOH A . W 9 HOH 29 529 222 HOH HOH A . W 9 HOH 30 530 74 HOH HOH A . W 9 HOH 31 531 97 HOH HOH A . W 9 HOH 32 532 64 HOH HOH A . W 9 HOH 33 533 193 HOH HOH A . W 9 HOH 34 534 104 HOH HOH A . W 9 HOH 35 535 192 HOH HOH A . W 9 HOH 36 536 189 HOH HOH A . W 9 HOH 37 537 142 HOH HOH A . W 9 HOH 38 538 132 HOH HOH A . W 9 HOH 39 539 116 HOH HOH A . W 9 HOH 40 540 60 HOH HOH A . W 9 HOH 41 541 219 HOH HOH A . W 9 HOH 42 542 138 HOH HOH A . W 9 HOH 43 543 19 HOH HOH A . W 9 HOH 44 544 200 HOH HOH A . W 9 HOH 45 545 62 HOH HOH A . W 9 HOH 46 546 174 HOH HOH A . W 9 HOH 47 547 36 HOH HOH A . W 9 HOH 48 548 168 HOH HOH A . W 9 HOH 49 549 139 HOH HOH A . W 9 HOH 50 550 129 HOH HOH A . W 9 HOH 51 551 183 HOH HOH A . W 9 HOH 52 552 165 HOH HOH A . W 9 HOH 53 553 117 HOH HOH A . W 9 HOH 54 554 191 HOH HOH A . W 9 HOH 55 555 38 HOH HOH A . W 9 HOH 56 556 206 HOH HOH A . W 9 HOH 57 557 148 HOH HOH A . W 9 HOH 58 558 118 HOH HOH A . W 9 HOH 59 559 67 HOH HOH A . W 9 HOH 60 560 89 HOH HOH A . W 9 HOH 61 561 207 HOH HOH A . W 9 HOH 62 562 186 HOH HOH A . W 9 HOH 63 563 13 HOH HOH A . W 9 HOH 64 564 204 HOH HOH A . W 9 HOH 65 565 15 HOH HOH A . W 9 HOH 66 566 127 HOH HOH A . W 9 HOH 67 567 216 HOH HOH A . W 9 HOH 68 568 211 HOH HOH A . W 9 HOH 69 569 153 HOH HOH A . W 9 HOH 70 570 101 HOH HOH A . W 9 HOH 71 571 30 HOH HOH A . W 9 HOH 72 572 179 HOH HOH A . W 9 HOH 73 573 185 HOH HOH A . W 9 HOH 74 574 5 HOH HOH A . W 9 HOH 75 575 154 HOH HOH A . # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_and_software_defined_assembly PISA monomeric 1 2 author_and_software_defined_assembly PISA monomeric 1 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,C,D,E,F,G,H,I,J,K,L,M,V 2 1 B,N,O,P,Q,R,S,T,U,W # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD2 ? A ASP 94 ? I ASP 94 ? 1_555 MG ? D MG . ? I MG 402 ? 1_555 OE2 ? A GLU 98 ? I GLU 98 ? 1_555 85.1 ? 2 OD2 ? A ASP 94 ? I ASP 94 ? 1_555 MG ? D MG . ? I MG 402 ? 1_555 O3 ? H POP . ? I POP 406 ? 1_555 98.1 ? 3 OE2 ? A GLU 98 ? I GLU 98 ? 1_555 MG ? D MG . ? I MG 402 ? 1_555 O3 ? H POP . ? I POP 406 ? 1_555 176.6 ? 4 OD2 ? A ASP 94 ? I ASP 94 ? 1_555 MG ? D MG . ? I MG 402 ? 1_555 O6 ? H POP . ? I POP 406 ? 1_555 89.4 ? 5 OE2 ? A GLU 98 ? I GLU 98 ? 1_555 MG ? D MG . ? I MG 402 ? 1_555 O6 ? H POP . ? I POP 406 ? 1_555 77.3 ? 6 O3 ? H POP . ? I POP 406 ? 1_555 MG ? D MG . ? I MG 402 ? 1_555 O6 ? H POP . ? I POP 406 ? 1_555 103.8 ? 7 OD2 ? A ASP 94 ? I ASP 94 ? 1_555 MG ? D MG . ? I MG 402 ? 1_555 O ? V HOH . ? I HOH 528 ? 1_555 160.2 ? 8 OE2 ? A GLU 98 ? I GLU 98 ? 1_555 MG ? D MG . ? I MG 402 ? 1_555 O ? V HOH . ? I HOH 528 ? 1_555 89.0 ? 9 O3 ? H POP . ? I POP 406 ? 1_555 MG ? D MG . ? I MG 402 ? 1_555 O ? V HOH . ? I HOH 528 ? 1_555 87.6 ? 10 O6 ? H POP . ? I POP 406 ? 1_555 MG ? D MG . ? I MG 402 ? 1_555 O ? V HOH . ? I HOH 528 ? 1_555 107.7 ? 11 OD2 ? A ASP 94 ? I ASP 94 ? 1_555 MG ? D MG . ? I MG 402 ? 1_555 O ? V HOH . ? I HOH 568 ? 1_555 80.1 ? 12 OE2 ? A GLU 98 ? I GLU 98 ? 1_555 MG ? D MG . ? I MG 402 ? 1_555 O ? V HOH . ? I HOH 568 ? 1_555 90.9 ? 13 O3 ? H POP . ? I POP 406 ? 1_555 MG ? D MG . ? I MG 402 ? 1_555 O ? V HOH . ? I HOH 568 ? 1_555 88.5 ? 14 O6 ? H POP . ? I POP 406 ? 1_555 MG ? D MG . ? I MG 402 ? 1_555 O ? V HOH . ? I HOH 568 ? 1_555 165.0 ? 15 O ? V HOH . ? I HOH 528 ? 1_555 MG ? D MG . ? I MG 402 ? 1_555 O ? V HOH . ? I HOH 568 ? 1_555 81.1 ? 16 OD1 ? A ASP 94 ? I ASP 94 ? 1_555 MG ? E MG . ? I MG 403 ? 1_555 OE2 ? A GLU 98 ? I GLU 98 ? 1_555 85.6 ? 17 OD1 ? A ASP 94 ? I ASP 94 ? 1_555 MG ? E MG . ? I MG 403 ? 1_555 O6 ? H POP . ? I POP 406 ? 1_555 90.8 ? 18 OE2 ? A GLU 98 ? I GLU 98 ? 1_555 MG ? E MG . ? I MG 403 ? 1_555 O6 ? H POP . ? I POP 406 ? 1_555 83.8 ? 19 OD1 ? A ASP 94 ? I ASP 94 ? 1_555 MG ? E MG . ? I MG 403 ? 1_555 O ? V HOH . ? I HOH 516 ? 1_555 94.6 ? 20 OE2 ? A GLU 98 ? I GLU 98 ? 1_555 MG ? E MG . ? I MG 403 ? 1_555 O ? V HOH . ? I HOH 516 ? 1_555 105.4 ? 21 O6 ? H POP . ? I POP 406 ? 1_555 MG ? E MG . ? I MG 403 ? 1_555 O ? V HOH . ? I HOH 516 ? 1_555 169.6 ? 22 OD1 ? A ASP 94 ? I ASP 94 ? 1_555 MG ? E MG . ? I MG 403 ? 1_555 O ? V HOH . ? I HOH 525 ? 1_555 86.6 ? 23 OE2 ? A GLU 98 ? I GLU 98 ? 1_555 MG ? E MG . ? I MG 403 ? 1_555 O ? V HOH . ? I HOH 525 ? 1_555 161.2 ? 24 O6 ? H POP . ? I POP 406 ? 1_555 MG ? E MG . ? I MG 403 ? 1_555 O ? V HOH . ? I HOH 525 ? 1_555 79.1 ? 25 O ? V HOH . ? I HOH 516 ? 1_555 MG ? E MG . ? I MG 403 ? 1_555 O ? V HOH . ? I HOH 525 ? 1_555 92.3 ? 26 OD1 ? A ASP 94 ? I ASP 94 ? 1_555 MG ? E MG . ? I MG 403 ? 1_555 O ? V HOH . ? I HOH 557 ? 1_555 175.2 ? 27 OE2 ? A GLU 98 ? I GLU 98 ? 1_555 MG ? E MG . ? I MG 403 ? 1_555 O ? V HOH . ? I HOH 557 ? 1_555 89.7 ? 28 O6 ? H POP . ? I POP 406 ? 1_555 MG ? E MG . ? I MG 403 ? 1_555 O ? V HOH . ? I HOH 557 ? 1_555 89.4 ? 29 O ? V HOH . ? I HOH 516 ? 1_555 MG ? E MG . ? I MG 403 ? 1_555 O ? V HOH . ? I HOH 557 ? 1_555 86.0 ? 30 O ? V HOH . ? I HOH 525 ? 1_555 MG ? E MG . ? I MG 403 ? 1_555 O ? V HOH . ? I HOH 557 ? 1_555 98.1 ? 31 OE1 ? A GLU 98 ? I GLU 98 ? 1_555 NA ? G NA . ? I NA 405 ? 1_555 OG ? A SER 224 ? I SER 224 ? 1_555 97.9 ? 32 OE1 ? A GLU 98 ? I GLU 98 ? 1_555 NA ? G NA . ? I NA 405 ? 1_555 O ? A THR 225 ? I THR 225 ? 1_555 95.5 ? 33 OG ? A SER 224 ? I SER 224 ? 1_555 NA ? G NA . ? I NA 405 ? 1_555 O ? A THR 225 ? I THR 225 ? 1_555 86.3 ? 34 OE1 ? A GLU 98 ? I GLU 98 ? 1_555 NA ? G NA . ? I NA 405 ? 1_555 O ? V HOH . ? I HOH 578 ? 1_555 78.7 ? 35 OG ? A SER 224 ? I SER 224 ? 1_555 NA ? G NA . ? I NA 405 ? 1_555 O ? V HOH . ? I HOH 578 ? 1_555 161.7 ? 36 O ? A THR 225 ? I THR 225 ? 1_555 NA ? G NA . ? I NA 405 ? 1_555 O ? V HOH . ? I HOH 578 ? 1_555 76.1 ? 37 OE1 ? A GLU 98 ? I GLU 98 ? 1_555 NA ? G NA . ? I NA 405 ? 1_555 O ? V HOH . ? I HOH 580 ? 1_555 173.2 ? 38 OG ? A SER 224 ? I SER 224 ? 1_555 NA ? G NA . ? I NA 405 ? 1_555 O ? V HOH . ? I HOH 580 ? 1_555 86.3 ? 39 O ? A THR 225 ? I THR 225 ? 1_555 NA ? G NA . ? I NA 405 ? 1_555 O ? V HOH . ? I HOH 580 ? 1_555 79.4 ? 40 O ? V HOH . ? I HOH 578 ? 1_555 NA ? G NA . ? I NA 405 ? 1_555 O ? V HOH . ? I HOH 580 ? 1_555 95.7 ? 41 OG ? A SER 213 ? I SER 213 ? 1_555 MG ? F MG . ? I MG 404 ? 1_555 OE1 ? A GLU 217 ? I GLU 217 ? 1_555 85.4 ? 42 OG ? A SER 213 ? I SER 213 ? 1_555 MG ? F MG . ? I MG 404 ? 1_555 O2 ? H POP . ? I POP 406 ? 1_555 101.2 ? 43 OE1 ? A GLU 217 ? I GLU 217 ? 1_555 MG ? F MG . ? I MG 404 ? 1_555 O2 ? H POP . ? I POP 406 ? 1_555 100.8 ? 44 OG ? A SER 213 ? I SER 213 ? 1_555 MG ? F MG . ? I MG 404 ? 1_555 O4 ? H POP . ? I POP 406 ? 1_555 174.5 ? 45 OE1 ? A GLU 217 ? I GLU 217 ? 1_555 MG ? F MG . ? I MG 404 ? 1_555 O4 ? H POP . ? I POP 406 ? 1_555 95.9 ? 46 O2 ? H POP . ? I POP 406 ? 1_555 MG ? F MG . ? I MG 404 ? 1_555 O4 ? H POP . ? I POP 406 ? 1_555 83.8 ? 47 OG ? A SER 213 ? I SER 213 ? 1_555 MG ? F MG . ? I MG 404 ? 1_555 O ? V HOH . ? I HOH 531 ? 1_555 89.6 ? 48 OE1 ? A GLU 217 ? I GLU 217 ? 1_555 MG ? F MG . ? I MG 404 ? 1_555 O ? V HOH . ? I HOH 531 ? 1_555 78.8 ? 49 O2 ? H POP . ? I POP 406 ? 1_555 MG ? F MG . ? I MG 404 ? 1_555 O ? V HOH . ? I HOH 531 ? 1_555 169.1 ? 50 O4 ? H POP . ? I POP 406 ? 1_555 MG ? F MG . ? I MG 404 ? 1_555 O ? V HOH . ? I HOH 531 ? 1_555 85.5 ? 51 OD1 ? B ASP 94 ? A ASP 94 ? 1_555 MG ? N MG . ? A MG 401 ? 1_555 OE2 ? B GLU 98 ? A GLU 98 ? 1_555 82.8 ? 52 OD1 ? B ASP 94 ? A ASP 94 ? 1_555 MG ? N MG . ? A MG 401 ? 1_555 O2 ? R POP . ? A POP 405 ? 1_555 98.6 ? 53 OE2 ? B GLU 98 ? A GLU 98 ? 1_555 MG ? N MG . ? A MG 401 ? 1_555 O2 ? R POP . ? A POP 405 ? 1_555 82.2 ? 54 OD1 ? B ASP 94 ? A ASP 94 ? 1_555 MG ? N MG . ? A MG 401 ? 1_555 O ? W HOH . ? A HOH 503 ? 1_555 160.5 ? 55 OE2 ? B GLU 98 ? A GLU 98 ? 1_555 MG ? N MG . ? A MG 401 ? 1_555 O ? W HOH . ? A HOH 503 ? 1_555 102.2 ? 56 O2 ? R POP . ? A POP 405 ? 1_555 MG ? N MG . ? A MG 401 ? 1_555 O ? W HOH . ? A HOH 503 ? 1_555 100.7 ? 57 OD1 ? B ASP 94 ? A ASP 94 ? 1_555 MG ? N MG . ? A MG 401 ? 1_555 O ? W HOH . ? A HOH 514 ? 1_555 82.6 ? 58 OE2 ? B GLU 98 ? A GLU 98 ? 1_555 MG ? N MG . ? A MG 401 ? 1_555 O ? W HOH . ? A HOH 514 ? 1_555 161.5 ? 59 O2 ? R POP . ? A POP 405 ? 1_555 MG ? N MG . ? A MG 401 ? 1_555 O ? W HOH . ? A HOH 514 ? 1_555 88.8 ? 60 O ? W HOH . ? A HOH 503 ? 1_555 MG ? N MG . ? A MG 401 ? 1_555 O ? W HOH . ? A HOH 514 ? 1_555 95.4 ? 61 OD1 ? B ASP 94 ? A ASP 94 ? 1_555 MG ? N MG . ? A MG 401 ? 1_555 O ? W HOH . ? A HOH 534 ? 1_555 82.2 ? 62 OE2 ? B GLU 98 ? A GLU 98 ? 1_555 MG ? N MG . ? A MG 401 ? 1_555 O ? W HOH . ? A HOH 534 ? 1_555 102.5 ? 63 O2 ? R POP . ? A POP 405 ? 1_555 MG ? N MG . ? A MG 401 ? 1_555 O ? W HOH . ? A HOH 534 ? 1_555 175.3 ? 64 O ? W HOH . ? A HOH 503 ? 1_555 MG ? N MG . ? A MG 401 ? 1_555 O ? W HOH . ? A HOH 534 ? 1_555 78.3 ? 65 O ? W HOH . ? A HOH 514 ? 1_555 MG ? N MG . ? A MG 401 ? 1_555 O ? W HOH . ? A HOH 534 ? 1_555 86.7 ? 66 OD2 ? B ASP 94 ? A ASP 94 ? 1_555 MG ? P MG . ? A MG 403 ? 1_555 OE2 ? B GLU 98 ? A GLU 98 ? 1_555 90.7 ? 67 OD2 ? B ASP 94 ? A ASP 94 ? 1_555 MG ? P MG . ? A MG 403 ? 1_555 O2 ? R POP . ? A POP 405 ? 1_555 98.1 ? 68 OE2 ? B GLU 98 ? A GLU 98 ? 1_555 MG ? P MG . ? A MG 403 ? 1_555 O2 ? R POP . ? A POP 405 ? 1_555 89.7 ? 69 OD2 ? B ASP 94 ? A ASP 94 ? 1_555 MG ? P MG . ? A MG 403 ? 1_555 O5 ? R POP . ? A POP 405 ? 1_555 101.3 ? 70 OE2 ? B GLU 98 ? A GLU 98 ? 1_555 MG ? P MG . ? A MG 403 ? 1_555 O5 ? R POP . ? A POP 405 ? 1_555 167.9 ? 71 O2 ? R POP . ? A POP 405 ? 1_555 MG ? P MG . ? A MG 403 ? 1_555 O5 ? R POP . ? A POP 405 ? 1_555 89.9 ? 72 OD2 ? B ASP 94 ? A ASP 94 ? 1_555 MG ? P MG . ? A MG 403 ? 1_555 O ? W HOH . ? A HOH 526 ? 1_555 170.3 ? 73 OE2 ? B GLU 98 ? A GLU 98 ? 1_555 MG ? P MG . ? A MG 403 ? 1_555 O ? W HOH . ? A HOH 526 ? 1_555 88.5 ? 74 O2 ? R POP . ? A POP 405 ? 1_555 MG ? P MG . ? A MG 403 ? 1_555 O ? W HOH . ? A HOH 526 ? 1_555 91.5 ? 75 O5 ? R POP . ? A POP 405 ? 1_555 MG ? P MG . ? A MG 403 ? 1_555 O ? W HOH . ? A HOH 526 ? 1_555 79.4 ? 76 OD2 ? B ASP 94 ? A ASP 94 ? 1_555 MG ? P MG . ? A MG 403 ? 1_555 O ? W HOH . ? A HOH 550 ? 1_555 83.2 ? 77 OE2 ? B GLU 98 ? A GLU 98 ? 1_555 MG ? P MG . ? A MG 403 ? 1_555 O ? W HOH . ? A HOH 550 ? 1_555 88.5 ? 78 O2 ? R POP . ? A POP 405 ? 1_555 MG ? P MG . ? A MG 403 ? 1_555 O ? W HOH . ? A HOH 550 ? 1_555 177.8 ? 79 O5 ? R POP . ? A POP 405 ? 1_555 MG ? P MG . ? A MG 403 ? 1_555 O ? W HOH . ? A HOH 550 ? 1_555 91.6 ? 80 O ? W HOH . ? A HOH 526 ? 1_555 MG ? P MG . ? A MG 403 ? 1_555 O ? W HOH . ? A HOH 550 ? 1_555 87.1 ? 81 OE1 ? B GLU 98 ? A GLU 98 ? 1_555 NA ? Q NA . ? A NA 404 ? 1_555 O ? B THR 225 ? A THR 225 ? 1_555 93.4 ? 82 OE1 ? B GLU 98 ? A GLU 98 ? 1_555 NA ? Q NA . ? A NA 404 ? 1_555 O ? W HOH . ? A HOH 519 ? 1_555 97.8 ? 83 O ? B THR 225 ? A THR 225 ? 1_555 NA ? Q NA . ? A NA 404 ? 1_555 O ? W HOH . ? A HOH 519 ? 1_555 168.1 ? 84 OE1 ? B GLU 98 ? A GLU 98 ? 1_555 NA ? Q NA . ? A NA 404 ? 1_555 O ? W HOH . ? A HOH 549 ? 1_555 176.0 ? 85 O ? B THR 225 ? A THR 225 ? 1_555 NA ? Q NA . ? A NA 404 ? 1_555 O ? W HOH . ? A HOH 549 ? 1_555 85.0 ? 86 O ? W HOH . ? A HOH 519 ? 1_555 NA ? Q NA . ? A NA 404 ? 1_555 O ? W HOH . ? A HOH 549 ? 1_555 84.0 ? 87 OE1 ? B GLU 98 ? A GLU 98 ? 1_555 NA ? Q NA . ? A NA 404 ? 1_555 O ? W HOH . ? A HOH 563 ? 1_555 77.5 ? 88 O ? B THR 225 ? A THR 225 ? 1_555 NA ? Q NA . ? A NA 404 ? 1_555 O ? W HOH . ? A HOH 563 ? 1_555 78.8 ? 89 O ? W HOH . ? A HOH 519 ? 1_555 NA ? Q NA . ? A NA 404 ? 1_555 O ? W HOH . ? A HOH 563 ? 1_555 107.3 ? 90 O ? W HOH . ? A HOH 549 ? 1_555 NA ? Q NA . ? A NA 404 ? 1_555 O ? W HOH . ? A HOH 563 ? 1_555 98.6 ? 91 OG ? B SER 213 ? A SER 213 ? 1_555 MG ? O MG . ? A MG 402 ? 1_555 OE2 ? B GLU 217 ? A GLU 217 ? 1_555 86.5 ? 92 OG ? B SER 213 ? A SER 213 ? 1_555 MG ? O MG . ? A MG 402 ? 1_555 O3 ? R POP . ? A POP 405 ? 1_555 170.8 ? 93 OE2 ? B GLU 217 ? A GLU 217 ? 1_555 MG ? O MG . ? A MG 402 ? 1_555 O3 ? R POP . ? A POP 405 ? 1_555 100.2 ? 94 OG ? B SER 213 ? A SER 213 ? 1_555 MG ? O MG . ? A MG 402 ? 1_555 O6 ? R POP . ? A POP 405 ? 1_555 97.8 ? 95 OE2 ? B GLU 217 ? A GLU 217 ? 1_555 MG ? O MG . ? A MG 402 ? 1_555 O6 ? R POP . ? A POP 405 ? 1_555 86.7 ? 96 O3 ? R POP . ? A POP 405 ? 1_555 MG ? O MG . ? A MG 402 ? 1_555 O6 ? R POP . ? A POP 405 ? 1_555 88.8 ? 97 OG ? B SER 213 ? A SER 213 ? 1_555 MG ? O MG . ? A MG 402 ? 1_555 O ? W HOH . ? A HOH 530 ? 1_555 90.0 ? 98 OE2 ? B GLU 217 ? A GLU 217 ? 1_555 MG ? O MG . ? A MG 402 ? 1_555 O ? W HOH . ? A HOH 530 ? 1_555 89.2 ? 99 O3 ? R POP . ? A POP 405 ? 1_555 MG ? O MG . ? A MG 402 ? 1_555 O ? W HOH . ? A HOH 530 ? 1_555 84.0 ? 100 O6 ? R POP . ? A POP 405 ? 1_555 MG ? O MG . ? A MG 402 ? 1_555 O ? W HOH . ? A HOH 530 ? 1_555 170.9 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-07-08 2 'Structure model' 1 1 2021-01-20 3 'Structure model' 1 2 2023-10-18 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 2 'Structure model' 'Derived calculations' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 2 'Structure model' pdbx_struct_conn_angle 4 2 'Structure model' struct_conn 5 3 'Structure model' chem_comp_atom 6 3 'Structure model' chem_comp_bond 7 3 'Structure model' database_2 8 3 'Structure model' pdbx_initial_refinement_model 9 3 'Structure model' struct_ncs_dom_lim # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.pdbx_database_id_PubMed' 10 2 'Structure model' '_citation.title' 11 2 'Structure model' '_citation.year' 12 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 13 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 14 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 15 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 16 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 17 2 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_seq_id' 18 2 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 19 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 20 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 21 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 22 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 23 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 24 2 'Structure model' '_pdbx_struct_conn_angle.value' 25 2 'Structure model' '_struct_conn.pdbx_dist_value' 26 2 'Structure model' '_struct_conn.ptnr1_auth_asym_id' 27 2 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 28 2 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 29 2 'Structure model' '_struct_conn.ptnr1_label_asym_id' 30 2 'Structure model' '_struct_conn.ptnr1_label_atom_id' 31 2 'Structure model' '_struct_conn.ptnr1_label_comp_id' 32 2 'Structure model' '_struct_conn.ptnr1_label_seq_id' 33 2 'Structure model' '_struct_conn.ptnr2_auth_asym_id' 34 2 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 35 2 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 36 2 'Structure model' '_struct_conn.ptnr2_label_asym_id' 37 2 'Structure model' '_struct_conn.ptnr2_label_atom_id' 38 2 'Structure model' '_struct_conn.ptnr2_label_comp_id' 39 3 'Structure model' '_database_2.pdbx_DOI' 40 3 'Structure model' '_database_2.pdbx_database_accession' 41 3 'Structure model' '_struct_ncs_dom_lim.beg_auth_comp_id' 42 3 'Structure model' '_struct_ncs_dom_lim.beg_label_asym_id' 43 3 'Structure model' '_struct_ncs_dom_lim.beg_label_comp_id' 44 3 'Structure model' '_struct_ncs_dom_lim.beg_label_seq_id' 45 3 'Structure model' '_struct_ncs_dom_lim.end_auth_comp_id' 46 3 'Structure model' '_struct_ncs_dom_lim.end_label_asym_id' 47 3 'Structure model' '_struct_ncs_dom_lim.end_label_comp_id' 48 3 'Structure model' '_struct_ncs_dom_lim.end_label_seq_id' # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x+1/2,-y+1/2,-z 3 -x,y+1/2,-z+1/2 4 -x+1/2,-y,z+1/2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.14_3260 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? iMOSFLM ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _pdbx_entry_details.entry_id 6W26 _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PHE I 32 ? ? -95.51 40.56 2 1 ILE I 51 ? ? -114.65 -74.44 3 1 ASN I 61 ? ? -172.82 90.28 4 1 PHE A 32 ? ? -95.72 41.02 5 1 ILE A 51 ? ? -116.29 -73.90 6 1 ASN A 61 ? ? -171.27 93.47 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 I GLU 6 ? CG ? A GLU 6 CG 2 1 Y 1 I GLU 6 ? CD ? A GLU 6 CD 3 1 Y 1 I GLU 6 ? OE1 ? A GLU 6 OE1 4 1 Y 1 I GLU 6 ? OE2 ? A GLU 6 OE2 5 1 Y 1 I ARG 15 ? CG ? A ARG 15 CG 6 1 Y 1 I ARG 15 ? CD ? A ARG 15 CD 7 1 Y 1 I ARG 15 ? NE ? A ARG 15 NE 8 1 Y 1 I ARG 15 ? CZ ? A ARG 15 CZ 9 1 Y 1 I ARG 15 ? NH1 ? A ARG 15 NH1 10 1 Y 1 I ARG 15 ? NH2 ? A ARG 15 NH2 11 1 Y 1 I LYS 26 ? CE ? A LYS 26 CE 12 1 Y 1 I LYS 26 ? NZ ? A LYS 26 NZ 13 1 Y 1 I GLU 105 ? CD ? A GLU 105 CD 14 1 Y 1 I GLU 105 ? OE1 ? A GLU 105 OE1 15 1 Y 1 I GLU 105 ? OE2 ? A GLU 105 OE2 16 1 Y 1 I GLU 111 ? CD ? A GLU 111 CD 17 1 Y 1 I GLU 111 ? OE1 ? A GLU 111 OE1 18 1 Y 1 I GLU 111 ? OE2 ? A GLU 111 OE2 19 1 Y 1 I GLN 127 ? CD ? A GLN 127 CD 20 1 Y 1 I GLN 127 ? OE1 ? A GLN 127 OE1 21 1 Y 1 I GLN 127 ? NE2 ? A GLN 127 NE2 22 1 Y 1 I LYS 134 ? CE ? A LYS 134 CE 23 1 Y 1 I LYS 134 ? NZ ? A LYS 134 NZ 24 1 Y 1 I GLU 159 ? CD ? A GLU 159 CD 25 1 Y 1 I GLU 159 ? OE1 ? A GLU 159 OE1 26 1 Y 1 I GLU 159 ? OE2 ? A GLU 159 OE2 27 1 Y 1 I GLN 189 ? CD ? A GLN 189 CD 28 1 Y 1 I GLN 189 ? OE1 ? A GLN 189 OE1 29 1 Y 1 I GLN 189 ? NE2 ? A GLN 189 NE2 30 1 Y 1 I LYS 270 ? CE ? A LYS 270 CE 31 1 Y 1 I LYS 270 ? NZ ? A LYS 270 NZ 32 1 Y 1 A TYR 4 ? CG ? B TYR 4 CG 33 1 Y 1 A TYR 4 ? CD1 ? B TYR 4 CD1 34 1 Y 1 A TYR 4 ? CD2 ? B TYR 4 CD2 35 1 Y 1 A TYR 4 ? CE1 ? B TYR 4 CE1 36 1 Y 1 A TYR 4 ? CE2 ? B TYR 4 CE2 37 1 Y 1 A TYR 4 ? CZ ? B TYR 4 CZ 38 1 Y 1 A TYR 4 ? OH ? B TYR 4 OH 39 1 Y 1 A GLU 6 ? CG ? B GLU 6 CG 40 1 Y 1 A GLU 6 ? CD ? B GLU 6 CD 41 1 Y 1 A GLU 6 ? OE1 ? B GLU 6 OE1 42 1 Y 1 A GLU 6 ? OE2 ? B GLU 6 OE2 43 1 Y 1 A LYS 26 ? CE ? B LYS 26 CE 44 1 Y 1 A LYS 26 ? NZ ? B LYS 26 NZ 45 1 Y 1 A HIS 41 ? CG ? B HIS 41 CG 46 1 Y 1 A HIS 41 ? ND1 ? B HIS 41 ND1 47 1 Y 1 A HIS 41 ? CD2 ? B HIS 41 CD2 48 1 Y 1 A HIS 41 ? CE1 ? B HIS 41 CE1 49 1 Y 1 A HIS 41 ? NE2 ? B HIS 41 NE2 50 1 Y 1 A SER 45 ? OG ? B SER 45 OG 51 1 Y 1 A LYS 49 ? CE ? B LYS 49 CE 52 1 Y 1 A LYS 49 ? NZ ? B LYS 49 NZ 53 1 Y 1 A HIS 62 ? CG ? B HIS 62 CG 54 1 Y 1 A HIS 62 ? ND1 ? B HIS 62 ND1 55 1 Y 1 A HIS 62 ? CD2 ? B HIS 62 CD2 56 1 Y 1 A HIS 62 ? CE1 ? B HIS 62 CE1 57 1 Y 1 A HIS 62 ? NE2 ? B HIS 62 NE2 58 1 Y 1 A LYS 138 ? CE ? B LYS 138 CE 59 1 Y 1 A LYS 138 ? NZ ? B LYS 138 NZ 60 1 Y 1 A LYS 149 ? CD ? B LYS 149 CD 61 1 Y 1 A LYS 149 ? CE ? B LYS 149 CE 62 1 Y 1 A LYS 149 ? NZ ? B LYS 149 NZ 63 1 Y 1 A ASP 154 ? CG ? B ASP 154 CG 64 1 Y 1 A ASP 154 ? OD1 ? B ASP 154 OD1 65 1 Y 1 A ASP 154 ? OD2 ? B ASP 154 OD2 66 1 Y 1 A GLN 156 ? CD ? B GLN 156 CD 67 1 Y 1 A GLN 156 ? OE1 ? B GLN 156 OE1 68 1 Y 1 A GLN 156 ? NE2 ? B GLN 156 NE2 69 1 Y 1 A GLU 159 ? CD ? B GLU 159 CD 70 1 Y 1 A GLU 159 ? OE1 ? B GLU 159 OE1 71 1 Y 1 A GLU 159 ? OE2 ? B GLU 159 OE2 72 1 Y 1 A ASP 304 ? CG ? B ASP 304 CG 73 1 Y 1 A ASP 304 ? OD1 ? B ASP 304 OD1 74 1 Y 1 A ASP 304 ? OD2 ? B ASP 304 OD2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 I MET 1 ? A MET 1 2 1 Y 1 I ASP 2 ? A ASP 2 3 1 Y 1 I PRO 3 ? A PRO 3 4 1 Y 1 I TYR 4 ? A TYR 4 5 1 Y 1 I GLY 271 ? A GLY 271 6 1 Y 1 I LEU 309 ? A LEU 309 7 1 Y 1 I GLU 310 ? A GLU 310 8 1 Y 1 I ALA 311 ? A ALA 311 9 1 Y 1 I CYS 312 ? A CYS 312 10 1 Y 1 I GLN 313 ? A GLN 313 11 1 Y 1 I HIS 314 ? A HIS 314 12 1 Y 1 I GLU 315 ? A GLU 315 13 1 Y 1 I GLY 316 ? A GLY 316 14 1 Y 1 A MET 1 ? B MET 1 15 1 Y 1 A ASP 2 ? B ASP 2 16 1 Y 1 A PRO 3 ? B PRO 3 17 1 Y 1 A ASN 101 ? B ASN 101 18 1 Y 1 A THR 102 ? B THR 102 19 1 Y 1 A SER 103 ? B SER 103 20 1 Y 1 A PRO 104 ? B PRO 104 21 1 Y 1 A GLU 105 ? B GLU 105 22 1 Y 1 A SER 106 ? B SER 106 23 1 Y 1 A GLU 107 ? B GLU 107 24 1 Y 1 A VAL 108 ? B VAL 108 25 1 Y 1 A GLN 109 ? B GLN 109 26 1 Y 1 A TYR 305 ? B TYR 305 27 1 Y 1 A ARG 306 ? B ARG 306 28 1 Y 1 A TYR 307 ? B TYR 307 29 1 Y 1 A GLY 308 ? B GLY 308 30 1 Y 1 A LEU 309 ? B LEU 309 31 1 Y 1 A GLU 310 ? B GLU 310 32 1 Y 1 A ALA 311 ? B ALA 311 33 1 Y 1 A CYS 312 ? B CYS 312 34 1 Y 1 A GLN 313 ? B GLN 313 35 1 Y 1 A HIS 314 ? B HIS 314 36 1 Y 1 A GLU 315 ? B GLU 315 37 1 Y 1 A GLY 316 ? B GLY 316 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 EDO C1 C N N 88 EDO O1 O N N 89 EDO C2 C N N 90 EDO O2 O N N 91 EDO H11 H N N 92 EDO H12 H N N 93 EDO HO1 H N N 94 EDO H21 H N N 95 EDO H22 H N N 96 EDO HO2 H N N 97 GLN N N N N 98 GLN CA C N S 99 GLN C C N N 100 GLN O O N N 101 GLN CB C N N 102 GLN CG C N N 103 GLN CD C N N 104 GLN OE1 O N N 105 GLN NE2 N N N 106 GLN OXT O N N 107 GLN H H N N 108 GLN H2 H N N 109 GLN HA H N N 110 GLN HB2 H N N 111 GLN HB3 H N N 112 GLN HG2 H N N 113 GLN HG3 H N N 114 GLN HE21 H N N 115 GLN HE22 H N N 116 GLN HXT H N N 117 GLU N N N N 118 GLU CA C N S 119 GLU C C N N 120 GLU O O N N 121 GLU CB C N N 122 GLU CG C N N 123 GLU CD C N N 124 GLU OE1 O N N 125 GLU OE2 O N N 126 GLU OXT O N N 127 GLU H H N N 128 GLU H2 H N N 129 GLU HA H N N 130 GLU HB2 H N N 131 GLU HB3 H N N 132 GLU HG2 H N N 133 GLU HG3 H N N 134 GLU HE2 H N N 135 GLU HXT H N N 136 GLY N N N N 137 GLY CA C N N 138 GLY C C N N 139 GLY O O N N 140 GLY OXT O N N 141 GLY H H N N 142 GLY H2 H N N 143 GLY HA2 H N N 144 GLY HA3 H N N 145 GLY HXT H N N 146 GOL C1 C N N 147 GOL O1 O N N 148 GOL C2 C N N 149 GOL O2 O N N 150 GOL C3 C N N 151 GOL O3 O N N 152 GOL H11 H N N 153 GOL H12 H N N 154 GOL HO1 H N N 155 GOL H2 H N N 156 GOL HO2 H N N 157 GOL H31 H N N 158 GOL H32 H N N 159 GOL HO3 H N N 160 HIS N N N N 161 HIS CA C N S 162 HIS C C N N 163 HIS O O N N 164 HIS CB C N N 165 HIS CG C Y N 166 HIS ND1 N Y N 167 HIS CD2 C Y N 168 HIS CE1 C Y N 169 HIS NE2 N Y N 170 HIS OXT O N N 171 HIS H H N N 172 HIS H2 H N N 173 HIS HA H N N 174 HIS HB2 H N N 175 HIS HB3 H N N 176 HIS HD1 H N N 177 HIS HD2 H N N 178 HIS HE1 H N N 179 HIS HE2 H N N 180 HIS HXT H N N 181 HOH O O N N 182 HOH H1 H N N 183 HOH H2 H N N 184 ILE N N N N 185 ILE CA C N S 186 ILE C C N N 187 ILE O O N N 188 ILE CB C N S 189 ILE CG1 C N N 190 ILE CG2 C N N 191 ILE CD1 C N N 192 ILE OXT O N N 193 ILE H H N N 194 ILE H2 H N N 195 ILE HA H N N 196 ILE HB H N N 197 ILE HG12 H N N 198 ILE HG13 H N N 199 ILE HG21 H N N 200 ILE HG22 H N N 201 ILE HG23 H N N 202 ILE HD11 H N N 203 ILE HD12 H N N 204 ILE HD13 H N N 205 ILE HXT H N N 206 IMD N1 N Y N 207 IMD C2 C Y N 208 IMD N3 N Y N 209 IMD C4 C Y N 210 IMD C5 C Y N 211 IMD HN1 H N N 212 IMD H2 H N N 213 IMD HN3 H N N 214 IMD H4 H N N 215 IMD H5 H N N 216 LEU N N N N 217 LEU CA C N S 218 LEU C C N N 219 LEU O O N N 220 LEU CB C N N 221 LEU CG C N N 222 LEU CD1 C N N 223 LEU CD2 C N N 224 LEU OXT O N N 225 LEU H H N N 226 LEU H2 H N N 227 LEU HA H N N 228 LEU HB2 H N N 229 LEU HB3 H N N 230 LEU HG H N N 231 LEU HD11 H N N 232 LEU HD12 H N N 233 LEU HD13 H N N 234 LEU HD21 H N N 235 LEU HD22 H N N 236 LEU HD23 H N N 237 LEU HXT H N N 238 LYS N N N N 239 LYS CA C N S 240 LYS C C N N 241 LYS O O N N 242 LYS CB C N N 243 LYS CG C N N 244 LYS CD C N N 245 LYS CE C N N 246 LYS NZ N N N 247 LYS OXT O N N 248 LYS H H N N 249 LYS H2 H N N 250 LYS HA H N N 251 LYS HB2 H N N 252 LYS HB3 H N N 253 LYS HG2 H N N 254 LYS HG3 H N N 255 LYS HD2 H N N 256 LYS HD3 H N N 257 LYS HE2 H N N 258 LYS HE3 H N N 259 LYS HZ1 H N N 260 LYS HZ2 H N N 261 LYS HZ3 H N N 262 LYS HXT H N N 263 MET N N N N 264 MET CA C N S 265 MET C C N N 266 MET O O N N 267 MET CB C N N 268 MET CG C N N 269 MET SD S N N 270 MET CE C N N 271 MET OXT O N N 272 MET H H N N 273 MET H2 H N N 274 MET HA H N N 275 MET HB2 H N N 276 MET HB3 H N N 277 MET HG2 H N N 278 MET HG3 H N N 279 MET HE1 H N N 280 MET HE2 H N N 281 MET HE3 H N N 282 MET HXT H N N 283 MG MG MG N N 284 NA NA NA N N 285 PHE N N N N 286 PHE CA C N S 287 PHE C C N N 288 PHE O O N N 289 PHE CB C N N 290 PHE CG C Y N 291 PHE CD1 C Y N 292 PHE CD2 C Y N 293 PHE CE1 C Y N 294 PHE CE2 C Y N 295 PHE CZ C Y N 296 PHE OXT O N N 297 PHE H H N N 298 PHE H2 H N N 299 PHE HA H N N 300 PHE HB2 H N N 301 PHE HB3 H N N 302 PHE HD1 H N N 303 PHE HD2 H N N 304 PHE HE1 H N N 305 PHE HE2 H N N 306 PHE HZ H N N 307 PHE HXT H N N 308 POP P1 P N N 309 POP O1 O N N 310 POP O2 O N N 311 POP O3 O N N 312 POP O O N N 313 POP P2 P N N 314 POP O4 O N N 315 POP O5 O N N 316 POP O6 O N N 317 POP HO2 H N N 318 POP HO5 H N N 319 PRO N N N N 320 PRO CA C N S 321 PRO C C N N 322 PRO O O N N 323 PRO CB C N N 324 PRO CG C N N 325 PRO CD C N N 326 PRO OXT O N N 327 PRO H H N N 328 PRO HA H N N 329 PRO HB2 H N N 330 PRO HB3 H N N 331 PRO HG2 H N N 332 PRO HG3 H N N 333 PRO HD2 H N N 334 PRO HD3 H N N 335 PRO HXT H N N 336 SER N N N N 337 SER CA C N S 338 SER C C N N 339 SER O O N N 340 SER CB C N N 341 SER OG O N N 342 SER OXT O N N 343 SER H H N N 344 SER H2 H N N 345 SER HA H N N 346 SER HB2 H N N 347 SER HB3 H N N 348 SER HG H N N 349 SER HXT H N N 350 SO4 S S N N 351 SO4 O1 O N N 352 SO4 O2 O N N 353 SO4 O3 O N N 354 SO4 O4 O N N 355 THR N N N N 356 THR CA C N S 357 THR C C N N 358 THR O O N N 359 THR CB C N R 360 THR OG1 O N N 361 THR CG2 C N N 362 THR OXT O N N 363 THR H H N N 364 THR H2 H N N 365 THR HA H N N 366 THR HB H N N 367 THR HG1 H N N 368 THR HG21 H N N 369 THR HG22 H N N 370 THR HG23 H N N 371 THR HXT H N N 372 TRP N N N N 373 TRP CA C N S 374 TRP C C N N 375 TRP O O N N 376 TRP CB C N N 377 TRP CG C Y N 378 TRP CD1 C Y N 379 TRP CD2 C Y N 380 TRP NE1 N Y N 381 TRP CE2 C Y N 382 TRP CE3 C Y N 383 TRP CZ2 C Y N 384 TRP CZ3 C Y N 385 TRP CH2 C Y N 386 TRP OXT O N N 387 TRP H H N N 388 TRP H2 H N N 389 TRP HA H N N 390 TRP HB2 H N N 391 TRP HB3 H N N 392 TRP HD1 H N N 393 TRP HE1 H N N 394 TRP HE3 H N N 395 TRP HZ2 H N N 396 TRP HZ3 H N N 397 TRP HH2 H N N 398 TRP HXT H N N 399 TYR N N N N 400 TYR CA C N S 401 TYR C C N N 402 TYR O O N N 403 TYR CB C N N 404 TYR CG C Y N 405 TYR CD1 C Y N 406 TYR CD2 C Y N 407 TYR CE1 C Y N 408 TYR CE2 C Y N 409 TYR CZ C Y N 410 TYR OH O N N 411 TYR OXT O N N 412 TYR H H N N 413 TYR H2 H N N 414 TYR HA H N N 415 TYR HB2 H N N 416 TYR HB3 H N N 417 TYR HD1 H N N 418 TYR HD2 H N N 419 TYR HE1 H N N 420 TYR HE2 H N N 421 TYR HH H N N 422 TYR HXT H N N 423 VAL N N N N 424 VAL CA C N S 425 VAL C C N N 426 VAL O O N N 427 VAL CB C N N 428 VAL CG1 C N N 429 VAL CG2 C N N 430 VAL OXT O N N 431 VAL H H N N 432 VAL H2 H N N 433 VAL HA H N N 434 VAL HB H N N 435 VAL HG11 H N N 436 VAL HG12 H N N 437 VAL HG13 H N N 438 VAL HG21 H N N 439 VAL HG22 H N N 440 VAL HG23 H N N 441 VAL HXT H N N 442 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 EDO C1 O1 sing N N 83 EDO C1 C2 sing N N 84 EDO C1 H11 sing N N 85 EDO C1 H12 sing N N 86 EDO O1 HO1 sing N N 87 EDO C2 O2 sing N N 88 EDO C2 H21 sing N N 89 EDO C2 H22 sing N N 90 EDO O2 HO2 sing N N 91 GLN N CA sing N N 92 GLN N H sing N N 93 GLN N H2 sing N N 94 GLN CA C sing N N 95 GLN CA CB sing N N 96 GLN CA HA sing N N 97 GLN C O doub N N 98 GLN C OXT sing N N 99 GLN CB CG sing N N 100 GLN CB HB2 sing N N 101 GLN CB HB3 sing N N 102 GLN CG CD sing N N 103 GLN CG HG2 sing N N 104 GLN CG HG3 sing N N 105 GLN CD OE1 doub N N 106 GLN CD NE2 sing N N 107 GLN NE2 HE21 sing N N 108 GLN NE2 HE22 sing N N 109 GLN OXT HXT sing N N 110 GLU N CA sing N N 111 GLU N H sing N N 112 GLU N H2 sing N N 113 GLU CA C sing N N 114 GLU CA CB sing N N 115 GLU CA HA sing N N 116 GLU C O doub N N 117 GLU C OXT sing N N 118 GLU CB CG sing N N 119 GLU CB HB2 sing N N 120 GLU CB HB3 sing N N 121 GLU CG CD sing N N 122 GLU CG HG2 sing N N 123 GLU CG HG3 sing N N 124 GLU CD OE1 doub N N 125 GLU CD OE2 sing N N 126 GLU OE2 HE2 sing N N 127 GLU OXT HXT sing N N 128 GLY N CA sing N N 129 GLY N H sing N N 130 GLY N H2 sing N N 131 GLY CA C sing N N 132 GLY CA HA2 sing N N 133 GLY CA HA3 sing N N 134 GLY C O doub N N 135 GLY C OXT sing N N 136 GLY OXT HXT sing N N 137 GOL C1 O1 sing N N 138 GOL C1 C2 sing N N 139 GOL C1 H11 sing N N 140 GOL C1 H12 sing N N 141 GOL O1 HO1 sing N N 142 GOL C2 O2 sing N N 143 GOL C2 C3 sing N N 144 GOL C2 H2 sing N N 145 GOL O2 HO2 sing N N 146 GOL C3 O3 sing N N 147 GOL C3 H31 sing N N 148 GOL C3 H32 sing N N 149 GOL O3 HO3 sing N N 150 HIS N CA sing N N 151 HIS N H sing N N 152 HIS N H2 sing N N 153 HIS CA C sing N N 154 HIS CA CB sing N N 155 HIS CA HA sing N N 156 HIS C O doub N N 157 HIS C OXT sing N N 158 HIS CB CG sing N N 159 HIS CB HB2 sing N N 160 HIS CB HB3 sing N N 161 HIS CG ND1 sing Y N 162 HIS CG CD2 doub Y N 163 HIS ND1 CE1 doub Y N 164 HIS ND1 HD1 sing N N 165 HIS CD2 NE2 sing Y N 166 HIS CD2 HD2 sing N N 167 HIS CE1 NE2 sing Y N 168 HIS CE1 HE1 sing N N 169 HIS NE2 HE2 sing N N 170 HIS OXT HXT sing N N 171 HOH O H1 sing N N 172 HOH O H2 sing N N 173 ILE N CA sing N N 174 ILE N H sing N N 175 ILE N H2 sing N N 176 ILE CA C sing N N 177 ILE CA CB sing N N 178 ILE CA HA sing N N 179 ILE C O doub N N 180 ILE C OXT sing N N 181 ILE CB CG1 sing N N 182 ILE CB CG2 sing N N 183 ILE CB HB sing N N 184 ILE CG1 CD1 sing N N 185 ILE CG1 HG12 sing N N 186 ILE CG1 HG13 sing N N 187 ILE CG2 HG21 sing N N 188 ILE CG2 HG22 sing N N 189 ILE CG2 HG23 sing N N 190 ILE CD1 HD11 sing N N 191 ILE CD1 HD12 sing N N 192 ILE CD1 HD13 sing N N 193 ILE OXT HXT sing N N 194 IMD N1 C2 sing Y N 195 IMD N1 C5 sing Y N 196 IMD N1 HN1 sing N N 197 IMD C2 N3 doub Y N 198 IMD C2 H2 sing N N 199 IMD N3 C4 sing Y N 200 IMD N3 HN3 sing N N 201 IMD C4 C5 doub Y N 202 IMD C4 H4 sing N N 203 IMD C5 H5 sing N N 204 LEU N CA sing N N 205 LEU N H sing N N 206 LEU N H2 sing N N 207 LEU CA C sing N N 208 LEU CA CB sing N N 209 LEU CA HA sing N N 210 LEU C O doub N N 211 LEU C OXT sing N N 212 LEU CB CG sing N N 213 LEU CB HB2 sing N N 214 LEU CB HB3 sing N N 215 LEU CG CD1 sing N N 216 LEU CG CD2 sing N N 217 LEU CG HG sing N N 218 LEU CD1 HD11 sing N N 219 LEU CD1 HD12 sing N N 220 LEU CD1 HD13 sing N N 221 LEU CD2 HD21 sing N N 222 LEU CD2 HD22 sing N N 223 LEU CD2 HD23 sing N N 224 LEU OXT HXT sing N N 225 LYS N CA sing N N 226 LYS N H sing N N 227 LYS N H2 sing N N 228 LYS CA C sing N N 229 LYS CA CB sing N N 230 LYS CA HA sing N N 231 LYS C O doub N N 232 LYS C OXT sing N N 233 LYS CB CG sing N N 234 LYS CB HB2 sing N N 235 LYS CB HB3 sing N N 236 LYS CG CD sing N N 237 LYS CG HG2 sing N N 238 LYS CG HG3 sing N N 239 LYS CD CE sing N N 240 LYS CD HD2 sing N N 241 LYS CD HD3 sing N N 242 LYS CE NZ sing N N 243 LYS CE HE2 sing N N 244 LYS CE HE3 sing N N 245 LYS NZ HZ1 sing N N 246 LYS NZ HZ2 sing N N 247 LYS NZ HZ3 sing N N 248 LYS OXT HXT sing N N 249 MET N CA sing N N 250 MET N H sing N N 251 MET N H2 sing N N 252 MET CA C sing N N 253 MET CA CB sing N N 254 MET CA HA sing N N 255 MET C O doub N N 256 MET C OXT sing N N 257 MET CB CG sing N N 258 MET CB HB2 sing N N 259 MET CB HB3 sing N N 260 MET CG SD sing N N 261 MET CG HG2 sing N N 262 MET CG HG3 sing N N 263 MET SD CE sing N N 264 MET CE HE1 sing N N 265 MET CE HE2 sing N N 266 MET CE HE3 sing N N 267 MET OXT HXT sing N N 268 PHE N CA sing N N 269 PHE N H sing N N 270 PHE N H2 sing N N 271 PHE CA C sing N N 272 PHE CA CB sing N N 273 PHE CA HA sing N N 274 PHE C O doub N N 275 PHE C OXT sing N N 276 PHE CB CG sing N N 277 PHE CB HB2 sing N N 278 PHE CB HB3 sing N N 279 PHE CG CD1 doub Y N 280 PHE CG CD2 sing Y N 281 PHE CD1 CE1 sing Y N 282 PHE CD1 HD1 sing N N 283 PHE CD2 CE2 doub Y N 284 PHE CD2 HD2 sing N N 285 PHE CE1 CZ doub Y N 286 PHE CE1 HE1 sing N N 287 PHE CE2 CZ sing Y N 288 PHE CE2 HE2 sing N N 289 PHE CZ HZ sing N N 290 PHE OXT HXT sing N N 291 POP P1 O1 doub N N 292 POP P1 O2 sing N N 293 POP P1 O3 sing N N 294 POP P1 O sing N N 295 POP O2 HO2 sing N N 296 POP O P2 sing N N 297 POP P2 O4 doub N N 298 POP P2 O5 sing N N 299 POP P2 O6 sing N N 300 POP O5 HO5 sing N N 301 PRO N CA sing N N 302 PRO N CD sing N N 303 PRO N H sing N N 304 PRO CA C sing N N 305 PRO CA CB sing N N 306 PRO CA HA sing N N 307 PRO C O doub N N 308 PRO C OXT sing N N 309 PRO CB CG sing N N 310 PRO CB HB2 sing N N 311 PRO CB HB3 sing N N 312 PRO CG CD sing N N 313 PRO CG HG2 sing N N 314 PRO CG HG3 sing N N 315 PRO CD HD2 sing N N 316 PRO CD HD3 sing N N 317 PRO OXT HXT sing N N 318 SER N CA sing N N 319 SER N H sing N N 320 SER N H2 sing N N 321 SER CA C sing N N 322 SER CA CB sing N N 323 SER CA HA sing N N 324 SER C O doub N N 325 SER C OXT sing N N 326 SER CB OG sing N N 327 SER CB HB2 sing N N 328 SER CB HB3 sing N N 329 SER OG HG sing N N 330 SER OXT HXT sing N N 331 SO4 S O1 doub N N 332 SO4 S O2 doub N N 333 SO4 S O3 sing N N 334 SO4 S O4 sing N N 335 THR N CA sing N N 336 THR N H sing N N 337 THR N H2 sing N N 338 THR CA C sing N N 339 THR CA CB sing N N 340 THR CA HA sing N N 341 THR C O doub N N 342 THR C OXT sing N N 343 THR CB OG1 sing N N 344 THR CB CG2 sing N N 345 THR CB HB sing N N 346 THR OG1 HG1 sing N N 347 THR CG2 HG21 sing N N 348 THR CG2 HG22 sing N N 349 THR CG2 HG23 sing N N 350 THR OXT HXT sing N N 351 TRP N CA sing N N 352 TRP N H sing N N 353 TRP N H2 sing N N 354 TRP CA C sing N N 355 TRP CA CB sing N N 356 TRP CA HA sing N N 357 TRP C O doub N N 358 TRP C OXT sing N N 359 TRP CB CG sing N N 360 TRP CB HB2 sing N N 361 TRP CB HB3 sing N N 362 TRP CG CD1 doub Y N 363 TRP CG CD2 sing Y N 364 TRP CD1 NE1 sing Y N 365 TRP CD1 HD1 sing N N 366 TRP CD2 CE2 doub Y N 367 TRP CD2 CE3 sing Y N 368 TRP NE1 CE2 sing Y N 369 TRP NE1 HE1 sing N N 370 TRP CE2 CZ2 sing Y N 371 TRP CE3 CZ3 doub Y N 372 TRP CE3 HE3 sing N N 373 TRP CZ2 CH2 doub Y N 374 TRP CZ2 HZ2 sing N N 375 TRP CZ3 CH2 sing Y N 376 TRP CZ3 HZ3 sing N N 377 TRP CH2 HH2 sing N N 378 TRP OXT HXT sing N N 379 TYR N CA sing N N 380 TYR N H sing N N 381 TYR N H2 sing N N 382 TYR CA C sing N N 383 TYR CA CB sing N N 384 TYR CA HA sing N N 385 TYR C O doub N N 386 TYR C OXT sing N N 387 TYR CB CG sing N N 388 TYR CB HB2 sing N N 389 TYR CB HB3 sing N N 390 TYR CG CD1 doub Y N 391 TYR CG CD2 sing Y N 392 TYR CD1 CE1 sing Y N 393 TYR CD1 HD1 sing N N 394 TYR CD2 CE2 doub Y N 395 TYR CD2 HD2 sing N N 396 TYR CE1 CZ doub Y N 397 TYR CE1 HE1 sing N N 398 TYR CE2 CZ sing Y N 399 TYR CE2 HE2 sing N N 400 TYR CZ OH sing N N 401 TYR OH HH sing N N 402 TYR OXT HXT sing N N 403 VAL N CA sing N N 404 VAL N H sing N N 405 VAL N H2 sing N N 406 VAL CA C sing N N 407 VAL CA CB sing N N 408 VAL CA HA sing N N 409 VAL C O doub N N 410 VAL C OXT sing N N 411 VAL CB CG1 sing N N 412 VAL CB CG2 sing N N 413 VAL CB HB sing N N 414 VAL CG1 HG11 sing N N 415 VAL CG1 HG12 sing N N 416 VAL CG1 HG13 sing N N 417 VAL CG2 HG21 sing N N 418 VAL CG2 HG22 sing N N 419 VAL CG2 HG23 sing N N 420 VAL OXT HXT sing N N 421 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Human Genome Research Institute (NIH/NHGRI)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number GM56838 _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id IMD _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id IMD _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SULFATE ION' SO4 3 'MAGNESIUM ION' MG 4 'SODIUM ION' NA 5 'PYROPHOSPHATE 2-' POP 6 IMIDAZOLE IMD 7 1,2-ETHANEDIOL EDO 8 GLYCEROL GOL 9 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5TD7 _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _space_group.name_H-M_alt 'P 21 21 21' _space_group.name_Hall 'P 2ac 2ab' _space_group.IT_number 19 _space_group.crystal_system orthorhombic _space_group.id 1 #