data_6W3D # _entry.id 6W3D # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.389 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6W3D pdb_00006w3d 10.2210/pdb6w3d/pdb WWPDB D_1000247548 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-04-15 2 'Structure model' 1 1 2020-09-09 3 'Structure model' 1 2 2020-09-16 4 'Structure model' 1 3 2021-06-23 5 'Structure model' 1 4 2024-03-06 6 'Structure model' 1 5 2024-04-03 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Structure summary' 4 5 'Structure model' 'Data collection' 5 5 'Structure model' 'Database references' 6 6 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 4 'Structure model' audit_author 5 5 'Structure model' chem_comp_atom 6 5 'Structure model' chem_comp_bond 7 5 'Structure model' database_2 8 6 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.pdbx_database_id_DOI' 7 2 'Structure model' '_citation.pdbx_database_id_PubMed' 8 2 'Structure model' '_citation.title' 9 2 'Structure model' '_citation.year' 10 2 'Structure model' '_citation_author.identifier_ORCID' 11 2 'Structure model' '_citation_author.name' 12 3 'Structure model' '_citation.journal_volume' 13 3 'Structure model' '_citation.page_first' 14 3 'Structure model' '_citation.page_last' 15 5 'Structure model' '_database_2.pdbx_DOI' 16 5 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6W3D _pdbx_database_status.recvd_initial_deposition_date 2020-03-09 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Bick, M.J.' 1 0000-0002-9585-859X 'Basanta, B.' 2 0000-0003-1118-5269 'Sankaran, B.' 3 ? 'Baker, D.' 4 0000-0001-7896-6217 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Proc.Natl.Acad.Sci.USA _citation.journal_id_ASTM PNASA6 _citation.journal_id_CSD 0040 _citation.journal_id_ISSN 1091-6490 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 117 _citation.language ? _citation.page_first 22135 _citation.page_last 22145 _citation.title 'An enumerative algorithm for de novo design of proteins with diverse pocket structures.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1073/pnas.2005412117 _citation.pdbx_database_id_PubMed 32839327 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Basanta, B.' 1 0000-0003-1118-5269 primary 'Bick, M.J.' 2 0000-0002-9585-859X primary 'Bera, A.K.' 3 ? primary 'Norn, C.' 4 0000-0002-1450-4651 primary 'Chow, C.M.' 5 0000-0001-5351-6412 primary 'Carter, L.P.' 6 ? primary 'Goreshnik, I.' 7 ? primary 'Dimaio, F.' 8 ? primary 'Baker, D.' 9 0000-0001-7896-6217 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Rd1NTF2_05 15705.792 1 ? ? ? ? 2 water nat water 18.015 57 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGSHHHHHHGSENLYFQSGSGSDENDTARKIIKTLLDIMREGDEDKLRDQMDPNVRADVGDKTVHGREHAAKFLAHIVKR ADHISITLKSLHNHNGRLRMQAEVRIVHNGRTERVTLEMVFRDHNGKLLIERMKYG ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSHHHHHHGSENLYFQSGSGSDENDTARKIIKTLLDIMREGDEDKLRDQMDPNVRADVGDKTVHGREHAAKFLAHIVKR ADHISITLKSLHNHNGRLRMQAEVRIVHNGRTERVTLEMVFRDHNGKLLIERMKYG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 GLY n 1 11 SER n 1 12 GLU n 1 13 ASN n 1 14 LEU n 1 15 TYR n 1 16 PHE n 1 17 GLN n 1 18 SER n 1 19 GLY n 1 20 SER n 1 21 GLY n 1 22 SER n 1 23 ASP n 1 24 GLU n 1 25 ASN n 1 26 ASP n 1 27 THR n 1 28 ALA n 1 29 ARG n 1 30 LYS n 1 31 ILE n 1 32 ILE n 1 33 LYS n 1 34 THR n 1 35 LEU n 1 36 LEU n 1 37 ASP n 1 38 ILE n 1 39 MET n 1 40 ARG n 1 41 GLU n 1 42 GLY n 1 43 ASP n 1 44 GLU n 1 45 ASP n 1 46 LYS n 1 47 LEU n 1 48 ARG n 1 49 ASP n 1 50 GLN n 1 51 MET n 1 52 ASP n 1 53 PRO n 1 54 ASN n 1 55 VAL n 1 56 ARG n 1 57 ALA n 1 58 ASP n 1 59 VAL n 1 60 GLY n 1 61 ASP n 1 62 LYS n 1 63 THR n 1 64 VAL n 1 65 HIS n 1 66 GLY n 1 67 ARG n 1 68 GLU n 1 69 HIS n 1 70 ALA n 1 71 ALA n 1 72 LYS n 1 73 PHE n 1 74 LEU n 1 75 ALA n 1 76 HIS n 1 77 ILE n 1 78 VAL n 1 79 LYS n 1 80 ARG n 1 81 ALA n 1 82 ASP n 1 83 HIS n 1 84 ILE n 1 85 SER n 1 86 ILE n 1 87 THR n 1 88 LEU n 1 89 LYS n 1 90 SER n 1 91 LEU n 1 92 HIS n 1 93 ASN n 1 94 HIS n 1 95 ASN n 1 96 GLY n 1 97 ARG n 1 98 LEU n 1 99 ARG n 1 100 MET n 1 101 GLN n 1 102 ALA n 1 103 GLU n 1 104 VAL n 1 105 ARG n 1 106 ILE n 1 107 VAL n 1 108 HIS n 1 109 ASN n 1 110 GLY n 1 111 ARG n 1 112 THR n 1 113 GLU n 1 114 ARG n 1 115 VAL n 1 116 THR n 1 117 LEU n 1 118 GLU n 1 119 MET n 1 120 VAL n 1 121 PHE n 1 122 ARG n 1 123 ASP n 1 124 HIS n 1 125 ASN n 1 126 GLY n 1 127 LYS n 1 128 LEU n 1 129 LEU n 1 130 ILE n 1 131 GLU n 1 132 ARG n 1 133 MET n 1 134 LYS n 1 135 TYR n 1 136 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 136 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'synthetic construct' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 32630 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain Lemo21 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET29b _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -21 ? ? ? A . n A 1 2 GLY 2 -20 ? ? ? A . n A 1 3 SER 3 -19 ? ? ? A . n A 1 4 HIS 4 -18 ? ? ? A . n A 1 5 HIS 5 -17 ? ? ? A . n A 1 6 HIS 6 -16 ? ? ? A . n A 1 7 HIS 7 -15 ? ? ? A . n A 1 8 HIS 8 -14 ? ? ? A . n A 1 9 HIS 9 -13 ? ? ? A . n A 1 10 GLY 10 -12 ? ? ? A . n A 1 11 SER 11 -11 ? ? ? A . n A 1 12 GLU 12 -10 ? ? ? A . n A 1 13 ASN 13 -9 ? ? ? A . n A 1 14 LEU 14 -8 -8 LEU ALA A . n A 1 15 TYR 15 -7 -7 TYR ALA A . n A 1 16 PHE 16 -6 -6 PHE ALA A . n A 1 17 GLN 17 -5 -5 GLN ALA A . n A 1 18 SER 18 -4 ? ? ? A . n A 1 19 GLY 19 -3 ? ? ? A . n A 1 20 SER 20 -2 ? ? ? A . n A 1 21 GLY 21 -1 ? ? ? A . n A 1 22 SER 22 0 ? ? ? A . n A 1 23 ASP 23 1 ? ? ? A . n A 1 24 GLU 24 2 ? ? ? A . n A 1 25 ASN 25 3 3 ASN ASN A . n A 1 26 ASP 26 4 4 ASP ASP A . n A 1 27 THR 27 5 5 THR THR A . n A 1 28 ALA 28 6 6 ALA ALA A . n A 1 29 ARG 29 7 7 ARG ARG A . n A 1 30 LYS 30 8 8 LYS LYS A . n A 1 31 ILE 31 9 9 ILE ILE A . n A 1 32 ILE 32 10 10 ILE ILE A . n A 1 33 LYS 33 11 11 LYS LYS A . n A 1 34 THR 34 12 12 THR THR A . n A 1 35 LEU 35 13 13 LEU LEU A . n A 1 36 LEU 36 14 14 LEU LEU A . n A 1 37 ASP 37 15 15 ASP ASP A . n A 1 38 ILE 38 16 16 ILE ILE A . n A 1 39 MET 39 17 17 MET MET A . n A 1 40 ARG 40 18 18 ARG ARG A . n A 1 41 GLU 41 19 19 GLU GLU A . n A 1 42 GLY 42 20 20 GLY GLY A . n A 1 43 ASP 43 21 21 ASP ASP A . n A 1 44 GLU 44 22 22 GLU GLU A . n A 1 45 ASP 45 23 23 ASP ASP A . n A 1 46 LYS 46 24 24 LYS LYS A . n A 1 47 LEU 47 25 25 LEU LEU A . n A 1 48 ARG 48 26 26 ARG ARG A . n A 1 49 ASP 49 27 27 ASP ASP A . n A 1 50 GLN 50 28 28 GLN GLN A . n A 1 51 MET 51 29 29 MET MET A . n A 1 52 ASP 52 30 30 ASP ASP A . n A 1 53 PRO 53 31 31 PRO PRO A . n A 1 54 ASN 54 32 32 ASN ASN A . n A 1 55 VAL 55 33 33 VAL VAL A . n A 1 56 ARG 56 34 34 ARG ARG A . n A 1 57 ALA 57 35 35 ALA ALA A . n A 1 58 ASP 58 36 36 ASP ASP A . n A 1 59 VAL 59 37 37 VAL VAL A . n A 1 60 GLY 60 38 38 GLY GLY A . n A 1 61 ASP 61 39 39 ASP ASP A . n A 1 62 LYS 62 40 40 LYS LYS A . n A 1 63 THR 63 41 41 THR THR A . n A 1 64 VAL 64 42 42 VAL VAL A . n A 1 65 HIS 65 43 43 HIS HIS A . n A 1 66 GLY 66 44 44 GLY GLY A . n A 1 67 ARG 67 45 45 ARG ARG A . n A 1 68 GLU 68 46 46 GLU GLU A . n A 1 69 HIS 69 47 47 HIS HIS A . n A 1 70 ALA 70 48 48 ALA ALA A . n A 1 71 ALA 71 49 49 ALA ALA A . n A 1 72 LYS 72 50 50 LYS LYS A . n A 1 73 PHE 73 51 51 PHE PHE A . n A 1 74 LEU 74 52 52 LEU LEU A . n A 1 75 ALA 75 53 53 ALA ALA A . n A 1 76 HIS 76 54 54 HIS HIS A . n A 1 77 ILE 77 55 55 ILE ILE A . n A 1 78 VAL 78 56 56 VAL VAL A . n A 1 79 LYS 79 57 57 LYS LYS A . n A 1 80 ARG 80 58 58 ARG ARG A . n A 1 81 ALA 81 59 59 ALA ALA A . n A 1 82 ASP 82 60 60 ASP ASP A . n A 1 83 HIS 83 61 61 HIS HIS A . n A 1 84 ILE 84 62 62 ILE ILE A . n A 1 85 SER 85 63 63 SER SER A . n A 1 86 ILE 86 64 64 ILE ILE A . n A 1 87 THR 87 65 65 THR THR A . n A 1 88 LEU 88 66 66 LEU LEU A . n A 1 89 LYS 89 67 67 LYS LYS A . n A 1 90 SER 90 68 68 SER SER A . n A 1 91 LEU 91 69 69 LEU LEU A . n A 1 92 HIS 92 70 70 HIS HIS A . n A 1 93 ASN 93 71 71 ASN ASN A . n A 1 94 HIS 94 72 72 HIS HIS A . n A 1 95 ASN 95 73 73 ASN ASN A . n A 1 96 GLY 96 74 74 GLY GLY A . n A 1 97 ARG 97 75 75 ARG ARG A . n A 1 98 LEU 98 76 76 LEU LEU A . n A 1 99 ARG 99 77 77 ARG ARG A . n A 1 100 MET 100 78 78 MET MET A . n A 1 101 GLN 101 79 79 GLN GLN A . n A 1 102 ALA 102 80 80 ALA ALA A . n A 1 103 GLU 103 81 81 GLU GLU A . n A 1 104 VAL 104 82 82 VAL VAL A . n A 1 105 ARG 105 83 83 ARG ARG A . n A 1 106 ILE 106 84 84 ILE ILE A . n A 1 107 VAL 107 85 85 VAL VAL A . n A 1 108 HIS 108 86 86 HIS HIS A . n A 1 109 ASN 109 87 87 ASN ASN A . n A 1 110 GLY 110 88 88 GLY GLY A . n A 1 111 ARG 111 89 89 ARG ARG A . n A 1 112 THR 112 90 90 THR THR A . n A 1 113 GLU 113 91 91 GLU GLU A . n A 1 114 ARG 114 92 92 ARG ARG A . n A 1 115 VAL 115 93 93 VAL VAL A . n A 1 116 THR 116 94 94 THR THR A . n A 1 117 LEU 117 95 95 LEU LEU A . n A 1 118 GLU 118 96 96 GLU GLU A . n A 1 119 MET 119 97 97 MET MET A . n A 1 120 VAL 120 98 98 VAL VAL A . n A 1 121 PHE 121 99 99 PHE PHE A . n A 1 122 ARG 122 100 100 ARG ARG A . n A 1 123 ASP 123 101 101 ASP ASP A . n A 1 124 HIS 124 102 102 HIS HIS A . n A 1 125 ASN 125 103 103 ASN ASN A . n A 1 126 GLY 126 104 104 GLY GLY A . n A 1 127 LYS 127 105 105 LYS LYS A . n A 1 128 LEU 128 106 106 LEU LEU A . n A 1 129 LEU 129 107 107 LEU LEU A . n A 1 130 ILE 130 108 108 ILE ILE A . n A 1 131 GLU 131 109 109 GLU GLU A . n A 1 132 ARG 132 110 110 ARG ARG A . n A 1 133 MET 133 111 111 MET MET A . n A 1 134 LYS 134 112 112 LYS LYS A . n A 1 135 TYR 135 113 113 TYR TYR A . n A 1 136 GLY 136 114 114 GLY GLY A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 201 54 HOH HOH A . B 2 HOH 2 202 25 HOH HOH A . B 2 HOH 3 203 15 HOH HOH A . B 2 HOH 4 204 36 HOH HOH A . B 2 HOH 5 205 38 HOH HOH A . B 2 HOH 6 206 12 HOH HOH A . B 2 HOH 7 207 8 HOH HOH A . B 2 HOH 8 208 33 HOH HOH A . B 2 HOH 9 209 41 HOH HOH A . B 2 HOH 10 210 28 HOH HOH A . B 2 HOH 11 211 44 HOH HOH A . B 2 HOH 12 212 11 HOH HOH A . B 2 HOH 13 213 13 HOH HOH A . B 2 HOH 14 214 49 HOH HOH A . B 2 HOH 15 215 1 HOH HOH A . B 2 HOH 16 216 22 HOH HOH A . B 2 HOH 17 217 39 HOH HOH A . B 2 HOH 18 218 52 HOH HOH A . B 2 HOH 19 219 4 HOH HOH A . B 2 HOH 20 220 7 HOH HOH A . B 2 HOH 21 221 30 HOH HOH A . B 2 HOH 22 222 35 HOH HOH A . B 2 HOH 23 223 14 HOH HOH A . B 2 HOH 24 224 17 HOH HOH A . B 2 HOH 25 225 10 HOH HOH A . B 2 HOH 26 226 3 HOH HOH A . B 2 HOH 27 227 20 HOH HOH A . B 2 HOH 28 228 31 HOH HOH A . B 2 HOH 29 229 2 HOH HOH A . B 2 HOH 30 230 56 HOH HOH A . B 2 HOH 31 231 47 HOH HOH A . B 2 HOH 32 232 53 HOH HOH A . B 2 HOH 33 233 34 HOH HOH A . B 2 HOH 34 234 18 HOH HOH A . B 2 HOH 35 235 9 HOH HOH A . B 2 HOH 36 236 27 HOH HOH A . B 2 HOH 37 237 21 HOH HOH A . B 2 HOH 38 238 42 HOH HOH A . B 2 HOH 39 239 26 HOH HOH A . B 2 HOH 40 240 5 HOH HOH A . B 2 HOH 41 241 16 HOH HOH A . B 2 HOH 42 242 37 HOH HOH A . B 2 HOH 43 243 43 HOH HOH A . B 2 HOH 44 244 6 HOH HOH A . B 2 HOH 45 245 55 HOH HOH A . B 2 HOH 46 246 40 HOH HOH A . B 2 HOH 47 247 48 HOH HOH A . B 2 HOH 48 248 24 HOH HOH A . B 2 HOH 49 249 51 HOH HOH A . B 2 HOH 50 250 29 HOH HOH A . B 2 HOH 51 251 19 HOH HOH A . B 2 HOH 52 252 46 HOH HOH A . B 2 HOH 53 253 45 HOH HOH A . B 2 HOH 54 254 50 HOH HOH A . B 2 HOH 55 255 23 HOH HOH A . B 2 HOH 56 256 57 HOH HOH A . B 2 HOH 57 257 32 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LEU -8 ? CG ? A LEU 14 CG 2 1 Y 1 A LEU -8 ? CD1 ? A LEU 14 CD1 3 1 Y 1 A LEU -8 ? CD2 ? A LEU 14 CD2 4 1 Y 1 A TYR -7 ? CG ? A TYR 15 CG 5 1 Y 1 A TYR -7 ? CD1 ? A TYR 15 CD1 6 1 Y 1 A TYR -7 ? CD2 ? A TYR 15 CD2 7 1 Y 1 A TYR -7 ? CE1 ? A TYR 15 CE1 8 1 Y 1 A TYR -7 ? CE2 ? A TYR 15 CE2 9 1 Y 1 A TYR -7 ? CZ ? A TYR 15 CZ 10 1 Y 1 A TYR -7 ? OH ? A TYR 15 OH 11 1 Y 1 A PHE -6 ? CG ? A PHE 16 CG 12 1 Y 1 A PHE -6 ? CD1 ? A PHE 16 CD1 13 1 Y 1 A PHE -6 ? CD2 ? A PHE 16 CD2 14 1 Y 1 A PHE -6 ? CE1 ? A PHE 16 CE1 15 1 Y 1 A PHE -6 ? CE2 ? A PHE 16 CE2 16 1 Y 1 A PHE -6 ? CZ ? A PHE 16 CZ 17 1 Y 1 A GLN -5 ? CG ? A GLN 17 CG 18 1 Y 1 A GLN -5 ? CD ? A GLN 17 CD 19 1 Y 1 A GLN -5 ? OE1 ? A GLN 17 OE1 20 1 Y 1 A GLN -5 ? NE2 ? A GLN 17 NE2 21 1 Y 1 A ASN 3 ? N ? A ASN 25 N 22 1 Y 1 A ASN 3 ? CA ? A ASN 25 CA 23 1 Y 1 A ASN 3 ? CB ? A ASN 25 CB 24 1 Y 1 A ASN 3 ? CG ? A ASN 25 CG 25 1 Y 1 A ASN 3 ? OD1 ? A ASN 25 OD1 26 1 Y 1 A ASN 3 ? ND2 ? A ASN 25 ND2 27 1 Y 1 A ASP 4 ? CG ? A ASP 26 CG 28 1 Y 1 A ASP 4 ? OD1 ? A ASP 26 OD1 29 1 Y 1 A ASP 4 ? OD2 ? A ASP 26 OD2 30 1 Y 1 A ARG 7 ? CD ? A ARG 29 CD 31 1 Y 1 A ARG 7 ? NE ? A ARG 29 NE 32 1 Y 1 A ARG 7 ? CZ ? A ARG 29 CZ 33 1 Y 1 A ARG 7 ? NH1 ? A ARG 29 NH1 34 1 Y 1 A ARG 7 ? NH2 ? A ARG 29 NH2 35 1 Y 1 A LYS 8 ? CG ? A LYS 30 CG 36 1 Y 1 A LYS 8 ? CD ? A LYS 30 CD 37 1 Y 1 A LYS 8 ? CE ? A LYS 30 CE 38 1 Y 1 A LYS 8 ? NZ ? A LYS 30 NZ 39 1 Y 1 A LYS 11 ? CD ? A LYS 33 CD 40 1 Y 1 A LYS 11 ? CE ? A LYS 33 CE 41 1 Y 1 A LYS 11 ? NZ ? A LYS 33 NZ 42 1 Y 1 A ASP 39 ? CG ? A ASP 61 CG 43 1 Y 1 A ASP 39 ? OD1 ? A ASP 61 OD1 44 1 Y 1 A ASP 39 ? OD2 ? A ASP 61 OD2 45 1 Y 1 A LYS 40 ? CD ? A LYS 62 CD 46 1 Y 1 A LYS 40 ? CE ? A LYS 62 CE 47 1 Y 1 A LYS 40 ? NZ ? A LYS 62 NZ 48 1 Y 1 A GLU 46 ? CD ? A GLU 68 CD 49 1 Y 1 A GLU 46 ? OE1 ? A GLU 68 OE1 50 1 Y 1 A GLU 46 ? OE2 ? A GLU 68 OE2 51 1 Y 1 A LYS 50 ? NZ ? A LYS 72 NZ 52 1 Y 1 A LYS 57 ? CG ? A LYS 79 CG 53 1 Y 1 A LYS 57 ? CD ? A LYS 79 CD 54 1 Y 1 A LYS 57 ? CE ? A LYS 79 CE 55 1 Y 1 A LYS 57 ? NZ ? A LYS 79 NZ 56 1 Y 1 A ARG 58 ? CG ? A ARG 80 CG 57 1 Y 1 A ARG 58 ? CD ? A ARG 80 CD 58 1 Y 1 A ARG 58 ? NE ? A ARG 80 NE 59 1 Y 1 A ARG 58 ? CZ ? A ARG 80 CZ 60 1 Y 1 A ARG 58 ? NH1 ? A ARG 80 NH1 61 1 Y 1 A ARG 58 ? NH2 ? A ARG 80 NH2 62 1 Y 1 A HIS 72 ? CG ? A HIS 94 CG 63 1 Y 1 A HIS 72 ? ND1 ? A HIS 94 ND1 64 1 Y 1 A HIS 72 ? CD2 ? A HIS 94 CD2 65 1 Y 1 A HIS 72 ? CE1 ? A HIS 94 CE1 66 1 Y 1 A HIS 72 ? NE2 ? A HIS 94 NE2 67 1 Y 1 A ASN 73 ? CG ? A ASN 95 CG 68 1 Y 1 A ASN 73 ? OD1 ? A ASN 95 OD1 69 1 Y 1 A ASN 73 ? ND2 ? A ASN 95 ND2 70 1 Y 1 A ARG 83 ? CZ ? A ARG 105 CZ 71 1 Y 1 A ARG 83 ? NH1 ? A ARG 105 NH1 72 1 Y 1 A ARG 83 ? NH2 ? A ARG 105 NH2 73 1 Y 1 A HIS 86 ? CG ? A HIS 108 CG 74 1 Y 1 A HIS 86 ? ND1 ? A HIS 108 ND1 75 1 Y 1 A HIS 86 ? CD2 ? A HIS 108 CD2 76 1 Y 1 A HIS 86 ? CE1 ? A HIS 108 CE1 77 1 Y 1 A HIS 86 ? NE2 ? A HIS 108 NE2 78 1 Y 1 A ASN 87 ? CG ? A ASN 109 CG 79 1 Y 1 A ASN 87 ? OD1 ? A ASN 109 OD1 80 1 Y 1 A ASN 87 ? ND2 ? A ASN 109 ND2 81 1 Y 1 A ARG 92 ? CD ? A ARG 114 CD 82 1 Y 1 A ARG 92 ? NE ? A ARG 114 NE 83 1 Y 1 A ARG 92 ? CZ ? A ARG 114 CZ 84 1 Y 1 A ARG 92 ? NH1 ? A ARG 114 NH1 85 1 Y 1 A ARG 92 ? NH2 ? A ARG 114 NH2 86 1 Y 1 A ASP 101 ? CG ? A ASP 123 CG 87 1 Y 1 A ASP 101 ? OD1 ? A ASP 123 OD1 88 1 Y 1 A ASP 101 ? OD2 ? A ASP 123 OD2 89 1 Y 1 A LYS 105 ? CD ? A LYS 127 CD 90 1 Y 1 A LYS 105 ? CE ? A LYS 127 CE 91 1 Y 1 A LYS 105 ? NZ ? A LYS 127 NZ 92 1 Y 1 A LYS 112 ? CE ? A LYS 134 CE 93 1 Y 1 A LYS 112 ? NZ ? A LYS 134 NZ 94 1 Y 1 A GLY 114 ? C ? A GLY 136 C 95 1 Y 1 A GLY 114 ? O ? A GLY 136 O # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.5.27 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? dev-3026 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? 'Jun 17, 2015' 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 97.840 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6W3D _cell.details ? _cell.formula_units_Z ? _cell.length_a 60.076 _cell.length_a_esd ? _cell.length_b 30.498 _cell.length_b_esd ? _cell.length_c 61.099 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6W3D _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6W3D _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.77 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 30.32 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;Protein at 56mg/ml, then 1:1 dilution in 0.09M Sodium fluoride; 0.09M Sodium bromide; 0.09M Sodium iodide, 0.1M Tris/BICINE pH 8.5, 50% v/v of 40% v/v PEG 500 MME; 20 % w/v PEG 20000 ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details 'Liquid nitrogen cryo stream' _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-02-28 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.999995 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ALS BEAMLINE 8.2.2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.999995 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 8.2.2 _diffrn_source.pdbx_synchrotron_site ALS # _reflns.B_iso_Wilson_estimate 20.240 _reflns.entry_id 6W3D _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.380 _reflns.d_resolution_low 28.2750 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 22794 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.800 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 4.400 _reflns.pdbx_Rmerge_I_obs 0.037 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 18.300 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.042 _reflns.pdbx_Rpim_I_all 0.020 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 1.000 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split 1.380 1.400 ? ? 4992 ? ? ? 1144 100.000 ? ? ? ? 1.909 ? ? ? ? ? ? ? ? 4.400 ? ? ? 0.800 2.175 1.030 ? 1 1 0.306 ? ? 7.560 28.270 ? ? 495 ? ? ? 136 85.000 ? ? ? ? 0.019 ? ? ? ? ? ? ? ? 3.600 ? ? ? 61.100 0.022 0.011 ? 2 1 0.999 ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 100.400 _refine.B_iso_mean 32.1968 _refine.B_iso_min 15.670 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6W3D _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.3800 _refine.ls_d_res_low 28.2750 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 22779 _refine.ls_number_reflns_R_free 1997 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.6600 _refine.ls_percent_reflns_R_free 8.7700 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1855 _refine.ls_R_factor_R_free 0.2158 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1825 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.340 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 'Computational design model' _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 24.8000 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.1700 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 1.3800 _refine_hist.d_res_low 28.2750 _refine_hist.number_atoms_solvent 57 _refine_hist.number_atoms_total 913 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 116 _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent 38.31 _refine_hist.pdbx_number_atoms_protein 856 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function f_bond_d 0.019 ? ? 963 'X-RAY DIFFRACTION' ? f_angle_d 1.549 ? ? 1305 'X-RAY DIFFRACTION' ? f_dihedral_angle_d 19.415 ? ? 349 'X-RAY DIFFRACTION' ? f_chiral_restr 0.115 ? ? 157 'X-RAY DIFFRACTION' ? f_plane_restr 0.010 ? ? 172 'X-RAY DIFFRACTION' ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.3800 1.4145 . . 139 1464 100.0000 . . . 0.3533 0.0000 0.3205 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.4145 1.4528 . . 143 1492 100.0000 . . . 0.3289 0.0000 0.2716 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.4528 1.4955 . . 142 1467 100.0000 . . . 0.3087 0.0000 0.2405 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.4955 1.5438 . . 139 1455 100.0000 . . . 0.2248 0.0000 0.2078 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.5438 1.5989 . . 144 1499 100.0000 . . . 0.3022 0.0000 0.1829 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.5989 1.6630 . . 142 1471 100.0000 . . . 0.2187 0.0000 0.1807 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.6630 1.7386 . . 140 1464 100.0000 . . . 0.2380 0.0000 0.1770 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.7386 1.8303 . . 143 1487 100.0000 . . . 0.2233 0.0000 0.1696 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.8303 1.9449 . . 143 1487 100.0000 . . . 0.2277 0.0000 0.1526 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.9449 2.0951 . . 144 1487 100.0000 . . . 0.2117 0.0000 0.1478 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.0951 2.3058 . . 142 1474 100.0000 . . . 0.2059 0.0000 0.1521 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.3058 2.6392 . . 145 1505 100.0000 . . . 0.1917 0.0000 0.1664 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.6392 3.3243 . . 143 1500 100.0000 . . . 0.1956 0.0000 0.1933 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.3243 28.2750 . . 148 1530 98.0000 . . . 0.2119 0.0000 0.1926 . . . . . . . . . . . # _struct.entry_id 6W3D _struct.title 'Rd1NTF2_05 with long sheet' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6W3D _struct_keywords.text 'NTF2-like, synthetic, BIOSYNTHETIC PROTEIN' _struct_keywords.pdbx_keywords 'BIOSYNTHETIC PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 6W3D _struct_ref.pdbx_db_accession 6W3D _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6W3D _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 136 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 6W3D _struct_ref_seq.db_align_beg -21 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 114 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg -21 _struct_ref_seq.pdbx_auth_seq_align_end 114 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details 'SEC followed by multi-angle light scattering' # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 26 ? GLY A 42 ? ASP A 4 GLY A 20 1 ? 17 HELX_P HELX_P2 AA2 ASP A 43 ? ASP A 49 ? ASP A 21 ASP A 27 1 ? 7 HELX_P HELX_P3 AA3 GLY A 66 ? ARG A 80 ? GLY A 44 ARG A 58 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 6 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LYS A 62 ? HIS A 65 ? LYS A 40 HIS A 43 AA1 2 MET A 51 ? VAL A 59 ? MET A 29 VAL A 37 AA1 3 LYS A 127 ? TYR A 135 ? LYS A 105 TYR A 113 AA1 4 ARG A 111 ? ARG A 122 ? ARG A 89 ARG A 100 AA1 5 ARG A 97 ? HIS A 108 ? ARG A 75 HIS A 86 AA1 6 HIS A 83 ? HIS A 94 ? HIS A 61 HIS A 72 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O VAL A 64 ? O VAL A 42 N ALA A 57 ? N ALA A 35 AA1 2 3 N ASP A 58 ? N ASP A 36 O MET A 133 ? O MET A 111 AA1 3 4 O ARG A 132 ? O ARG A 110 N GLU A 118 ? N GLU A 96 AA1 4 5 O VAL A 115 ? O VAL A 93 N VAL A 104 ? N VAL A 82 AA1 5 6 O GLU A 103 ? O GLU A 81 N THR A 87 ? N THR A 65 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 H A GLY 88 ? B O A HOH 201 ? ? 1.12 2 1 HE21 A GLN 28 ? ? O A HOH 202 ? ? 1.58 3 1 N A GLY 88 ? B O A HOH 201 ? ? 1.84 4 1 NE2 A GLN 28 ? ? O A HOH 202 ? ? 2.08 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -21 ? A MET 1 2 1 Y 1 A GLY -20 ? A GLY 2 3 1 Y 1 A SER -19 ? A SER 3 4 1 Y 1 A HIS -18 ? A HIS 4 5 1 Y 1 A HIS -17 ? A HIS 5 6 1 Y 1 A HIS -16 ? A HIS 6 7 1 Y 1 A HIS -15 ? A HIS 7 8 1 Y 1 A HIS -14 ? A HIS 8 9 1 Y 1 A HIS -13 ? A HIS 9 10 1 Y 1 A GLY -12 ? A GLY 10 11 1 Y 1 A SER -11 ? A SER 11 12 1 Y 1 A GLU -10 ? A GLU 12 13 1 Y 1 A ASN -9 ? A ASN 13 14 1 Y 1 A SER -4 ? A SER 18 15 1 Y 1 A GLY -3 ? A GLY 19 16 1 Y 1 A SER -2 ? A SER 20 17 1 Y 1 A GLY -1 ? A GLY 21 18 1 Y 1 A SER 0 ? A SER 22 19 1 Y 1 A ASP 1 ? A ASP 23 20 1 Y 1 A GLU 2 ? A GLU 24 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 HOH O O N N 144 HOH H1 H N N 145 HOH H2 H N N 146 ILE N N N N 147 ILE CA C N S 148 ILE C C N N 149 ILE O O N N 150 ILE CB C N S 151 ILE CG1 C N N 152 ILE CG2 C N N 153 ILE CD1 C N N 154 ILE OXT O N N 155 ILE H H N N 156 ILE H2 H N N 157 ILE HA H N N 158 ILE HB H N N 159 ILE HG12 H N N 160 ILE HG13 H N N 161 ILE HG21 H N N 162 ILE HG22 H N N 163 ILE HG23 H N N 164 ILE HD11 H N N 165 ILE HD12 H N N 166 ILE HD13 H N N 167 ILE HXT H N N 168 LEU N N N N 169 LEU CA C N S 170 LEU C C N N 171 LEU O O N N 172 LEU CB C N N 173 LEU CG C N N 174 LEU CD1 C N N 175 LEU CD2 C N N 176 LEU OXT O N N 177 LEU H H N N 178 LEU H2 H N N 179 LEU HA H N N 180 LEU HB2 H N N 181 LEU HB3 H N N 182 LEU HG H N N 183 LEU HD11 H N N 184 LEU HD12 H N N 185 LEU HD13 H N N 186 LEU HD21 H N N 187 LEU HD22 H N N 188 LEU HD23 H N N 189 LEU HXT H N N 190 LYS N N N N 191 LYS CA C N S 192 LYS C C N N 193 LYS O O N N 194 LYS CB C N N 195 LYS CG C N N 196 LYS CD C N N 197 LYS CE C N N 198 LYS NZ N N N 199 LYS OXT O N N 200 LYS H H N N 201 LYS H2 H N N 202 LYS HA H N N 203 LYS HB2 H N N 204 LYS HB3 H N N 205 LYS HG2 H N N 206 LYS HG3 H N N 207 LYS HD2 H N N 208 LYS HD3 H N N 209 LYS HE2 H N N 210 LYS HE3 H N N 211 LYS HZ1 H N N 212 LYS HZ2 H N N 213 LYS HZ3 H N N 214 LYS HXT H N N 215 MET N N N N 216 MET CA C N S 217 MET C C N N 218 MET O O N N 219 MET CB C N N 220 MET CG C N N 221 MET SD S N N 222 MET CE C N N 223 MET OXT O N N 224 MET H H N N 225 MET H2 H N N 226 MET HA H N N 227 MET HB2 H N N 228 MET HB3 H N N 229 MET HG2 H N N 230 MET HG3 H N N 231 MET HE1 H N N 232 MET HE2 H N N 233 MET HE3 H N N 234 MET HXT H N N 235 PHE N N N N 236 PHE CA C N S 237 PHE C C N N 238 PHE O O N N 239 PHE CB C N N 240 PHE CG C Y N 241 PHE CD1 C Y N 242 PHE CD2 C Y N 243 PHE CE1 C Y N 244 PHE CE2 C Y N 245 PHE CZ C Y N 246 PHE OXT O N N 247 PHE H H N N 248 PHE H2 H N N 249 PHE HA H N N 250 PHE HB2 H N N 251 PHE HB3 H N N 252 PHE HD1 H N N 253 PHE HD2 H N N 254 PHE HE1 H N N 255 PHE HE2 H N N 256 PHE HZ H N N 257 PHE HXT H N N 258 PRO N N N N 259 PRO CA C N S 260 PRO C C N N 261 PRO O O N N 262 PRO CB C N N 263 PRO CG C N N 264 PRO CD C N N 265 PRO OXT O N N 266 PRO H H N N 267 PRO HA H N N 268 PRO HB2 H N N 269 PRO HB3 H N N 270 PRO HG2 H N N 271 PRO HG3 H N N 272 PRO HD2 H N N 273 PRO HD3 H N N 274 PRO HXT H N N 275 SER N N N N 276 SER CA C N S 277 SER C C N N 278 SER O O N N 279 SER CB C N N 280 SER OG O N N 281 SER OXT O N N 282 SER H H N N 283 SER H2 H N N 284 SER HA H N N 285 SER HB2 H N N 286 SER HB3 H N N 287 SER HG H N N 288 SER HXT H N N 289 THR N N N N 290 THR CA C N S 291 THR C C N N 292 THR O O N N 293 THR CB C N R 294 THR OG1 O N N 295 THR CG2 C N N 296 THR OXT O N N 297 THR H H N N 298 THR H2 H N N 299 THR HA H N N 300 THR HB H N N 301 THR HG1 H N N 302 THR HG21 H N N 303 THR HG22 H N N 304 THR HG23 H N N 305 THR HXT H N N 306 TYR N N N N 307 TYR CA C N S 308 TYR C C N N 309 TYR O O N N 310 TYR CB C N N 311 TYR CG C Y N 312 TYR CD1 C Y N 313 TYR CD2 C Y N 314 TYR CE1 C Y N 315 TYR CE2 C Y N 316 TYR CZ C Y N 317 TYR OH O N N 318 TYR OXT O N N 319 TYR H H N N 320 TYR H2 H N N 321 TYR HA H N N 322 TYR HB2 H N N 323 TYR HB3 H N N 324 TYR HD1 H N N 325 TYR HD2 H N N 326 TYR HE1 H N N 327 TYR HE2 H N N 328 TYR HH H N N 329 TYR HXT H N N 330 VAL N N N N 331 VAL CA C N S 332 VAL C C N N 333 VAL O O N N 334 VAL CB C N N 335 VAL CG1 C N N 336 VAL CG2 C N N 337 VAL OXT O N N 338 VAL H H N N 339 VAL H2 H N N 340 VAL HA H N N 341 VAL HB H N N 342 VAL HG11 H N N 343 VAL HG12 H N N 344 VAL HG13 H N N 345 VAL HG21 H N N 346 VAL HG22 H N N 347 VAL HG23 H N N 348 VAL HXT H N N 349 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 HOH O H1 sing N N 137 HOH O H2 sing N N 138 ILE N CA sing N N 139 ILE N H sing N N 140 ILE N H2 sing N N 141 ILE CA C sing N N 142 ILE CA CB sing N N 143 ILE CA HA sing N N 144 ILE C O doub N N 145 ILE C OXT sing N N 146 ILE CB CG1 sing N N 147 ILE CB CG2 sing N N 148 ILE CB HB sing N N 149 ILE CG1 CD1 sing N N 150 ILE CG1 HG12 sing N N 151 ILE CG1 HG13 sing N N 152 ILE CG2 HG21 sing N N 153 ILE CG2 HG22 sing N N 154 ILE CG2 HG23 sing N N 155 ILE CD1 HD11 sing N N 156 ILE CD1 HD12 sing N N 157 ILE CD1 HD13 sing N N 158 ILE OXT HXT sing N N 159 LEU N CA sing N N 160 LEU N H sing N N 161 LEU N H2 sing N N 162 LEU CA C sing N N 163 LEU CA CB sing N N 164 LEU CA HA sing N N 165 LEU C O doub N N 166 LEU C OXT sing N N 167 LEU CB CG sing N N 168 LEU CB HB2 sing N N 169 LEU CB HB3 sing N N 170 LEU CG CD1 sing N N 171 LEU CG CD2 sing N N 172 LEU CG HG sing N N 173 LEU CD1 HD11 sing N N 174 LEU CD1 HD12 sing N N 175 LEU CD1 HD13 sing N N 176 LEU CD2 HD21 sing N N 177 LEU CD2 HD22 sing N N 178 LEU CD2 HD23 sing N N 179 LEU OXT HXT sing N N 180 LYS N CA sing N N 181 LYS N H sing N N 182 LYS N H2 sing N N 183 LYS CA C sing N N 184 LYS CA CB sing N N 185 LYS CA HA sing N N 186 LYS C O doub N N 187 LYS C OXT sing N N 188 LYS CB CG sing N N 189 LYS CB HB2 sing N N 190 LYS CB HB3 sing N N 191 LYS CG CD sing N N 192 LYS CG HG2 sing N N 193 LYS CG HG3 sing N N 194 LYS CD CE sing N N 195 LYS CD HD2 sing N N 196 LYS CD HD3 sing N N 197 LYS CE NZ sing N N 198 LYS CE HE2 sing N N 199 LYS CE HE3 sing N N 200 LYS NZ HZ1 sing N N 201 LYS NZ HZ2 sing N N 202 LYS NZ HZ3 sing N N 203 LYS OXT HXT sing N N 204 MET N CA sing N N 205 MET N H sing N N 206 MET N H2 sing N N 207 MET CA C sing N N 208 MET CA CB sing N N 209 MET CA HA sing N N 210 MET C O doub N N 211 MET C OXT sing N N 212 MET CB CG sing N N 213 MET CB HB2 sing N N 214 MET CB HB3 sing N N 215 MET CG SD sing N N 216 MET CG HG2 sing N N 217 MET CG HG3 sing N N 218 MET SD CE sing N N 219 MET CE HE1 sing N N 220 MET CE HE2 sing N N 221 MET CE HE3 sing N N 222 MET OXT HXT sing N N 223 PHE N CA sing N N 224 PHE N H sing N N 225 PHE N H2 sing N N 226 PHE CA C sing N N 227 PHE CA CB sing N N 228 PHE CA HA sing N N 229 PHE C O doub N N 230 PHE C OXT sing N N 231 PHE CB CG sing N N 232 PHE CB HB2 sing N N 233 PHE CB HB3 sing N N 234 PHE CG CD1 doub Y N 235 PHE CG CD2 sing Y N 236 PHE CD1 CE1 sing Y N 237 PHE CD1 HD1 sing N N 238 PHE CD2 CE2 doub Y N 239 PHE CD2 HD2 sing N N 240 PHE CE1 CZ doub Y N 241 PHE CE1 HE1 sing N N 242 PHE CE2 CZ sing Y N 243 PHE CE2 HE2 sing N N 244 PHE CZ HZ sing N N 245 PHE OXT HXT sing N N 246 PRO N CA sing N N 247 PRO N CD sing N N 248 PRO N H sing N N 249 PRO CA C sing N N 250 PRO CA CB sing N N 251 PRO CA HA sing N N 252 PRO C O doub N N 253 PRO C OXT sing N N 254 PRO CB CG sing N N 255 PRO CB HB2 sing N N 256 PRO CB HB3 sing N N 257 PRO CG CD sing N N 258 PRO CG HG2 sing N N 259 PRO CG HG3 sing N N 260 PRO CD HD2 sing N N 261 PRO CD HD3 sing N N 262 PRO OXT HXT sing N N 263 SER N CA sing N N 264 SER N H sing N N 265 SER N H2 sing N N 266 SER CA C sing N N 267 SER CA CB sing N N 268 SER CA HA sing N N 269 SER C O doub N N 270 SER C OXT sing N N 271 SER CB OG sing N N 272 SER CB HB2 sing N N 273 SER CB HB3 sing N N 274 SER OG HG sing N N 275 SER OXT HXT sing N N 276 THR N CA sing N N 277 THR N H sing N N 278 THR N H2 sing N N 279 THR CA C sing N N 280 THR CA CB sing N N 281 THR CA HA sing N N 282 THR C O doub N N 283 THR C OXT sing N N 284 THR CB OG1 sing N N 285 THR CB CG2 sing N N 286 THR CB HB sing N N 287 THR OG1 HG1 sing N N 288 THR CG2 HG21 sing N N 289 THR CG2 HG22 sing N N 290 THR CG2 HG23 sing N N 291 THR OXT HXT sing N N 292 TYR N CA sing N N 293 TYR N H sing N N 294 TYR N H2 sing N N 295 TYR CA C sing N N 296 TYR CA CB sing N N 297 TYR CA HA sing N N 298 TYR C O doub N N 299 TYR C OXT sing N N 300 TYR CB CG sing N N 301 TYR CB HB2 sing N N 302 TYR CB HB3 sing N N 303 TYR CG CD1 doub Y N 304 TYR CG CD2 sing Y N 305 TYR CD1 CE1 sing Y N 306 TYR CD1 HD1 sing N N 307 TYR CD2 CE2 doub Y N 308 TYR CD2 HD2 sing N N 309 TYR CE1 CZ doub Y N 310 TYR CE1 HE1 sing N N 311 TYR CE2 CZ sing Y N 312 TYR CE2 HE2 sing N N 313 TYR CZ OH sing N N 314 TYR OH HH sing N N 315 TYR OXT HXT sing N N 316 VAL N CA sing N N 317 VAL N H sing N N 318 VAL N H2 sing N N 319 VAL CA C sing N N 320 VAL CA CB sing N N 321 VAL CA HA sing N N 322 VAL C O doub N N 323 VAL C OXT sing N N 324 VAL CB CG1 sing N N 325 VAL CB CG2 sing N N 326 VAL CB HB sing N N 327 VAL CG1 HG11 sing N N 328 VAL CG1 HG12 sing N N 329 VAL CG1 HG13 sing N N 330 VAL CG2 HG21 sing N N 331 VAL CG2 HG22 sing N N 332 VAL CG2 HG23 sing N N 333 VAL OXT HXT sing N N 334 # _pdbx_audit_support.funding_organization 'Department of Defense (DOD, United States)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number 'DARPA Synergistic Discovery and Design (SD2) HR0011835403 contract FA8750-17-C-0219' _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'in silico model' _pdbx_initial_refinement_model.source_name Other _pdbx_initial_refinement_model.details 'Computational design model' # _atom_sites.entry_id 6W3D _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.016646 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.002291 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.032789 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.016521 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_