data_6W4L # _entry.id 6W4L # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6W4L pdb_00006w4l 10.2210/pdb6w4l/pdb WWPDB D_1000247598 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6W4L _pdbx_database_status.recvd_initial_deposition_date 2020-03-11 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Warren, C.' 1 ? 'Bonanno, J.B.' 2 0000-0003-0863-7826 'Almo, S.C.' 3 0000-0003-2591-5234 'Shechter, D.' 4 0000-0001-9388-6004 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Acta Crystallogr.,Sect.F' _citation.journal_id_ASTM ACSFEN _citation.journal_id_CSD ? _citation.journal_id_ISSN 2053-230X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 76 _citation.language ? _citation.page_first 194 _citation.page_last 198 _citation.title 'Structure of a single-chain H2A/H2B dimer.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1107/S2053230X20004604 _citation.pdbx_database_id_PubMed 32356520 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Warren, C.' 1 ? primary 'Bonanno, J.B.' 2 ? primary 'Almo, S.C.' 3 ? primary 'Shechter, D.' 4 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 117.270 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6W4L _cell.details ? _cell.formula_units_Z ? _cell.length_a 61.793 _cell.length_a_esd ? _cell.length_b 44.679 _cell.length_b_esd ? _cell.length_c 66.450 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6W4L _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Histone H2B 1.1,Histone H2A type 1' 20521.707 1 ? ? ? ;single chain construct linking H2B (aa 34-126) and H2A (aa 14-105); one N-terminal Gly cloning artifact.,single chain construct linking H2B (aa 34-126) and H2A (aa 14-105); one N-terminal Gly cloning artifact. ; 2 non-polymer syn PYROPHOSPHATE 177.975 1 ? ? ? ? 3 water nat water 18.015 43 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name H2B1.1 # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAV SEGTKAVTKYTSAKKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRI IPRHLQLAVRNDEELNKLLGGVTIAQ ; _entity_poly.pdbx_seq_one_letter_code_can ;GRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAV SEGTKAVTKYTSAKKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRI IPRHLQLAVRNDEELNKLLGGVTIAQ ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ARG n 1 3 LYS n 1 4 GLU n 1 5 SER n 1 6 TYR n 1 7 ALA n 1 8 ILE n 1 9 TYR n 1 10 VAL n 1 11 TYR n 1 12 LYS n 1 13 VAL n 1 14 LEU n 1 15 LYS n 1 16 GLN n 1 17 VAL n 1 18 HIS n 1 19 PRO n 1 20 ASP n 1 21 THR n 1 22 GLY n 1 23 ILE n 1 24 SER n 1 25 SER n 1 26 LYS n 1 27 ALA n 1 28 MET n 1 29 SER n 1 30 ILE n 1 31 MET n 1 32 ASN n 1 33 SER n 1 34 PHE n 1 35 VAL n 1 36 ASN n 1 37 ASP n 1 38 VAL n 1 39 PHE n 1 40 GLU n 1 41 ARG n 1 42 ILE n 1 43 ALA n 1 44 GLY n 1 45 GLU n 1 46 ALA n 1 47 SER n 1 48 ARG n 1 49 LEU n 1 50 ALA n 1 51 HIS n 1 52 TYR n 1 53 ASN n 1 54 LYS n 1 55 ARG n 1 56 SER n 1 57 THR n 1 58 ILE n 1 59 THR n 1 60 SER n 1 61 ARG n 1 62 GLU n 1 63 ILE n 1 64 GLN n 1 65 THR n 1 66 ALA n 1 67 VAL n 1 68 ARG n 1 69 LEU n 1 70 LEU n 1 71 LEU n 1 72 PRO n 1 73 GLY n 1 74 GLU n 1 75 LEU n 1 76 ALA n 1 77 LYS n 1 78 HIS n 1 79 ALA n 1 80 VAL n 1 81 SER n 1 82 GLU n 1 83 GLY n 1 84 THR n 1 85 LYS n 1 86 ALA n 1 87 VAL n 1 88 THR n 1 89 LYS n 1 90 TYR n 1 91 THR n 1 92 SER n 1 93 ALA n 1 94 LYS n 1 95 LYS n 1 96 ALA n 1 97 LYS n 1 98 THR n 1 99 ARG n 1 100 SER n 1 101 SER n 1 102 ARG n 1 103 ALA n 1 104 GLY n 1 105 LEU n 1 106 GLN n 1 107 PHE n 1 108 PRO n 1 109 VAL n 1 110 GLY n 1 111 ARG n 1 112 VAL n 1 113 HIS n 1 114 ARG n 1 115 LEU n 1 116 LEU n 1 117 ARG n 1 118 LYS n 1 119 GLY n 1 120 ASN n 1 121 TYR n 1 122 ALA n 1 123 GLU n 1 124 ARG n 1 125 VAL n 1 126 GLY n 1 127 ALA n 1 128 GLY n 1 129 ALA n 1 130 PRO n 1 131 VAL n 1 132 TYR n 1 133 LEU n 1 134 ALA n 1 135 ALA n 1 136 VAL n 1 137 LEU n 1 138 GLU n 1 139 TYR n 1 140 LEU n 1 141 THR n 1 142 ALA n 1 143 GLU n 1 144 ILE n 1 145 LEU n 1 146 GLU n 1 147 LEU n 1 148 ALA n 1 149 GLY n 1 150 ASN n 1 151 ALA n 1 152 ALA n 1 153 ARG n 1 154 ASP n 1 155 ASN n 1 156 LYS n 1 157 LYS n 1 158 THR n 1 159 ARG n 1 160 ILE n 1 161 ILE n 1 162 PRO n 1 163 ARG n 1 164 HIS n 1 165 LEU n 1 166 GLN n 1 167 LEU n 1 168 ALA n 1 169 VAL n 1 170 ARG n 1 171 ASN n 1 172 ASP n 1 173 GLU n 1 174 GLU n 1 175 LEU n 1 176 ASN n 1 177 LYS n 1 178 LEU n 1 179 LEU n 1 180 GLY n 1 181 GLY n 1 182 VAL n 1 183 THR n 1 184 ILE n 1 185 ALA n 1 186 GLN n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 94 'African clawed frog' ? ? ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? Rosetta2 ? ? ? ? ? ? pET ? ? ? 'modified pET30' ? ? 1 2 sample 'Biological sequence' 95 186 'African clawed frog' ? ? ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? Rosetta2 ? ? ? ? ? ? pET ? ? ? 'modified pET30' ? ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP H2B11_XENLA P02281 ? 1 ;RKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVS EGTKAVTKYTSAK ; 34 2 UNP H2A1_XENLA P06897 ? 1 ;KAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEE LNKLLGGVTIAQ ; 14 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 6W4L A 2 ? 94 ? P02281 34 ? 126 ? 34 126 2 2 6W4L A 95 ? 186 ? P06897 14 ? 105 ? 1014 1105 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 6W4L _struct_ref_seq_dif.mon_id GLY _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P02281 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'expression tag' _struct_ref_seq_dif.pdbx_auth_seq_num 33 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PPV non-polymer . PYROPHOSPHATE ? 'H4 O7 P2' 177.975 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6W4L _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.09 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 41 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.9 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2M sodium thiocyanate, 20% PEG3350' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'MARMOSAIC 225 mm CCD' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2017-12-06 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator diamond _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97931 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 31-ID' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97931 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 31-ID _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 13.7 _reflns.entry_id 6W4L _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.310 _reflns.d_resolution_low 26.710 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 38073 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.400 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.700 _reflns.pdbx_Rmerge_I_obs 0.058 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 5.600 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.069 _reflns.pdbx_Rpim_I_all 0.036 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split 1.310 1.390 ? ? 19786 ? ? ? 5487 99.800 ? ? ? ? 0.892 ? ? ? ? ? ? ? ? 3.600 ? ? ? 1.100 1.052 0.550 ? 1 1 0.619 ? ? 4.160 26.710 ? ? 3963 ? ? ? 1134 89.400 ? ? ? ? 0.022 ? ? ? ? ? ? ? ? 3.500 ? ? ? 13.900 0.026 0.014 ? 2 1 0.999 ? ? # _refine.aniso_B[1][1] 0.4700 _refine.aniso_B[1][2] -0.0000 _refine.aniso_B[1][3] -0.0100 _refine.aniso_B[2][2] -0.9600 _refine.aniso_B[2][3] 0.0000 _refine.aniso_B[3][3] 0.3300 _refine.B_iso_max 77.570 _refine.B_iso_mean 20.4180 _refine.B_iso_min 8.910 _refine.correlation_coeff_Fo_to_Fc 0.9680 _refine.correlation_coeff_Fo_to_Fc_free 0.9470 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS; U VALUES REFINED INDIVIDUALLY ANISOTROPICALLY' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6W4L _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.3100 _refine.ls_d_res_low 20.0000 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 36283 _refine.ls_number_reflns_R_free 1776 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.2800 _refine.ls_percent_reflns_R_free 4.7000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1712 _refine.ls_R_factor_R_free 0.2063 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1695 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1KX5 _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.0560 _refine.pdbx_overall_ESU_R_Free 0.0550 _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 2.7490 _refine.overall_SU_ML 0.0490 _refine.overall_SU_R_Cruickshank_DPI 0.0562 _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 1.3100 _refine_hist.d_res_low 20.0000 _refine_hist.number_atoms_solvent 43 _refine_hist.number_atoms_total 1427 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 176 _refine_hist.pdbx_B_iso_mean_ligand 24.27 _refine_hist.pdbx_B_iso_mean_solvent 25.77 _refine_hist.pdbx_number_atoms_protein 1375 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 9 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.012 0.019 1412 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.002 0.020 1421 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.541 1.978 1909 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.057 3.000 3254 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 4.500 5.000 179 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 37.634 22.203 59 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 13.830 15.000 261 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 19.937 15.000 15 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.101 0.200 221 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.007 0.020 1570 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.002 0.020 323 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? 1.788 3.000 2831 ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? 14.972 5.000 22 ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? 5.968 5.000 2833 ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.3150 _refine_ls_shell.d_res_low 1.3490 _refine_ls_shell.number_reflns_all 2736 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 143 _refine_ls_shell.number_reflns_R_work 2593 _refine_ls_shell.percent_reflns_obs 99.7800 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.3100 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.3040 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 6W4L _struct.title 'The crystal structure of a single chain H2B-H2A histone chimera from Xenopus laevis' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6W4L _struct_keywords.text 'histone, chromatin, GENE REGULATION' _struct_keywords.pdbx_keywords 'GENE REGULATION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 TYR A 6 ? HIS A 18 ? TYR A 38 HIS A 50 1 ? 13 HELX_P HELX_P2 AA2 SER A 24 ? ASN A 53 ? SER A 56 ASN A 85 1 ? 30 HELX_P HELX_P3 AA3 THR A 59 ? LEU A 71 ? THR A 91 LEU A 103 1 ? 13 HELX_P HELX_P4 AA4 PRO A 72 ? ALA A 93 ? PRO A 104 ALA A 125 1 ? 22 HELX_P HELX_P5 AA5 THR A 98 ? ALA A 103 ? THR A 1017 ALA A 1022 1 ? 6 HELX_P HELX_P6 AA6 PRO A 108 ? GLY A 119 ? PRO A 1027 GLY A 1038 1 ? 12 HELX_P HELX_P7 AA7 ALA A 127 ? ASN A 155 ? ALA A 1046 ASN A 1074 1 ? 29 HELX_P HELX_P8 AA8 ILE A 161 ? ASN A 171 ? ILE A 1080 ASN A 1090 1 ? 11 HELX_P HELX_P9 AA9 ASP A 172 ? LEU A 179 ? ASP A 1091 LEU A 1098 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 2 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA2 1 2 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLY A 22 ? ILE A 23 ? GLY A 54 ILE A 55 AA1 2 ARG A 159 ? ILE A 160 ? ARG A 1078 ILE A 1079 AA2 1 THR A 57 ? ILE A 58 ? THR A 89 ILE A 90 AA2 2 ARG A 124 ? VAL A 125 ? ARG A 1043 VAL A 1044 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLY A 22 ? N GLY A 54 O ILE A 160 ? O ILE A 1079 AA2 1 2 N ILE A 58 ? N ILE A 90 O ARG A 124 ? O ARG A 1043 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id PPV _struct_site.pdbx_auth_seq_id 1201 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 8 _struct_site.details 'binding site for residue PPV A 1201' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 8 HIS A 18 ? HIS A 50 . ? 4_555 ? 2 AC1 8 PRO A 19 ? PRO A 51 . ? 4_555 ? 3 AC1 8 ASP A 20 ? ASP A 52 . ? 4_555 ? 4 AC1 8 THR A 21 ? THR A 53 . ? 4_555 ? 5 AC1 8 LYS A 89 ? LYS A 121 . ? 1_555 ? 6 AC1 8 ARG A 153 ? ARG A 1072 . ? 4_555 ? 7 AC1 8 HOH C . ? HOH A 1303 . ? 1_555 ? 8 AC1 8 HOH C . ? HOH A 1316 . ? 1_555 ? # _atom_sites.entry_id 6W4L _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.016183 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.008342 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.022382 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.016931 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 33 ? ? ? A . n A 1 2 ARG 2 34 ? ? ? A . n A 1 3 LYS 3 35 ? ? ? A . n A 1 4 GLU 4 36 36 GLU GLU A . n A 1 5 SER 5 37 37 SER SER A . n A 1 6 TYR 6 38 38 TYR TYR A . n A 1 7 ALA 7 39 39 ALA ALA A . n A 1 8 ILE 8 40 40 ILE ILE A . n A 1 9 TYR 9 41 41 TYR TYR A . n A 1 10 VAL 10 42 42 VAL VAL A . n A 1 11 TYR 11 43 43 TYR TYR A . n A 1 12 LYS 12 44 44 LYS LYS A . n A 1 13 VAL 13 45 45 VAL VAL A . n A 1 14 LEU 14 46 46 LEU LEU A . n A 1 15 LYS 15 47 47 LYS LYS A . n A 1 16 GLN 16 48 48 GLN GLN A . n A 1 17 VAL 17 49 49 VAL VAL A . n A 1 18 HIS 18 50 50 HIS HIS A . n A 1 19 PRO 19 51 51 PRO PRO A . n A 1 20 ASP 20 52 52 ASP ASP A . n A 1 21 THR 21 53 53 THR THR A . n A 1 22 GLY 22 54 54 GLY GLY A . n A 1 23 ILE 23 55 55 ILE ILE A . n A 1 24 SER 24 56 56 SER SER A . n A 1 25 SER 25 57 57 SER SER A . n A 1 26 LYS 26 58 58 LYS LYS A . n A 1 27 ALA 27 59 59 ALA ALA A . n A 1 28 MET 28 60 60 MET MET A . n A 1 29 SER 29 61 61 SER SER A . n A 1 30 ILE 30 62 62 ILE ILE A . n A 1 31 MET 31 63 63 MET MET A . n A 1 32 ASN 32 64 64 ASN ASN A . n A 1 33 SER 33 65 65 SER SER A . n A 1 34 PHE 34 66 66 PHE PHE A . n A 1 35 VAL 35 67 67 VAL VAL A . n A 1 36 ASN 36 68 68 ASN ASN A . n A 1 37 ASP 37 69 69 ASP ASP A . n A 1 38 VAL 38 70 70 VAL VAL A . n A 1 39 PHE 39 71 71 PHE PHE A . n A 1 40 GLU 40 72 72 GLU GLU A . n A 1 41 ARG 41 73 73 ARG ARG A . n A 1 42 ILE 42 74 74 ILE ILE A . n A 1 43 ALA 43 75 75 ALA ALA A . n A 1 44 GLY 44 76 76 GLY GLY A . n A 1 45 GLU 45 77 77 GLU GLU A . n A 1 46 ALA 46 78 78 ALA ALA A . n A 1 47 SER 47 79 79 SER SER A . n A 1 48 ARG 48 80 80 ARG ARG A . n A 1 49 LEU 49 81 81 LEU LEU A . n A 1 50 ALA 50 82 82 ALA ALA A . n A 1 51 HIS 51 83 83 HIS HIS A . n A 1 52 TYR 52 84 84 TYR TYR A . n A 1 53 ASN 53 85 85 ASN ASN A . n A 1 54 LYS 54 86 86 LYS LYS A . n A 1 55 ARG 55 87 87 ARG ARG A . n A 1 56 SER 56 88 88 SER SER A . n A 1 57 THR 57 89 89 THR THR A . n A 1 58 ILE 58 90 90 ILE ILE A . n A 1 59 THR 59 91 91 THR THR A . n A 1 60 SER 60 92 92 SER SER A . n A 1 61 ARG 61 93 93 ARG ARG A . n A 1 62 GLU 62 94 94 GLU GLU A . n A 1 63 ILE 63 95 95 ILE ILE A . n A 1 64 GLN 64 96 96 GLN GLN A . n A 1 65 THR 65 97 97 THR THR A . n A 1 66 ALA 66 98 98 ALA ALA A . n A 1 67 VAL 67 99 99 VAL VAL A . n A 1 68 ARG 68 100 100 ARG ARG A . n A 1 69 LEU 69 101 101 LEU LEU A . n A 1 70 LEU 70 102 102 LEU LEU A . n A 1 71 LEU 71 103 103 LEU LEU A . n A 1 72 PRO 72 104 104 PRO PRO A . n A 1 73 GLY 73 105 105 GLY GLY A . n A 1 74 GLU 74 106 106 GLU GLU A . n A 1 75 LEU 75 107 107 LEU LEU A . n A 1 76 ALA 76 108 108 ALA ALA A . n A 1 77 LYS 77 109 109 LYS LYS A . n A 1 78 HIS 78 110 110 HIS HIS A . n A 1 79 ALA 79 111 111 ALA ALA A . n A 1 80 VAL 80 112 112 VAL VAL A . n A 1 81 SER 81 113 113 SER SER A . n A 1 82 GLU 82 114 114 GLU GLU A . n A 1 83 GLY 83 115 115 GLY GLY A . n A 1 84 THR 84 116 116 THR THR A . n A 1 85 LYS 85 117 117 LYS LYS A . n A 1 86 ALA 86 118 118 ALA ALA A . n A 1 87 VAL 87 119 119 VAL VAL A . n A 1 88 THR 88 120 120 THR THR A . n A 1 89 LYS 89 121 121 LYS LYS A . n A 1 90 TYR 90 122 122 TYR TYR A . n A 1 91 THR 91 123 123 THR THR A . n A 1 92 SER 92 124 124 SER SER A . n A 1 93 ALA 93 125 125 ALA ALA A . n A 1 94 LYS 94 126 126 LYS LYS A . n A 1 95 LYS 95 1014 1014 LYS LYS A . n A 1 96 ALA 96 1015 1015 ALA ALA A . n A 1 97 LYS 97 1016 1016 LYS LYS A . n A 1 98 THR 98 1017 1017 THR THR A . n A 1 99 ARG 99 1018 1018 ARG ARG A . n A 1 100 SER 100 1019 1019 SER SER A . n A 1 101 SER 101 1020 1020 SER SER A . n A 1 102 ARG 102 1021 1021 ARG ARG A . n A 1 103 ALA 103 1022 1022 ALA ALA A . n A 1 104 GLY 104 1023 1023 GLY GLY A . n A 1 105 LEU 105 1024 1024 LEU LEU A . n A 1 106 GLN 106 1025 1025 GLN GLN A . n A 1 107 PHE 107 1026 1026 PHE PHE A . n A 1 108 PRO 108 1027 1027 PRO PRO A . n A 1 109 VAL 109 1028 1028 VAL VAL A . n A 1 110 GLY 110 1029 1029 GLY GLY A . n A 1 111 ARG 111 1030 1030 ARG ARG A . n A 1 112 VAL 112 1031 1031 VAL VAL A . n A 1 113 HIS 113 1032 1032 HIS HIS A . n A 1 114 ARG 114 1033 1033 ARG ARG A . n A 1 115 LEU 115 1034 1034 LEU LEU A . n A 1 116 LEU 116 1035 1035 LEU LEU A . n A 1 117 ARG 117 1036 1036 ARG ARG A . n A 1 118 LYS 118 1037 1037 LYS LYS A . n A 1 119 GLY 119 1038 1038 GLY GLY A . n A 1 120 ASN 120 1039 1039 ASN ASN A . n A 1 121 TYR 121 1040 1040 TYR TYR A . n A 1 122 ALA 122 1041 1041 ALA ALA A . n A 1 123 GLU 123 1042 1042 GLU GLU A . n A 1 124 ARG 124 1043 1043 ARG ARG A . n A 1 125 VAL 125 1044 1044 VAL VAL A . n A 1 126 GLY 126 1045 1045 GLY GLY A . n A 1 127 ALA 127 1046 1046 ALA ALA A . n A 1 128 GLY 128 1047 1047 GLY GLY A . n A 1 129 ALA 129 1048 1048 ALA ALA A . n A 1 130 PRO 130 1049 1049 PRO PRO A . n A 1 131 VAL 131 1050 1050 VAL VAL A . n A 1 132 TYR 132 1051 1051 TYR TYR A . n A 1 133 LEU 133 1052 1052 LEU LEU A . n A 1 134 ALA 134 1053 1053 ALA ALA A . n A 1 135 ALA 135 1054 1054 ALA ALA A . n A 1 136 VAL 136 1055 1055 VAL VAL A . n A 1 137 LEU 137 1056 1056 LEU LEU A . n A 1 138 GLU 138 1057 1057 GLU GLU A . n A 1 139 TYR 139 1058 1058 TYR TYR A . n A 1 140 LEU 140 1059 1059 LEU LEU A . n A 1 141 THR 141 1060 1060 THR THR A . n A 1 142 ALA 142 1061 1061 ALA ALA A . n A 1 143 GLU 143 1062 1062 GLU GLU A . n A 1 144 ILE 144 1063 1063 ILE ILE A . n A 1 145 LEU 145 1064 1064 LEU LEU A . n A 1 146 GLU 146 1065 1065 GLU GLU A . n A 1 147 LEU 147 1066 1066 LEU LEU A . n A 1 148 ALA 148 1067 1067 ALA ALA A . n A 1 149 GLY 149 1068 1068 GLY GLY A . n A 1 150 ASN 150 1069 1069 ASN ASN A . n A 1 151 ALA 151 1070 1070 ALA ALA A . n A 1 152 ALA 152 1071 1071 ALA ALA A . n A 1 153 ARG 153 1072 1072 ARG ARG A . n A 1 154 ASP 154 1073 1073 ASP ASP A . n A 1 155 ASN 155 1074 1074 ASN ASN A . n A 1 156 LYS 156 1075 1075 LYS LYS A . n A 1 157 LYS 157 1076 1076 LYS LYS A . n A 1 158 THR 158 1077 1077 THR THR A . n A 1 159 ARG 159 1078 1078 ARG ARG A . n A 1 160 ILE 160 1079 1079 ILE ILE A . n A 1 161 ILE 161 1080 1080 ILE ILE A . n A 1 162 PRO 162 1081 1081 PRO PRO A . n A 1 163 ARG 163 1082 1082 ARG ARG A . n A 1 164 HIS 164 1083 1083 HIS HIS A . n A 1 165 LEU 165 1084 1084 LEU LEU A . n A 1 166 GLN 166 1085 1085 GLN GLN A . n A 1 167 LEU 167 1086 1086 LEU LEU A . n A 1 168 ALA 168 1087 1087 ALA ALA A . n A 1 169 VAL 169 1088 1088 VAL VAL A . n A 1 170 ARG 170 1089 1089 ARG ARG A . n A 1 171 ASN 171 1090 1090 ASN ASN A . n A 1 172 ASP 172 1091 1091 ASP ASP A . n A 1 173 GLU 173 1092 1092 GLU GLU A . n A 1 174 GLU 174 1093 1093 GLU GLU A . n A 1 175 LEU 175 1094 1094 LEU LEU A . n A 1 176 ASN 176 1095 1095 ASN ASN A . n A 1 177 LYS 177 1096 1096 LYS LYS A . n A 1 178 LEU 178 1097 1097 LEU LEU A . n A 1 179 LEU 179 1098 1098 LEU LEU A . n A 1 180 GLY 180 1099 ? ? ? A . n A 1 181 GLY 181 1100 ? ? ? A . n A 1 182 VAL 182 1101 ? ? ? A . n A 1 183 THR 183 1102 ? ? ? A . n A 1 184 ILE 184 1103 ? ? ? A . n A 1 185 ALA 185 1104 ? ? ? A . n A 1 186 GLN 186 1105 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 PPV 1 1201 1 PPV PPV A . C 3 HOH 1 1301 38 HOH HOH A . C 3 HOH 2 1302 43 HOH HOH A . C 3 HOH 3 1303 23 HOH HOH A . C 3 HOH 4 1304 44 HOH HOH A . C 3 HOH 5 1305 13 HOH HOH A . C 3 HOH 6 1306 2 HOH HOH A . C 3 HOH 7 1307 45 HOH HOH A . C 3 HOH 8 1308 12 HOH HOH A . C 3 HOH 9 1309 18 HOH HOH A . C 3 HOH 10 1310 11 HOH HOH A . C 3 HOH 11 1311 36 HOH HOH A . C 3 HOH 12 1312 7 HOH HOH A . C 3 HOH 13 1313 39 HOH HOH A . C 3 HOH 14 1314 26 HOH HOH A . C 3 HOH 15 1315 22 HOH HOH A . C 3 HOH 16 1316 24 HOH HOH A . C 3 HOH 17 1317 20 HOH HOH A . C 3 HOH 18 1318 19 HOH HOH A . C 3 HOH 19 1319 37 HOH HOH A . C 3 HOH 20 1320 25 HOH HOH A . C 3 HOH 21 1321 5 HOH HOH A . C 3 HOH 22 1322 14 HOH HOH A . C 3 HOH 23 1323 8 HOH HOH A . C 3 HOH 24 1324 6 HOH HOH A . C 3 HOH 25 1325 1 HOH HOH A . C 3 HOH 26 1326 34 HOH HOH A . C 3 HOH 27 1327 17 HOH HOH A . C 3 HOH 28 1328 4 HOH HOH A . C 3 HOH 29 1329 21 HOH HOH A . C 3 HOH 30 1330 16 HOH HOH A . C 3 HOH 31 1331 10 HOH HOH A . C 3 HOH 32 1332 9 HOH HOH A . C 3 HOH 33 1333 41 HOH HOH A . C 3 HOH 34 1334 27 HOH HOH A . C 3 HOH 35 1335 35 HOH HOH A . C 3 HOH 36 1336 31 HOH HOH A . C 3 HOH 37 1337 42 HOH HOH A . C 3 HOH 38 1338 33 HOH HOH A . C 3 HOH 39 1339 32 HOH HOH A . C 3 HOH 40 1340 29 HOH HOH A . C 3 HOH 41 1341 3 HOH HOH A . C 3 HOH 42 1342 30 HOH HOH A . C 3 HOH 43 1343 40 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 1311 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id C _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-05-06 2 'Structure model' 1 1 2020-05-13 3 'Structure model' 1 2 2023-10-18 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' database_2 6 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation.pdbx_database_id_PubMed' 5 2 'Structure model' '_citation.title' 6 2 'Structure model' '_citation_author.identifier_ORCID' 7 3 'Structure model' '_database_2.pdbx_DOI' 8 3 'Structure model' '_database_2.pdbx_database_accession' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.5.32 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0123 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 5 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot ? ? ? . 6 # _pdbx_entry_details.entry_id 6W4L _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 33 ? A GLY 1 2 1 Y 1 A ARG 34 ? A ARG 2 3 1 Y 1 A LYS 35 ? A LYS 3 4 1 Y 1 A GLY 1099 ? A GLY 180 5 1 Y 1 A GLY 1100 ? A GLY 181 6 1 Y 1 A VAL 1101 ? A VAL 182 7 1 Y 1 A THR 1102 ? A THR 183 8 1 Y 1 A ILE 1103 ? A ILE 184 9 1 Y 1 A ALA 1104 ? A ALA 185 10 1 Y 1 A GLN 1105 ? A GLN 186 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 HOH O O N N 144 HOH H1 H N N 145 HOH H2 H N N 146 ILE N N N N 147 ILE CA C N S 148 ILE C C N N 149 ILE O O N N 150 ILE CB C N S 151 ILE CG1 C N N 152 ILE CG2 C N N 153 ILE CD1 C N N 154 ILE OXT O N N 155 ILE H H N N 156 ILE H2 H N N 157 ILE HA H N N 158 ILE HB H N N 159 ILE HG12 H N N 160 ILE HG13 H N N 161 ILE HG21 H N N 162 ILE HG22 H N N 163 ILE HG23 H N N 164 ILE HD11 H N N 165 ILE HD12 H N N 166 ILE HD13 H N N 167 ILE HXT H N N 168 LEU N N N N 169 LEU CA C N S 170 LEU C C N N 171 LEU O O N N 172 LEU CB C N N 173 LEU CG C N N 174 LEU CD1 C N N 175 LEU CD2 C N N 176 LEU OXT O N N 177 LEU H H N N 178 LEU H2 H N N 179 LEU HA H N N 180 LEU HB2 H N N 181 LEU HB3 H N N 182 LEU HG H N N 183 LEU HD11 H N N 184 LEU HD12 H N N 185 LEU HD13 H N N 186 LEU HD21 H N N 187 LEU HD22 H N N 188 LEU HD23 H N N 189 LEU HXT H N N 190 LYS N N N N 191 LYS CA C N S 192 LYS C C N N 193 LYS O O N N 194 LYS CB C N N 195 LYS CG C N N 196 LYS CD C N N 197 LYS CE C N N 198 LYS NZ N N N 199 LYS OXT O N N 200 LYS H H N N 201 LYS H2 H N N 202 LYS HA H N N 203 LYS HB2 H N N 204 LYS HB3 H N N 205 LYS HG2 H N N 206 LYS HG3 H N N 207 LYS HD2 H N N 208 LYS HD3 H N N 209 LYS HE2 H N N 210 LYS HE3 H N N 211 LYS HZ1 H N N 212 LYS HZ2 H N N 213 LYS HZ3 H N N 214 LYS HXT H N N 215 MET N N N N 216 MET CA C N S 217 MET C C N N 218 MET O O N N 219 MET CB C N N 220 MET CG C N N 221 MET SD S N N 222 MET CE C N N 223 MET OXT O N N 224 MET H H N N 225 MET H2 H N N 226 MET HA H N N 227 MET HB2 H N N 228 MET HB3 H N N 229 MET HG2 H N N 230 MET HG3 H N N 231 MET HE1 H N N 232 MET HE2 H N N 233 MET HE3 H N N 234 MET HXT H N N 235 PHE N N N N 236 PHE CA C N S 237 PHE C C N N 238 PHE O O N N 239 PHE CB C N N 240 PHE CG C Y N 241 PHE CD1 C Y N 242 PHE CD2 C Y N 243 PHE CE1 C Y N 244 PHE CE2 C Y N 245 PHE CZ C Y N 246 PHE OXT O N N 247 PHE H H N N 248 PHE H2 H N N 249 PHE HA H N N 250 PHE HB2 H N N 251 PHE HB3 H N N 252 PHE HD1 H N N 253 PHE HD2 H N N 254 PHE HE1 H N N 255 PHE HE2 H N N 256 PHE HZ H N N 257 PHE HXT H N N 258 PPV O11 O N N 259 PPV P1 P N N 260 PPV O21 O N N 261 PPV O31 O N N 262 PPV OPP O N N 263 PPV P2 P N N 264 PPV O12 O N N 265 PPV O22 O N N 266 PPV O32 O N N 267 PPV H11 H N N 268 PPV H21 H N N 269 PPV H12 H N N 270 PPV H32 H N N 271 PRO N N N N 272 PRO CA C N S 273 PRO C C N N 274 PRO O O N N 275 PRO CB C N N 276 PRO CG C N N 277 PRO CD C N N 278 PRO OXT O N N 279 PRO H H N N 280 PRO HA H N N 281 PRO HB2 H N N 282 PRO HB3 H N N 283 PRO HG2 H N N 284 PRO HG3 H N N 285 PRO HD2 H N N 286 PRO HD3 H N N 287 PRO HXT H N N 288 SER N N N N 289 SER CA C N S 290 SER C C N N 291 SER O O N N 292 SER CB C N N 293 SER OG O N N 294 SER OXT O N N 295 SER H H N N 296 SER H2 H N N 297 SER HA H N N 298 SER HB2 H N N 299 SER HB3 H N N 300 SER HG H N N 301 SER HXT H N N 302 THR N N N N 303 THR CA C N S 304 THR C C N N 305 THR O O N N 306 THR CB C N R 307 THR OG1 O N N 308 THR CG2 C N N 309 THR OXT O N N 310 THR H H N N 311 THR H2 H N N 312 THR HA H N N 313 THR HB H N N 314 THR HG1 H N N 315 THR HG21 H N N 316 THR HG22 H N N 317 THR HG23 H N N 318 THR HXT H N N 319 TYR N N N N 320 TYR CA C N S 321 TYR C C N N 322 TYR O O N N 323 TYR CB C N N 324 TYR CG C Y N 325 TYR CD1 C Y N 326 TYR CD2 C Y N 327 TYR CE1 C Y N 328 TYR CE2 C Y N 329 TYR CZ C Y N 330 TYR OH O N N 331 TYR OXT O N N 332 TYR H H N N 333 TYR H2 H N N 334 TYR HA H N N 335 TYR HB2 H N N 336 TYR HB3 H N N 337 TYR HD1 H N N 338 TYR HD2 H N N 339 TYR HE1 H N N 340 TYR HE2 H N N 341 TYR HH H N N 342 TYR HXT H N N 343 VAL N N N N 344 VAL CA C N S 345 VAL C C N N 346 VAL O O N N 347 VAL CB C N N 348 VAL CG1 C N N 349 VAL CG2 C N N 350 VAL OXT O N N 351 VAL H H N N 352 VAL H2 H N N 353 VAL HA H N N 354 VAL HB H N N 355 VAL HG11 H N N 356 VAL HG12 H N N 357 VAL HG13 H N N 358 VAL HG21 H N N 359 VAL HG22 H N N 360 VAL HG23 H N N 361 VAL HXT H N N 362 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 HOH O H1 sing N N 137 HOH O H2 sing N N 138 ILE N CA sing N N 139 ILE N H sing N N 140 ILE N H2 sing N N 141 ILE CA C sing N N 142 ILE CA CB sing N N 143 ILE CA HA sing N N 144 ILE C O doub N N 145 ILE C OXT sing N N 146 ILE CB CG1 sing N N 147 ILE CB CG2 sing N N 148 ILE CB HB sing N N 149 ILE CG1 CD1 sing N N 150 ILE CG1 HG12 sing N N 151 ILE CG1 HG13 sing N N 152 ILE CG2 HG21 sing N N 153 ILE CG2 HG22 sing N N 154 ILE CG2 HG23 sing N N 155 ILE CD1 HD11 sing N N 156 ILE CD1 HD12 sing N N 157 ILE CD1 HD13 sing N N 158 ILE OXT HXT sing N N 159 LEU N CA sing N N 160 LEU N H sing N N 161 LEU N H2 sing N N 162 LEU CA C sing N N 163 LEU CA CB sing N N 164 LEU CA HA sing N N 165 LEU C O doub N N 166 LEU C OXT sing N N 167 LEU CB CG sing N N 168 LEU CB HB2 sing N N 169 LEU CB HB3 sing N N 170 LEU CG CD1 sing N N 171 LEU CG CD2 sing N N 172 LEU CG HG sing N N 173 LEU CD1 HD11 sing N N 174 LEU CD1 HD12 sing N N 175 LEU CD1 HD13 sing N N 176 LEU CD2 HD21 sing N N 177 LEU CD2 HD22 sing N N 178 LEU CD2 HD23 sing N N 179 LEU OXT HXT sing N N 180 LYS N CA sing N N 181 LYS N H sing N N 182 LYS N H2 sing N N 183 LYS CA C sing N N 184 LYS CA CB sing N N 185 LYS CA HA sing N N 186 LYS C O doub N N 187 LYS C OXT sing N N 188 LYS CB CG sing N N 189 LYS CB HB2 sing N N 190 LYS CB HB3 sing N N 191 LYS CG CD sing N N 192 LYS CG HG2 sing N N 193 LYS CG HG3 sing N N 194 LYS CD CE sing N N 195 LYS CD HD2 sing N N 196 LYS CD HD3 sing N N 197 LYS CE NZ sing N N 198 LYS CE HE2 sing N N 199 LYS CE HE3 sing N N 200 LYS NZ HZ1 sing N N 201 LYS NZ HZ2 sing N N 202 LYS NZ HZ3 sing N N 203 LYS OXT HXT sing N N 204 MET N CA sing N N 205 MET N H sing N N 206 MET N H2 sing N N 207 MET CA C sing N N 208 MET CA CB sing N N 209 MET CA HA sing N N 210 MET C O doub N N 211 MET C OXT sing N N 212 MET CB CG sing N N 213 MET CB HB2 sing N N 214 MET CB HB3 sing N N 215 MET CG SD sing N N 216 MET CG HG2 sing N N 217 MET CG HG3 sing N N 218 MET SD CE sing N N 219 MET CE HE1 sing N N 220 MET CE HE2 sing N N 221 MET CE HE3 sing N N 222 MET OXT HXT sing N N 223 PHE N CA sing N N 224 PHE N H sing N N 225 PHE N H2 sing N N 226 PHE CA C sing N N 227 PHE CA CB sing N N 228 PHE CA HA sing N N 229 PHE C O doub N N 230 PHE C OXT sing N N 231 PHE CB CG sing N N 232 PHE CB HB2 sing N N 233 PHE CB HB3 sing N N 234 PHE CG CD1 doub Y N 235 PHE CG CD2 sing Y N 236 PHE CD1 CE1 sing Y N 237 PHE CD1 HD1 sing N N 238 PHE CD2 CE2 doub Y N 239 PHE CD2 HD2 sing N N 240 PHE CE1 CZ doub Y N 241 PHE CE1 HE1 sing N N 242 PHE CE2 CZ sing Y N 243 PHE CE2 HE2 sing N N 244 PHE CZ HZ sing N N 245 PHE OXT HXT sing N N 246 PPV O11 P1 sing N N 247 PPV O11 H11 sing N N 248 PPV P1 O21 sing N N 249 PPV P1 O31 doub N N 250 PPV P1 OPP sing N N 251 PPV O21 H21 sing N N 252 PPV OPP P2 sing N N 253 PPV P2 O12 sing N N 254 PPV P2 O22 doub N N 255 PPV P2 O32 sing N N 256 PPV O12 H12 sing N N 257 PPV O32 H32 sing N N 258 PRO N CA sing N N 259 PRO N CD sing N N 260 PRO N H sing N N 261 PRO CA C sing N N 262 PRO CA CB sing N N 263 PRO CA HA sing N N 264 PRO C O doub N N 265 PRO C OXT sing N N 266 PRO CB CG sing N N 267 PRO CB HB2 sing N N 268 PRO CB HB3 sing N N 269 PRO CG CD sing N N 270 PRO CG HG2 sing N N 271 PRO CG HG3 sing N N 272 PRO CD HD2 sing N N 273 PRO CD HD3 sing N N 274 PRO OXT HXT sing N N 275 SER N CA sing N N 276 SER N H sing N N 277 SER N H2 sing N N 278 SER CA C sing N N 279 SER CA CB sing N N 280 SER CA HA sing N N 281 SER C O doub N N 282 SER C OXT sing N N 283 SER CB OG sing N N 284 SER CB HB2 sing N N 285 SER CB HB3 sing N N 286 SER OG HG sing N N 287 SER OXT HXT sing N N 288 THR N CA sing N N 289 THR N H sing N N 290 THR N H2 sing N N 291 THR CA C sing N N 292 THR CA CB sing N N 293 THR CA HA sing N N 294 THR C O doub N N 295 THR C OXT sing N N 296 THR CB OG1 sing N N 297 THR CB CG2 sing N N 298 THR CB HB sing N N 299 THR OG1 HG1 sing N N 300 THR CG2 HG21 sing N N 301 THR CG2 HG22 sing N N 302 THR CG2 HG23 sing N N 303 THR OXT HXT sing N N 304 TYR N CA sing N N 305 TYR N H sing N N 306 TYR N H2 sing N N 307 TYR CA C sing N N 308 TYR CA CB sing N N 309 TYR CA HA sing N N 310 TYR C O doub N N 311 TYR C OXT sing N N 312 TYR CB CG sing N N 313 TYR CB HB2 sing N N 314 TYR CB HB3 sing N N 315 TYR CG CD1 doub Y N 316 TYR CG CD2 sing Y N 317 TYR CD1 CE1 sing Y N 318 TYR CD1 HD1 sing N N 319 TYR CD2 CE2 doub Y N 320 TYR CD2 HD2 sing N N 321 TYR CE1 CZ doub Y N 322 TYR CE1 HE1 sing N N 323 TYR CE2 CZ sing Y N 324 TYR CE2 HE2 sing N N 325 TYR CZ OH sing N N 326 TYR OH HH sing N N 327 TYR OXT HXT sing N N 328 VAL N CA sing N N 329 VAL N H sing N N 330 VAL N H2 sing N N 331 VAL CA C sing N N 332 VAL CA CB sing N N 333 VAL CA HA sing N N 334 VAL C O doub N N 335 VAL C OXT sing N N 336 VAL CB CG1 sing N N 337 VAL CB CG2 sing N N 338 VAL CB HB sing N N 339 VAL CG1 HG11 sing N N 340 VAL CG1 HG12 sing N N 341 VAL CG1 HG13 sing N N 342 VAL CG2 HG21 sing N N 343 VAL CG2 HG22 sing N N 344 VAL CG2 HG23 sing N N 345 VAL OXT HXT sing N N 346 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number R01GM135614 _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 PYROPHOSPHATE PPV 3 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1KX5 _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #