data_6WA5 # _entry.id 6WA5 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6WA5 pdb_00006wa5 10.2210/pdb6wa5/pdb WWPDB D_1000247563 ? ? BMRB 30740 ? ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Solution NMR Structure of the G4L/Q5K/G6S (NOS) Unmyristoylated Feline Immunodeficiency Virus Matrix Protein' _pdbx_database_related.db_id 30740 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 6WA5 _pdbx_database_status.recvd_initial_deposition_date 2020-03-24 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Brown, J.B.' 1 0000-0003-1329-4063 'Summers, H.R.' 2 0000-0002-2936-9894 'Brown, L.A.' 3 0000-0001-7316-2041 'Marchant, J.' 4 0000-0002-2418-6247 'Canova, P.N.' 5 0000-0002-2269-773X ;O'Hern, C.T. ; 6 0000-0002-5896-2101 'Abbott, S.T.' 7 0000-0001-7077-5731 'Nyaunu, C.' 8 0000-0001-9898-1801 'Maxwell, S.' 9 0000-0002-5383-8726 'Johnson, T.' 10 0000-0001-5566-7679 'Moser, M.B.' 11 0000-0003-1471-607X 'Ablan, S.A.' 12 ? 'Carter, H.' 13 ? 'Freed, E.O.' 14 0000-0003-3345-022X 'Summers, M.F.' 15 0000-0003-4267-4380 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Mol.Biol. _citation.journal_id_ASTM JMOBAK _citation.journal_id_CSD 0070 _citation.journal_id_ISSN 1089-8638 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 432 _citation.language ? _citation.page_first 4076 _citation.page_last 4091 _citation.title 'Structural and Mechanistic Studies of the Rare Myristoylation Signal of the Feline Immunodeficiency Virus.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.jmb.2020.05.008 _citation.pdbx_database_id_PubMed 32442659 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Brown, J.B.' 1 ? primary 'Summers, H.R.' 2 ? primary 'Brown, L.A.' 3 ? primary 'Marchant, J.' 4 ? primary 'Canova, P.N.' 5 ? primary ;O'Hern, C.T. ; 6 ? primary 'Abbott, S.T.' 7 ? primary 'Nyaunu, C.' 8 ? primary 'Maxwell, S.' 9 ? primary 'Johnson, T.' 10 ? primary 'Moser, M.B.' 11 ? primary 'Ablan, S.D.' 12 ? primary 'Carter, H.' 13 ? primary 'Freed, E.O.' 14 ? primary 'Summers, M.F.' 15 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Matrix protein' _entity.formula_weight 14075.185 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation 'G4L, Q5K, G6S' _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name MA # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GNLKSRDWKMAIKRCSNVAVGVGGKSKKFGEGNFRWAIRMANVSTGREPGDIPETLDQLRLVICDLQERREKFGSSKEID MAIVTLKVFAVAGLLNMTVSTAAAAENMYSQMGLDTRPHHHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;GNLKSRDWKMAIKRCSNVAVGVGGKSKKFGEGNFRWAIRMANVSTGREPGDIPETLDQLRLVICDLQERREKFGSSKEID MAIVTLKVFAVAGLLNMTVSTAAAAENMYSQMGLDTRPHHHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ASN n 1 3 LEU n 1 4 LYS n 1 5 SER n 1 6 ARG n 1 7 ASP n 1 8 TRP n 1 9 LYS n 1 10 MET n 1 11 ALA n 1 12 ILE n 1 13 LYS n 1 14 ARG n 1 15 CYS n 1 16 SER n 1 17 ASN n 1 18 VAL n 1 19 ALA n 1 20 VAL n 1 21 GLY n 1 22 VAL n 1 23 GLY n 1 24 GLY n 1 25 LYS n 1 26 SER n 1 27 LYS n 1 28 LYS n 1 29 PHE n 1 30 GLY n 1 31 GLU n 1 32 GLY n 1 33 ASN n 1 34 PHE n 1 35 ARG n 1 36 TRP n 1 37 ALA n 1 38 ILE n 1 39 ARG n 1 40 MET n 1 41 ALA n 1 42 ASN n 1 43 VAL n 1 44 SER n 1 45 THR n 1 46 GLY n 1 47 ARG n 1 48 GLU n 1 49 PRO n 1 50 GLY n 1 51 ASP n 1 52 ILE n 1 53 PRO n 1 54 GLU n 1 55 THR n 1 56 LEU n 1 57 ASP n 1 58 GLN n 1 59 LEU n 1 60 ARG n 1 61 LEU n 1 62 VAL n 1 63 ILE n 1 64 CYS n 1 65 ASP n 1 66 LEU n 1 67 GLN n 1 68 GLU n 1 69 ARG n 1 70 ARG n 1 71 GLU n 1 72 LYS n 1 73 PHE n 1 74 GLY n 1 75 SER n 1 76 SER n 1 77 LYS n 1 78 GLU n 1 79 ILE n 1 80 ASP n 1 81 MET n 1 82 ALA n 1 83 ILE n 1 84 VAL n 1 85 THR n 1 86 LEU n 1 87 LYS n 1 88 VAL n 1 89 PHE n 1 90 ALA n 1 91 VAL n 1 92 ALA n 1 93 GLY n 1 94 LEU n 1 95 LEU n 1 96 ASN n 1 97 MET n 1 98 THR n 1 99 VAL n 1 100 SER n 1 101 THR n 1 102 ALA n 1 103 ALA n 1 104 ALA n 1 105 ALA n 1 106 GLU n 1 107 ASN n 1 108 MET n 1 109 TYR n 1 110 SER n 1 111 GLN n 1 112 MET n 1 113 GLY n 1 114 LEU n 1 115 ASP n 1 116 THR n 1 117 ARG n 1 118 PRO n 1 119 HIS n 1 120 HIS n 1 121 HIS n 1 122 HIS n 1 123 HIS n 1 124 HIS n 1 125 HIS n 1 126 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 126 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene GAG _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Feline immunodeficiency virus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 11673 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q66971_9RETR _struct_ref.pdbx_db_accession Q66971 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;GNGQGRDWKMAIKRCSNVAVGVGGKSKKFGEGNFRWAIRMANVSTGREPGDIPETLDQLRLVICDLQERREKFGSSKEID MAIVTLKVFAVAGLLNMTVSTAAAAENMYSQMGLDTRP ; _struct_ref.pdbx_align_begin 2 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6WA5 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 118 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q66971 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 119 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 119 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6WA5 LEU A 3 ? UNP Q66971 GLY 4 'engineered mutation' 4 1 1 6WA5 LYS A 4 ? UNP Q66971 GLN 5 'engineered mutation' 5 2 1 6WA5 SER A 5 ? UNP Q66971 GLY 6 'engineered mutation' 6 3 1 6WA5 HIS A 119 ? UNP Q66971 ? ? 'expression tag' 120 4 1 6WA5 HIS A 120 ? UNP Q66971 ? ? 'expression tag' 121 5 1 6WA5 HIS A 121 ? UNP Q66971 ? ? 'expression tag' 122 6 1 6WA5 HIS A 122 ? UNP Q66971 ? ? 'expression tag' 123 7 1 6WA5 HIS A 123 ? UNP Q66971 ? ? 'expression tag' 124 8 1 6WA5 HIS A 124 ? UNP Q66971 ? ? 'expression tag' 125 9 1 6WA5 HIS A 125 ? UNP Q66971 ? ? 'expression tag' 126 10 1 6WA5 HIS A 126 ? UNP Q66971 ? ? 'expression tag' 127 11 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 2 3 '2D 1H-1H NOESY' 1 isotropic 2 4 3 '2D 1H-1H NOESY' 1 isotropic 3 1 5 '2D 1H-15N HSQC' 1 isotropic 4 3 5 '2D 1H-15N HSQC' 2 isotropic 5 1 4 '3D CBCA(CO)NH' 1 isotropic 6 3 4 '3D CBCA(CO)NH' 1 isotropic 7 1 4 '3D HNCACB' 1 isotropic 8 3 4 '3D HNCACB' 1 isotropic 9 1 4 '3D HNCO' 1 isotropic 10 3 4 '3D HNCO' 1 isotropic 11 1 4 '3D HN(CA)CO' 1 isotropic 12 3 4 '3D HN(CA)CO' 1 isotropic 13 1 5 '3D 1H-15N NOESY' 1 isotropic 14 3 5 '3D 1H-15N NOESY' 2 isotropic 15 1 4 '4D HSQC-NOESY-HMQC' 1 isotropic 16 2 2 '4D HMQC-NOESY-HMQC' 1 isotropic 17 2 3 '2D 1H-13C HMQC' 1 isotropic 18 4 3 '2D 1H-13C HMQC' 1 isotropic # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.details _pdbx_nmr_exptl_sample_conditions.ionic_strength_err _pdbx_nmr_exptl_sample_conditions.ionic_strength_units _pdbx_nmr_exptl_sample_conditions.label _pdbx_nmr_exptl_sample_conditions.pH_err _pdbx_nmr_exptl_sample_conditions.pH_units _pdbx_nmr_exptl_sample_conditions.pressure_err _pdbx_nmr_exptl_sample_conditions.temperature_err _pdbx_nmr_exptl_sample_conditions.temperature_units 1 298 atm 1 8 5 ? ? mM conditions_1 ? pH ? ? K 2 298 atm 1 8 5 ? ? mM conditions_2 ? pD ? ? K 3 298 atm 1 5 5 ? ? mM conditions_3 ? pH ? ? K 4 298 atm 1 5 5 ? ? mM conditions_4 ? pD ? ? K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 5 ;50 mM sodium phosphate, 10 mM DTT, 5 mM sodium chloride, 4 g/L glucose, 1 g/L [U-99% 15N] ammonium chloride, 300 uM [U-15N] Unmyristoylated G4L/Q5K/G6S (NOS) Feline Immunodeficiency Virus Matrix Protein, 90% H2O/10% D2O ; '90% H2O/10% D2O' 1H/15N solution ? 2 ;50 mM sodium phosphate, 10 mM DTT, 5 mM sodium chloride, 4 g/L [U-99% 13C] glucose, 1 g/L ammonium chloride, 300 uM [U-13C] Unmyristoylated G4L/Q5K/G6S (NOS) Feline Immunodeficiency Virus Matrix Protein, 100% D2O ; '100% D2O' 1H/13C solution ? 4 ;50 mM sodium phosphate, 10 mM DTT, 5 mM sodium chloride, 4 g/L [U-99% 13C] glucose, 1 g/L [U-99% 15N] ammonium chloride, 300 uM [U-13C; U-15N] Unmyristoylated G4L/Q5K/G6S (NOS) Feline Immunodeficiency Virus Matrix Protein, 90% H2O/10% D2O ; '90% H2O/10% D2O' 1H/15N/13C solution ? 3 ;50 mM sodium phosphate, 10 mM DTT, 5 mM sodium chloride, 300 uM Unmyristoylated G4L/Q5K/G6S (NOS) Feline Immunodeficiency Virus Matrix Protein, 100% D2O ; '100% D2O' 1H solution ? # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 DMX ? Bruker 600 ? 2 DMX ? Bruker 500 ? # _pdbx_nmr_refine.entry_id 6WA5 _pdbx_nmr_refine.method na _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 8 # _pdbx_nmr_ensemble.entry_id 6WA5 _pdbx_nmr_ensemble.conformers_calculated_total_number 160 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 6WA5 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'target function' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 collection TopSpin ? 'Bruker Biospin' 2 processing NMRFx ? 'Johnson, One Moon Scientific' 3 processing NMRDraw ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 4 processing NMRPipe ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 5 'chemical shift assignment' NMRView ? 'Johnson, One Moon Scientific' 6 'peak picking' NMRView ? 'Johnson, One Moon Scientific' 7 'data analysis' NMRView ? 'Johnson, One Moon Scientific' 8 refinement CYANA ? 'Guntert, Mumenthaler and Wuthrich' 9 'structure calculation' CYANA ? 'Guntert, Mumenthaler and Wuthrich' # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6WA5 _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 6WA5 _struct.title 'Solution NMR Structure of the G4L/Q5K/G6S (NOS) Unmyristoylated Feline Immunodeficiency Virus Matrix Protein' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6WA5 _struct_keywords.text 'FIV, VIRAL PROTEIN' _struct_keywords.pdbx_keywords 'VIRAL PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LYS A 4 ? SER A 16 ? LYS A 5 SER A 17 1 ? 13 HELX_P HELX_P2 AA2 GLY A 30 ? THR A 45 ? GLY A 31 THR A 46 1 ? 16 HELX_P HELX_P3 AA3 THR A 55 ? GLY A 74 ? THR A 56 GLY A 75 1 ? 20 HELX_P HELX_P4 AA4 SER A 76 ? LEU A 95 ? SER A 77 LEU A 96 1 ? 20 HELX_P HELX_P5 AA5 THR A 101 ? MET A 112 ? THR A 102 MET A 113 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 6WA5 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 2 2 GLY GLY A . n A 1 2 ASN 2 3 3 ASN ASN A . n A 1 3 LEU 3 4 4 LEU LEU A . n A 1 4 LYS 4 5 5 LYS LYS A . n A 1 5 SER 5 6 6 SER SER A . n A 1 6 ARG 6 7 7 ARG ARG A . n A 1 7 ASP 7 8 8 ASP ASP A . n A 1 8 TRP 8 9 9 TRP TRP A . n A 1 9 LYS 9 10 10 LYS LYS A . n A 1 10 MET 10 11 11 MET MET A . n A 1 11 ALA 11 12 12 ALA ALA A . n A 1 12 ILE 12 13 13 ILE ILE A . n A 1 13 LYS 13 14 14 LYS LYS A . n A 1 14 ARG 14 15 15 ARG ARG A . n A 1 15 CYS 15 16 16 CYS CYS A . n A 1 16 SER 16 17 17 SER SER A . n A 1 17 ASN 17 18 18 ASN ASN A . n A 1 18 VAL 18 19 19 VAL VAL A . n A 1 19 ALA 19 20 20 ALA ALA A . n A 1 20 VAL 20 21 21 VAL VAL A . n A 1 21 GLY 21 22 22 GLY GLY A . n A 1 22 VAL 22 23 23 VAL VAL A . n A 1 23 GLY 23 24 24 GLY GLY A . n A 1 24 GLY 24 25 25 GLY GLY A . n A 1 25 LYS 25 26 26 LYS LYS A . n A 1 26 SER 26 27 27 SER SER A . n A 1 27 LYS 27 28 28 LYS LYS A . n A 1 28 LYS 28 29 29 LYS LYS A . n A 1 29 PHE 29 30 30 PHE PHE A . n A 1 30 GLY 30 31 31 GLY GLY A . n A 1 31 GLU 31 32 32 GLU GLU A . n A 1 32 GLY 32 33 33 GLY GLY A . n A 1 33 ASN 33 34 34 ASN ASN A . n A 1 34 PHE 34 35 35 PHE PHE A . n A 1 35 ARG 35 36 36 ARG ARG A . n A 1 36 TRP 36 37 37 TRP TRP A . n A 1 37 ALA 37 38 38 ALA ALA A . n A 1 38 ILE 38 39 39 ILE ILE A . n A 1 39 ARG 39 40 40 ARG ARG A . n A 1 40 MET 40 41 41 MET MET A . n A 1 41 ALA 41 42 42 ALA ALA A . n A 1 42 ASN 42 43 43 ASN ASN A . n A 1 43 VAL 43 44 44 VAL VAL A . n A 1 44 SER 44 45 45 SER SER A . n A 1 45 THR 45 46 46 THR THR A . n A 1 46 GLY 46 47 47 GLY GLY A . n A 1 47 ARG 47 48 48 ARG ARG A . n A 1 48 GLU 48 49 49 GLU GLU A . n A 1 49 PRO 49 50 50 PRO PRO A . n A 1 50 GLY 50 51 51 GLY GLY A . n A 1 51 ASP 51 52 52 ASP ASP A . n A 1 52 ILE 52 53 53 ILE ILE A . n A 1 53 PRO 53 54 54 PRO PRO A . n A 1 54 GLU 54 55 55 GLU GLU A . n A 1 55 THR 55 56 56 THR THR A . n A 1 56 LEU 56 57 57 LEU LEU A . n A 1 57 ASP 57 58 58 ASP ASP A . n A 1 58 GLN 58 59 59 GLN GLN A . n A 1 59 LEU 59 60 60 LEU LEU A . n A 1 60 ARG 60 61 61 ARG ARG A . n A 1 61 LEU 61 62 62 LEU LEU A . n A 1 62 VAL 62 63 63 VAL VAL A . n A 1 63 ILE 63 64 64 ILE ILE A . n A 1 64 CYS 64 65 65 CYS CYS A . n A 1 65 ASP 65 66 66 ASP ASP A . n A 1 66 LEU 66 67 67 LEU LEU A . n A 1 67 GLN 67 68 68 GLN GLN A . n A 1 68 GLU 68 69 69 GLU GLU A . n A 1 69 ARG 69 70 70 ARG ARG A . n A 1 70 ARG 70 71 71 ARG ARG A . n A 1 71 GLU 71 72 72 GLU GLU A . n A 1 72 LYS 72 73 73 LYS LYS A . n A 1 73 PHE 73 74 74 PHE PHE A . n A 1 74 GLY 74 75 75 GLY GLY A . n A 1 75 SER 75 76 76 SER SER A . n A 1 76 SER 76 77 77 SER SER A . n A 1 77 LYS 77 78 78 LYS LYS A . n A 1 78 GLU 78 79 79 GLU GLU A . n A 1 79 ILE 79 80 80 ILE ILE A . n A 1 80 ASP 80 81 81 ASP ASP A . n A 1 81 MET 81 82 82 MET MET A . n A 1 82 ALA 82 83 83 ALA ALA A . n A 1 83 ILE 83 84 84 ILE ILE A . n A 1 84 VAL 84 85 85 VAL VAL A . n A 1 85 THR 85 86 86 THR THR A . n A 1 86 LEU 86 87 87 LEU LEU A . n A 1 87 LYS 87 88 88 LYS LYS A . n A 1 88 VAL 88 89 89 VAL VAL A . n A 1 89 PHE 89 90 90 PHE PHE A . n A 1 90 ALA 90 91 91 ALA ALA A . n A 1 91 VAL 91 92 92 VAL VAL A . n A 1 92 ALA 92 93 93 ALA ALA A . n A 1 93 GLY 93 94 94 GLY GLY A . n A 1 94 LEU 94 95 95 LEU LEU A . n A 1 95 LEU 95 96 96 LEU LEU A . n A 1 96 ASN 96 97 97 ASN ASN A . n A 1 97 MET 97 98 98 MET MET A . n A 1 98 THR 98 99 99 THR THR A . n A 1 99 VAL 99 100 100 VAL VAL A . n A 1 100 SER 100 101 101 SER SER A . n A 1 101 THR 101 102 102 THR THR A . n A 1 102 ALA 102 103 103 ALA ALA A . n A 1 103 ALA 103 104 104 ALA ALA A . n A 1 104 ALA 104 105 105 ALA ALA A . n A 1 105 ALA 105 106 106 ALA ALA A . n A 1 106 GLU 106 107 107 GLU GLU A . n A 1 107 ASN 107 108 108 ASN ASN A . n A 1 108 MET 108 109 109 MET MET A . n A 1 109 TYR 109 110 110 TYR TYR A . n A 1 110 SER 110 111 111 SER SER A . n A 1 111 GLN 111 112 112 GLN GLN A . n A 1 112 MET 112 113 113 MET MET A . n A 1 113 GLY 113 114 114 GLY GLY A . n A 1 114 LEU 114 115 115 LEU LEU A . n A 1 115 ASP 115 116 116 ASP ASP A . n A 1 116 THR 116 117 117 THR THR A . n A 1 117 ARG 117 118 118 ARG ARG A . n A 1 118 PRO 118 119 119 PRO PRO A . n A 1 119 HIS 119 120 ? ? ? A . n A 1 120 HIS 120 121 ? ? ? A . n A 1 121 HIS 121 122 ? ? ? A . n A 1 122 HIS 122 123 ? ? ? A . n A 1 123 HIS 123 124 ? ? ? A . n A 1 124 HIS 124 125 ? ? ? A . n A 1 125 HIS 125 126 ? ? ? A . n A 1 126 HIS 126 127 ? ? ? A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-07-22 2 'Structure model' 1 1 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 2 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' database_2 2 2 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_database_status.status_code_nmr_data' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 5 'sodium phosphate' 50 ? mM 'natural abundance' 5 DTT 10 ? mM 'natural abundance' 5 'sodium chloride' 5 ? mM 'natural abundance' 5 glucose 4 ? g/L 'natural abundance' 5 'ammonium chloride' 1 ? g/L '[U-99% 15N]' 5 'Unmyristoylated G4L/Q5K/G6S (NOS) Feline Immunodeficiency Virus Matrix Protein' 300 ? uM '[U-15N]' 2 'sodium phosphate' 50 ? mM 'natural abundance' 2 DTT 10 ? mM 'natural abundance' 2 'sodium chloride' 5 ? mM 'natural abundance' 2 glucose 4 ? g/L '[U-99% 13C]' 2 'ammonium chloride' 1 ? g/L 'natural abundance' 2 'Unmyristoylated G4L/Q5K/G6S (NOS) Feline Immunodeficiency Virus Matrix Protein' 300 ? uM '[U-13C]' 4 'sodium phosphate' 50 ? mM 'natural abundance' 4 DTT 10 ? mM 'natural abundance' 4 'sodium chloride' 5 ? mM 'natural abundance' 4 glucose 4 ? g/L '[U-99% 13C]' 4 'ammonium chloride' 1 ? g/L '[U-99% 15N]' 4 'Unmyristoylated G4L/Q5K/G6S (NOS) Feline Immunodeficiency Virus Matrix Protein' 300 ? uM '[U-13C; U-15N]' 3 'sodium phosphate' 50 ? mM 'natural abundance' 3 DTT 10 ? mM 'natural abundance' 3 'sodium chloride' 5 ? mM 'natural abundance' 3 'Unmyristoylated G4L/Q5K/G6S (NOS) Feline Immunodeficiency Virus Matrix Protein' 300 ? uM 'natural abundance' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 23 ? ? -153.08 -41.33 2 1 ILE A 53 ? ? -113.41 75.08 3 1 SER A 77 ? ? -177.99 124.41 4 1 THR A 99 ? ? -119.91 51.95 5 1 ARG A 118 ? ? -116.30 72.42 6 2 VAL A 23 ? ? -140.40 40.75 7 2 SER A 27 ? ? -63.65 98.15 8 2 PRO A 54 ? ? -69.73 -170.69 9 2 GLU A 55 ? ? -169.28 -38.63 10 2 MET A 98 ? ? 63.56 106.07 11 2 SER A 101 ? ? -106.94 -62.77 12 2 ARG A 118 ? ? -116.51 73.04 13 3 LYS A 26 ? ? -174.72 -44.91 14 3 LYS A 28 ? ? -153.29 84.36 15 3 ILE A 53 ? ? -113.22 75.14 16 3 SER A 77 ? ? -179.39 117.96 17 3 VAL A 100 ? ? 65.13 152.09 18 3 ASP A 116 ? ? 60.25 176.35 19 3 THR A 117 ? ? 62.30 171.14 20 4 LEU A 4 ? ? -51.92 107.89 21 4 THR A 46 ? ? -98.64 33.00 22 4 ILE A 53 ? ? -113.30 75.15 23 4 SER A 77 ? ? -179.36 128.84 24 4 VAL A 100 ? ? 43.53 -164.82 25 5 ASN A 3 ? ? 62.90 104.37 26 5 PHE A 30 ? ? -54.64 101.57 27 5 ASP A 52 ? ? 63.54 178.37 28 5 GLU A 55 ? ? 55.94 87.12 29 5 THR A 99 ? ? -89.47 48.82 30 5 ASP A 116 ? ? -154.18 88.41 31 6 SER A 27 ? ? -179.32 71.90 32 6 PHE A 30 ? ? -58.30 -177.96 33 6 ARG A 48 ? ? -93.93 46.49 34 6 GLU A 49 ? ? 62.92 160.10 35 6 ILE A 53 ? ? -117.94 76.88 36 6 GLU A 55 ? ? -108.13 42.00 37 7 LEU A 4 ? ? -51.28 170.22 38 7 VAL A 23 ? ? -173.94 -37.02 39 7 LYS A 26 ? ? 61.76 172.59 40 7 PHE A 30 ? ? -55.82 176.37 41 7 ILE A 53 ? ? -113.22 75.47 42 7 MET A 98 ? ? 63.99 107.49 43 8 SER A 27 ? ? -142.41 42.86 44 8 ASP A 52 ? ? -136.46 -75.49 45 8 GLU A 55 ? ? -152.72 43.28 46 8 SER A 77 ? ? -179.35 124.54 47 8 THR A 99 ? ? -93.34 41.63 48 8 ARG A 118 ? ? -118.11 72.62 49 9 SER A 27 ? ? -175.43 70.85 50 9 ASP A 52 ? ? 63.78 -169.80 51 9 ILE A 53 ? ? -112.35 78.12 52 9 GLU A 55 ? ? -115.05 58.89 53 9 SER A 77 ? ? -176.89 113.00 54 9 MET A 98 ? ? 64.32 108.34 55 9 ARG A 118 ? ? -174.28 71.28 56 10 LEU A 4 ? ? -51.89 107.75 57 10 SER A 27 ? ? 61.79 95.19 58 10 PHE A 30 ? ? -57.96 -178.57 59 10 GLU A 49 ? ? 64.44 153.44 60 10 ILE A 53 ? ? -112.51 77.46 61 10 SER A 77 ? ? -175.50 124.34 62 11 SER A 27 ? ? -178.54 79.70 63 11 PHE A 30 ? ? -52.76 170.94 64 11 ARG A 48 ? ? -93.08 48.13 65 11 GLU A 49 ? ? 64.43 153.53 66 11 ILE A 53 ? ? -112.70 76.98 67 11 GLU A 55 ? ? -148.58 41.53 68 11 SER A 76 ? ? -115.28 78.16 69 11 ARG A 118 ? ? 59.02 71.36 70 12 LYS A 26 ? ? 61.13 179.76 71 12 GLU A 49 ? ? 64.29 153.38 72 12 ILE A 53 ? ? -113.17 77.03 73 12 SER A 77 ? ? -174.19 119.84 74 12 MET A 98 ? ? 63.51 164.14 75 12 THR A 99 ? ? 179.32 -34.08 76 12 THR A 117 ? ? -82.62 -70.04 77 12 ARG A 118 ? ? 62.71 72.36 78 13 PHE A 30 ? ? -68.87 -178.28 79 13 ASP A 52 ? ? -134.86 -75.64 80 14 ASN A 3 ? ? 61.59 100.30 81 14 LYS A 26 ? ? -166.37 110.46 82 14 ASP A 52 ? ? -103.19 76.17 83 14 GLU A 55 ? ? 60.33 76.66 84 14 THR A 99 ? ? -103.58 45.92 85 14 ARG A 118 ? ? 63.19 160.60 86 15 PRO A 54 ? ? -69.72 -170.16 87 15 ARG A 118 ? ? -166.99 70.82 88 16 LEU A 4 ? ? 57.44 70.35 89 16 LYS A 26 ? ? 52.77 85.19 90 16 GLU A 49 ? ? 62.78 159.41 91 16 ILE A 53 ? ? -113.24 75.15 92 16 GLU A 55 ? ? -143.52 31.77 93 16 SER A 77 ? ? -179.52 94.95 94 16 THR A 99 ? ? -104.74 53.37 95 16 ARG A 118 ? ? 52.22 73.49 96 17 ASN A 3 ? ? 55.51 87.77 97 17 LYS A 5 ? ? -51.67 103.26 98 17 LYS A 26 ? ? 69.19 -75.38 99 17 SER A 27 ? ? -164.44 91.82 100 17 GLU A 49 ? ? 64.48 153.60 101 17 ILE A 53 ? ? -113.69 73.66 102 17 GLU A 55 ? ? -106.27 48.57 103 17 VAL A 100 ? ? 65.10 151.90 104 17 THR A 117 ? ? -99.11 -67.84 105 18 VAL A 23 ? ? -178.81 -34.73 106 18 LYS A 26 ? ? -134.30 -71.09 107 18 SER A 27 ? ? -67.23 -74.37 108 18 PHE A 30 ? ? -57.95 -178.79 109 18 GLU A 49 ? ? 62.93 160.22 110 18 ILE A 53 ? ? -112.88 76.47 111 18 SER A 77 ? ? -179.46 99.23 112 18 VAL A 100 ? ? 71.53 -69.48 113 18 SER A 101 ? ? -179.57 -67.65 114 18 THR A 117 ? ? 59.30 92.59 115 19 LEU A 4 ? ? -51.81 104.58 116 19 GLU A 49 ? ? 62.90 160.19 117 19 ILE A 53 ? ? -111.87 79.11 118 19 SER A 77 ? ? -179.34 125.91 119 19 MET A 98 ? ? 66.71 139.91 120 19 THR A 99 ? ? -164.28 26.66 121 19 ARG A 118 ? ? -117.33 70.95 122 20 SER A 27 ? ? -61.25 -179.21 123 20 LYS A 28 ? ? 62.99 97.37 124 20 THR A 46 ? ? -98.90 34.73 125 20 GLU A 55 ? ? -93.87 41.08 126 20 SER A 77 ? ? -179.43 103.76 127 20 THR A 99 ? ? -113.39 56.77 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A HIS 120 ? A HIS 119 2 1 Y 1 A HIS 121 ? A HIS 120 3 1 Y 1 A HIS 122 ? A HIS 121 4 1 Y 1 A HIS 123 ? A HIS 122 5 1 Y 1 A HIS 124 ? A HIS 123 6 1 Y 1 A HIS 125 ? A HIS 124 7 1 Y 1 A HIS 126 ? A HIS 125 8 1 Y 1 A HIS 127 ? A HIS 126 9 2 Y 1 A HIS 120 ? A HIS 119 10 2 Y 1 A HIS 121 ? A HIS 120 11 2 Y 1 A HIS 122 ? A HIS 121 12 2 Y 1 A HIS 123 ? A HIS 122 13 2 Y 1 A HIS 124 ? A HIS 123 14 2 Y 1 A HIS 125 ? A HIS 124 15 2 Y 1 A HIS 126 ? A HIS 125 16 2 Y 1 A HIS 127 ? A HIS 126 17 3 Y 1 A HIS 120 ? A HIS 119 18 3 Y 1 A HIS 121 ? A HIS 120 19 3 Y 1 A HIS 122 ? A HIS 121 20 3 Y 1 A HIS 123 ? A HIS 122 21 3 Y 1 A HIS 124 ? A HIS 123 22 3 Y 1 A HIS 125 ? A HIS 124 23 3 Y 1 A HIS 126 ? A HIS 125 24 3 Y 1 A HIS 127 ? A HIS 126 25 4 Y 1 A HIS 120 ? A HIS 119 26 4 Y 1 A HIS 121 ? A HIS 120 27 4 Y 1 A HIS 122 ? A HIS 121 28 4 Y 1 A HIS 123 ? A HIS 122 29 4 Y 1 A HIS 124 ? A HIS 123 30 4 Y 1 A HIS 125 ? A HIS 124 31 4 Y 1 A HIS 126 ? A HIS 125 32 4 Y 1 A HIS 127 ? A HIS 126 33 5 Y 1 A HIS 120 ? A HIS 119 34 5 Y 1 A HIS 121 ? A HIS 120 35 5 Y 1 A HIS 122 ? A HIS 121 36 5 Y 1 A HIS 123 ? A HIS 122 37 5 Y 1 A HIS 124 ? A HIS 123 38 5 Y 1 A HIS 125 ? A HIS 124 39 5 Y 1 A HIS 126 ? A HIS 125 40 5 Y 1 A HIS 127 ? A HIS 126 41 6 Y 1 A HIS 120 ? A HIS 119 42 6 Y 1 A HIS 121 ? A HIS 120 43 6 Y 1 A HIS 122 ? A HIS 121 44 6 Y 1 A HIS 123 ? A HIS 122 45 6 Y 1 A HIS 124 ? A HIS 123 46 6 Y 1 A HIS 125 ? A HIS 124 47 6 Y 1 A HIS 126 ? A HIS 125 48 6 Y 1 A HIS 127 ? A HIS 126 49 7 Y 1 A HIS 120 ? A HIS 119 50 7 Y 1 A HIS 121 ? A HIS 120 51 7 Y 1 A HIS 122 ? A HIS 121 52 7 Y 1 A HIS 123 ? A HIS 122 53 7 Y 1 A HIS 124 ? A HIS 123 54 7 Y 1 A HIS 125 ? A HIS 124 55 7 Y 1 A HIS 126 ? A HIS 125 56 7 Y 1 A HIS 127 ? A HIS 126 57 8 Y 1 A HIS 120 ? A HIS 119 58 8 Y 1 A HIS 121 ? A HIS 120 59 8 Y 1 A HIS 122 ? A HIS 121 60 8 Y 1 A HIS 123 ? A HIS 122 61 8 Y 1 A HIS 124 ? A HIS 123 62 8 Y 1 A HIS 125 ? A HIS 124 63 8 Y 1 A HIS 126 ? A HIS 125 64 8 Y 1 A HIS 127 ? A HIS 126 65 9 Y 1 A HIS 120 ? A HIS 119 66 9 Y 1 A HIS 121 ? A HIS 120 67 9 Y 1 A HIS 122 ? A HIS 121 68 9 Y 1 A HIS 123 ? A HIS 122 69 9 Y 1 A HIS 124 ? A HIS 123 70 9 Y 1 A HIS 125 ? A HIS 124 71 9 Y 1 A HIS 126 ? A HIS 125 72 9 Y 1 A HIS 127 ? A HIS 126 73 10 Y 1 A HIS 120 ? A HIS 119 74 10 Y 1 A HIS 121 ? A HIS 120 75 10 Y 1 A HIS 122 ? A HIS 121 76 10 Y 1 A HIS 123 ? A HIS 122 77 10 Y 1 A HIS 124 ? A HIS 123 78 10 Y 1 A HIS 125 ? A HIS 124 79 10 Y 1 A HIS 126 ? A HIS 125 80 10 Y 1 A HIS 127 ? A HIS 126 81 11 Y 1 A HIS 120 ? A HIS 119 82 11 Y 1 A HIS 121 ? A HIS 120 83 11 Y 1 A HIS 122 ? A HIS 121 84 11 Y 1 A HIS 123 ? A HIS 122 85 11 Y 1 A HIS 124 ? A HIS 123 86 11 Y 1 A HIS 125 ? A HIS 124 87 11 Y 1 A HIS 126 ? A HIS 125 88 11 Y 1 A HIS 127 ? A HIS 126 89 12 Y 1 A HIS 120 ? A HIS 119 90 12 Y 1 A HIS 121 ? A HIS 120 91 12 Y 1 A HIS 122 ? A HIS 121 92 12 Y 1 A HIS 123 ? A HIS 122 93 12 Y 1 A HIS 124 ? A HIS 123 94 12 Y 1 A HIS 125 ? A HIS 124 95 12 Y 1 A HIS 126 ? A HIS 125 96 12 Y 1 A HIS 127 ? A HIS 126 97 13 Y 1 A HIS 120 ? A HIS 119 98 13 Y 1 A HIS 121 ? A HIS 120 99 13 Y 1 A HIS 122 ? A HIS 121 100 13 Y 1 A HIS 123 ? A HIS 122 101 13 Y 1 A HIS 124 ? A HIS 123 102 13 Y 1 A HIS 125 ? A HIS 124 103 13 Y 1 A HIS 126 ? A HIS 125 104 13 Y 1 A HIS 127 ? A HIS 126 105 14 Y 1 A HIS 120 ? A HIS 119 106 14 Y 1 A HIS 121 ? A HIS 120 107 14 Y 1 A HIS 122 ? A HIS 121 108 14 Y 1 A HIS 123 ? A HIS 122 109 14 Y 1 A HIS 124 ? A HIS 123 110 14 Y 1 A HIS 125 ? A HIS 124 111 14 Y 1 A HIS 126 ? A HIS 125 112 14 Y 1 A HIS 127 ? A HIS 126 113 15 Y 1 A HIS 120 ? A HIS 119 114 15 Y 1 A HIS 121 ? A HIS 120 115 15 Y 1 A HIS 122 ? A HIS 121 116 15 Y 1 A HIS 123 ? A HIS 122 117 15 Y 1 A HIS 124 ? A HIS 123 118 15 Y 1 A HIS 125 ? A HIS 124 119 15 Y 1 A HIS 126 ? A HIS 125 120 15 Y 1 A HIS 127 ? A HIS 126 121 16 Y 1 A HIS 120 ? A HIS 119 122 16 Y 1 A HIS 121 ? A HIS 120 123 16 Y 1 A HIS 122 ? A HIS 121 124 16 Y 1 A HIS 123 ? A HIS 122 125 16 Y 1 A HIS 124 ? A HIS 123 126 16 Y 1 A HIS 125 ? A HIS 124 127 16 Y 1 A HIS 126 ? A HIS 125 128 16 Y 1 A HIS 127 ? A HIS 126 129 17 Y 1 A HIS 120 ? A HIS 119 130 17 Y 1 A HIS 121 ? A HIS 120 131 17 Y 1 A HIS 122 ? A HIS 121 132 17 Y 1 A HIS 123 ? A HIS 122 133 17 Y 1 A HIS 124 ? A HIS 123 134 17 Y 1 A HIS 125 ? A HIS 124 135 17 Y 1 A HIS 126 ? A HIS 125 136 17 Y 1 A HIS 127 ? A HIS 126 137 18 Y 1 A HIS 120 ? A HIS 119 138 18 Y 1 A HIS 121 ? A HIS 120 139 18 Y 1 A HIS 122 ? A HIS 121 140 18 Y 1 A HIS 123 ? A HIS 122 141 18 Y 1 A HIS 124 ? A HIS 123 142 18 Y 1 A HIS 125 ? A HIS 124 143 18 Y 1 A HIS 126 ? A HIS 125 144 18 Y 1 A HIS 127 ? A HIS 126 145 19 Y 1 A HIS 120 ? A HIS 119 146 19 Y 1 A HIS 121 ? A HIS 120 147 19 Y 1 A HIS 122 ? A HIS 121 148 19 Y 1 A HIS 123 ? A HIS 122 149 19 Y 1 A HIS 124 ? A HIS 123 150 19 Y 1 A HIS 125 ? A HIS 124 151 19 Y 1 A HIS 126 ? A HIS 125 152 19 Y 1 A HIS 127 ? A HIS 126 153 20 Y 1 A HIS 120 ? A HIS 119 154 20 Y 1 A HIS 121 ? A HIS 120 155 20 Y 1 A HIS 122 ? A HIS 121 156 20 Y 1 A HIS 123 ? A HIS 122 157 20 Y 1 A HIS 124 ? A HIS 123 158 20 Y 1 A HIS 125 ? A HIS 124 159 20 Y 1 A HIS 126 ? A HIS 125 160 20 Y 1 A HIS 127 ? A HIS 126 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Howard Hughes Medical Institute (HHMI)' 'United States' ? 1 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' 'T32 GM066706' 2 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' 'R01 GM042561' 3 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' 'IMSD R25 GM-055036-18' 4 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' 'U54 GM103297' 5 'National Science Foundation (NSF, United States)' 'United States' DGE-1144243 6 'National Science Foundation (NSF, United States)' 'United States' 1460653 7 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' 'R37 AI30917' 8 'National Institutes of Health/National Cancer Institute (NIH/NCI)' 'United States' ? 9 # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'mass spectrometry' _pdbx_struct_assembly_auth_evidence.details ? #