data_6WVS # _entry.id 6WVS # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.389 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6WVS pdb_00006wvs 10.2210/pdb6wvs/pdb WWPDB D_1000248731 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-11-25 2 'Structure model' 1 1 2020-12-02 3 'Structure model' 1 2 2020-12-16 4 'Structure model' 1 3 2024-03-06 5 'Structure model' 1 4 2024-04-03 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 2 'Structure model' 'Structure summary' 3 3 'Structure model' 'Database references' 4 4 'Structure model' 'Data collection' 5 4 'Structure model' 'Database references' 6 5 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' audit_author 2 2 'Structure model' citation 3 2 'Structure model' citation_author 4 2 'Structure model' entity 5 2 'Structure model' struct 6 3 'Structure model' citation 7 3 'Structure model' citation_author 8 4 'Structure model' chem_comp_atom 9 4 'Structure model' chem_comp_bond 10 4 'Structure model' database_2 11 5 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.pdbx_database_id_PubMed' 2 2 'Structure model' '_citation.title' 3 2 'Structure model' '_entity.pdbx_description' 4 2 'Structure model' '_struct.title' 5 3 'Structure model' '_citation.journal_volume' 6 3 'Structure model' '_citation.page_first' 7 3 'Structure model' '_citation.page_last' 8 3 'Structure model' '_citation_author.identifier_ORCID' 9 4 'Structure model' '_database_2.pdbx_DOI' 10 4 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6WVS _pdbx_database_status.recvd_initial_deposition_date 2020-05-06 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Bick, M.J.' 1 0000-0002-9585-859X 'Haydon, I.C.' 2 0000-0001-7227-9811 'Caldwell, S.J.' 3 0000-0002-9518-0168 'Zeymer, C.' 4 0000-0001-7138-381X 'Huang, P.' 5 0000-0002-7948-2895 'Fernandez-Velasco, D.A.' 6 ? 'Baker, D.' 7 0000-0001-7896-6217 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Proc.Natl.Acad.Sci.USA _citation.journal_id_ASTM PNASA6 _citation.journal_id_CSD 0040 _citation.journal_id_ISSN 1091-6490 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 117 _citation.language ? _citation.page_first 30362 _citation.page_last 30369 _citation.title 'Tight and specific lanthanide binding in a de novo TIM barrel with a large internal cavity designed by symmetric domain fusion.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1073/pnas.2008535117 _citation.pdbx_database_id_PubMed 33203677 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Caldwell, S.J.' 1 ? primary 'Haydon, I.C.' 2 ? primary 'Piperidou, N.' 3 ? primary 'Huang, P.S.' 4 ? primary 'Bick, M.J.' 5 ? primary 'Sjostrom, H.S.' 6 ? primary 'Hilvert, D.' 7 ? primary 'Baker, D.' 8 ? primary 'Zeymer, C.' 9 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'DeNovoTIM15 hyperstable de novo TIM barrel' 21824.438 1 ? ? ? ? 2 water nat water 18.015 19 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MDILIVNATDVDEMLKQVEILRRLGAKQIAVVSDDWRILQEALKKGGDILIVNATDVDEMLKQVEILRRLGAKQIAVVSD DWRILQEALKKGGDILIVNATDVDEMLKQVEILRRLGAKQIAVVSDDWRILQEALKKGGDILIVNATDVDEMLKQVEILR RLGAKQIAVVSDDWRILQEALKKGGLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MDILIVNATDVDEMLKQVEILRRLGAKQIAVVSDDWRILQEALKKGGDILIVNATDVDEMLKQVEILRRLGAKQIAVVSD DWRILQEALKKGGDILIVNATDVDEMLKQVEILRRLGAKQIAVVSDDWRILQEALKKGGDILIVNATDVDEMLKQVEILR RLGAKQIAVVSDDWRILQEALKKGGLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASP n 1 3 ILE n 1 4 LEU n 1 5 ILE n 1 6 VAL n 1 7 ASN n 1 8 ALA n 1 9 THR n 1 10 ASP n 1 11 VAL n 1 12 ASP n 1 13 GLU n 1 14 MET n 1 15 LEU n 1 16 LYS n 1 17 GLN n 1 18 VAL n 1 19 GLU n 1 20 ILE n 1 21 LEU n 1 22 ARG n 1 23 ARG n 1 24 LEU n 1 25 GLY n 1 26 ALA n 1 27 LYS n 1 28 GLN n 1 29 ILE n 1 30 ALA n 1 31 VAL n 1 32 VAL n 1 33 SER n 1 34 ASP n 1 35 ASP n 1 36 TRP n 1 37 ARG n 1 38 ILE n 1 39 LEU n 1 40 GLN n 1 41 GLU n 1 42 ALA n 1 43 LEU n 1 44 LYS n 1 45 LYS n 1 46 GLY n 1 47 GLY n 1 48 ASP n 1 49 ILE n 1 50 LEU n 1 51 ILE n 1 52 VAL n 1 53 ASN n 1 54 ALA n 1 55 THR n 1 56 ASP n 1 57 VAL n 1 58 ASP n 1 59 GLU n 1 60 MET n 1 61 LEU n 1 62 LYS n 1 63 GLN n 1 64 VAL n 1 65 GLU n 1 66 ILE n 1 67 LEU n 1 68 ARG n 1 69 ARG n 1 70 LEU n 1 71 GLY n 1 72 ALA n 1 73 LYS n 1 74 GLN n 1 75 ILE n 1 76 ALA n 1 77 VAL n 1 78 VAL n 1 79 SER n 1 80 ASP n 1 81 ASP n 1 82 TRP n 1 83 ARG n 1 84 ILE n 1 85 LEU n 1 86 GLN n 1 87 GLU n 1 88 ALA n 1 89 LEU n 1 90 LYS n 1 91 LYS n 1 92 GLY n 1 93 GLY n 1 94 ASP n 1 95 ILE n 1 96 LEU n 1 97 ILE n 1 98 VAL n 1 99 ASN n 1 100 ALA n 1 101 THR n 1 102 ASP n 1 103 VAL n 1 104 ASP n 1 105 GLU n 1 106 MET n 1 107 LEU n 1 108 LYS n 1 109 GLN n 1 110 VAL n 1 111 GLU n 1 112 ILE n 1 113 LEU n 1 114 ARG n 1 115 ARG n 1 116 LEU n 1 117 GLY n 1 118 ALA n 1 119 LYS n 1 120 GLN n 1 121 ILE n 1 122 ALA n 1 123 VAL n 1 124 VAL n 1 125 SER n 1 126 ASP n 1 127 ASP n 1 128 TRP n 1 129 ARG n 1 130 ILE n 1 131 LEU n 1 132 GLN n 1 133 GLU n 1 134 ALA n 1 135 LEU n 1 136 LYS n 1 137 LYS n 1 138 GLY n 1 139 GLY n 1 140 ASP n 1 141 ILE n 1 142 LEU n 1 143 ILE n 1 144 VAL n 1 145 ASN n 1 146 ALA n 1 147 THR n 1 148 ASP n 1 149 VAL n 1 150 ASP n 1 151 GLU n 1 152 MET n 1 153 LEU n 1 154 LYS n 1 155 GLN n 1 156 VAL n 1 157 GLU n 1 158 ILE n 1 159 LEU n 1 160 ARG n 1 161 ARG n 1 162 LEU n 1 163 GLY n 1 164 ALA n 1 165 LYS n 1 166 GLN n 1 167 ILE n 1 168 ALA n 1 169 VAL n 1 170 VAL n 1 171 SER n 1 172 ASP n 1 173 ASP n 1 174 TRP n 1 175 ARG n 1 176 ILE n 1 177 LEU n 1 178 GLN n 1 179 GLU n 1 180 ALA n 1 181 LEU n 1 182 LYS n 1 183 LYS n 1 184 GLY n 1 185 GLY n 1 186 LEU n 1 187 GLU n 1 188 HIS n 1 189 HIS n 1 190 HIS n 1 191 HIS n 1 192 HIS n 1 193 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 193 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'synthetic construct' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 32630 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 ILE 3 3 3 ILE ILE A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 ILE 5 5 5 ILE ILE A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 ASN 7 7 7 ASN ASN A . n A 1 8 ALA 8 8 8 ALA ALA A . n A 1 9 THR 9 9 9 THR THR A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 ASP 12 12 12 ASP ASP A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 MET 14 14 14 MET MET A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 GLN 17 17 17 GLN GLN A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 ARG 22 22 22 ARG ARG A . n A 1 23 ARG 23 23 23 ARG ARG A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 GLN 28 28 28 GLN GLN A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 ASP 34 34 34 ASP ASP A . n A 1 35 ASP 35 35 35 ASP ASP A . n A 1 36 TRP 36 36 36 TRP TRP A . n A 1 37 ARG 37 37 37 ARG ARG A . n A 1 38 ILE 38 38 38 ILE ILE A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 GLN 40 40 40 GLN GLN A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 LYS 44 44 44 LYS LYS A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 ASP 48 48 48 ASP ASP A . n A 1 49 ILE 49 49 49 ILE ILE A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 ILE 51 51 51 ILE ILE A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 ASN 53 53 53 ASN ASN A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 THR 55 55 55 THR THR A . n A 1 56 ASP 56 56 56 ASP ASP A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 MET 60 60 60 MET MET A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 LYS 62 62 62 LYS LYS A . n A 1 63 GLN 63 63 63 GLN GLN A . n A 1 64 VAL 64 64 64 VAL VAL A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 ILE 66 66 66 ILE ILE A . n A 1 67 LEU 67 67 67 LEU LEU A . n A 1 68 ARG 68 68 68 ARG ARG A . n A 1 69 ARG 69 69 69 ARG ARG A . n A 1 70 LEU 70 70 70 LEU LEU A . n A 1 71 GLY 71 71 71 GLY GLY A . n A 1 72 ALA 72 72 72 ALA ALA A . n A 1 73 LYS 73 73 73 LYS LYS A . n A 1 74 GLN 74 74 74 GLN GLN A . n A 1 75 ILE 75 75 75 ILE ILE A . n A 1 76 ALA 76 76 76 ALA ALA A . n A 1 77 VAL 77 77 77 VAL VAL A . n A 1 78 VAL 78 78 78 VAL VAL A . n A 1 79 SER 79 79 79 SER SER A . n A 1 80 ASP 80 80 80 ASP ASP A . n A 1 81 ASP 81 81 81 ASP ASP A . n A 1 82 TRP 82 82 82 TRP TRP A . n A 1 83 ARG 83 83 83 ARG ARG A . n A 1 84 ILE 84 84 84 ILE ILE A . n A 1 85 LEU 85 85 85 LEU LEU A . n A 1 86 GLN 86 86 86 GLN GLN A . n A 1 87 GLU 87 87 87 GLU GLU A . n A 1 88 ALA 88 88 88 ALA ALA A . n A 1 89 LEU 89 89 89 LEU LEU A . n A 1 90 LYS 90 90 90 LYS LYS A . n A 1 91 LYS 91 91 91 LYS LYS A . n A 1 92 GLY 92 92 92 GLY GLY A . n A 1 93 GLY 93 93 93 GLY GLY A . n A 1 94 ASP 94 94 94 ASP ASP A . n A 1 95 ILE 95 95 95 ILE ILE A . n A 1 96 LEU 96 96 96 LEU LEU A . n A 1 97 ILE 97 97 97 ILE ILE A . n A 1 98 VAL 98 98 98 VAL VAL A . n A 1 99 ASN 99 99 99 ASN ASN A . n A 1 100 ALA 100 100 100 ALA ALA A . n A 1 101 THR 101 101 101 THR THR A . n A 1 102 ASP 102 102 102 ASP ASP A . n A 1 103 VAL 103 103 103 VAL VAL A . n A 1 104 ASP 104 104 104 ASP ASP A . n A 1 105 GLU 105 105 105 GLU GLU A . n A 1 106 MET 106 106 106 MET MET A . n A 1 107 LEU 107 107 107 LEU LEU A . n A 1 108 LYS 108 108 108 LYS LYS A . n A 1 109 GLN 109 109 109 GLN GLN A . n A 1 110 VAL 110 110 110 VAL VAL A . n A 1 111 GLU 111 111 111 GLU GLU A . n A 1 112 ILE 112 112 112 ILE ILE A . n A 1 113 LEU 113 113 113 LEU LEU A . n A 1 114 ARG 114 114 114 ARG ARG A . n A 1 115 ARG 115 115 115 ARG ARG A . n A 1 116 LEU 116 116 116 LEU LEU A . n A 1 117 GLY 117 117 117 GLY GLY A . n A 1 118 ALA 118 118 118 ALA ALA A . n A 1 119 LYS 119 119 119 LYS LYS A . n A 1 120 GLN 120 120 120 GLN GLN A . n A 1 121 ILE 121 121 121 ILE ILE A . n A 1 122 ALA 122 122 122 ALA ALA A . n A 1 123 VAL 123 123 123 VAL VAL A . n A 1 124 VAL 124 124 124 VAL VAL A . n A 1 125 SER 125 125 125 SER SER A . n A 1 126 ASP 126 126 126 ASP ASP A . n A 1 127 ASP 127 127 127 ASP ASP A . n A 1 128 TRP 128 128 128 TRP TRP A . n A 1 129 ARG 129 129 129 ARG ARG A . n A 1 130 ILE 130 130 130 ILE ILE A . n A 1 131 LEU 131 131 131 LEU LEU A . n A 1 132 GLN 132 132 132 GLN GLN A . n A 1 133 GLU 133 133 133 GLU GLU A . n A 1 134 ALA 134 134 134 ALA ALA A . n A 1 135 LEU 135 135 135 LEU LEU A . n A 1 136 LYS 136 136 136 LYS LYS A . n A 1 137 LYS 137 137 137 LYS LYS A . n A 1 138 GLY 138 138 138 GLY GLY A . n A 1 139 GLY 139 139 139 GLY GLY A . n A 1 140 ASP 140 140 140 ASP ASP A . n A 1 141 ILE 141 141 141 ILE ILE A . n A 1 142 LEU 142 142 142 LEU LEU A . n A 1 143 ILE 143 143 143 ILE ILE A . n A 1 144 VAL 144 144 144 VAL VAL A . n A 1 145 ASN 145 145 145 ASN ASN A . n A 1 146 ALA 146 146 146 ALA ALA A . n A 1 147 THR 147 147 147 THR THR A . n A 1 148 ASP 148 148 148 ASP ASP A . n A 1 149 VAL 149 149 149 VAL VAL A . n A 1 150 ASP 150 150 150 ASP ASP A . n A 1 151 GLU 151 151 151 GLU GLU A . n A 1 152 MET 152 152 152 MET MET A . n A 1 153 LEU 153 153 153 LEU LEU A . n A 1 154 LYS 154 154 154 LYS LYS A . n A 1 155 GLN 155 155 155 GLN GLN A . n A 1 156 VAL 156 156 156 VAL VAL A . n A 1 157 GLU 157 157 157 GLU GLU A . n A 1 158 ILE 158 158 158 ILE ILE A . n A 1 159 LEU 159 159 159 LEU LEU A . n A 1 160 ARG 160 160 160 ARG ARG A . n A 1 161 ARG 161 161 161 ARG ARG A . n A 1 162 LEU 162 162 162 LEU LEU A . n A 1 163 GLY 163 163 163 GLY GLY A . n A 1 164 ALA 164 164 164 ALA ALA A . n A 1 165 LYS 165 165 165 LYS LYS A . n A 1 166 GLN 166 166 166 GLN GLN A . n A 1 167 ILE 167 167 167 ILE ILE A . n A 1 168 ALA 168 168 168 ALA ALA A . n A 1 169 VAL 169 169 169 VAL VAL A . n A 1 170 VAL 170 170 170 VAL VAL A . n A 1 171 SER 171 171 171 SER SER A . n A 1 172 ASP 172 172 172 ASP ASP A . n A 1 173 ASP 173 173 173 ASP ASP A . n A 1 174 TRP 174 174 174 TRP TRP A . n A 1 175 ARG 175 175 175 ARG ARG A . n A 1 176 ILE 176 176 176 ILE ILE A . n A 1 177 LEU 177 177 177 LEU LEU A . n A 1 178 GLN 178 178 178 GLN GLN A . n A 1 179 GLU 179 179 179 GLU GLU A . n A 1 180 ALA 180 180 180 ALA ALA A . n A 1 181 LEU 181 181 181 LEU LEU A . n A 1 182 LYS 182 182 182 LYS LYS A . n A 1 183 LYS 183 183 183 LYS LYS A . n A 1 184 GLY 184 184 ? ? ? A . n A 1 185 GLY 185 185 ? ? ? A . n A 1 186 LEU 186 186 ? ? ? A . n A 1 187 GLU 187 187 ? ? ? A . n A 1 188 HIS 188 188 ? ? ? A . n A 1 189 HIS 189 189 ? ? ? A . n A 1 190 HIS 190 190 ? ? ? A . n A 1 191 HIS 191 191 ? ? ? A . n A 1 192 HIS 192 192 ? ? ? A . n A 1 193 HIS 193 193 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 201 7 HOH HOH A . B 2 HOH 2 202 14 HOH HOH A . B 2 HOH 3 203 18 HOH HOH A . B 2 HOH 4 204 12 HOH HOH A . B 2 HOH 5 205 6 HOH HOH A . B 2 HOH 6 206 3 HOH HOH A . B 2 HOH 7 207 4 HOH HOH A . B 2 HOH 8 208 9 HOH HOH A . B 2 HOH 9 209 2 HOH HOH A . B 2 HOH 10 210 1 HOH HOH A . B 2 HOH 11 211 5 HOH HOH A . B 2 HOH 12 212 17 HOH HOH A . B 2 HOH 13 213 19 HOH HOH A . B 2 HOH 14 214 16 HOH HOH A . B 2 HOH 15 215 11 HOH HOH A . B 2 HOH 16 216 15 HOH HOH A . B 2 HOH 17 217 13 HOH HOH A . B 2 HOH 18 218 10 HOH HOH A . B 2 HOH 19 219 8 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A THR 9 ? OG1 ? A THR 9 OG1 2 1 Y 1 A THR 9 ? CG2 ? A THR 9 CG2 3 1 Y 1 A ASP 10 ? CG ? A ASP 10 CG 4 1 Y 1 A ASP 10 ? OD1 ? A ASP 10 OD1 5 1 Y 1 A ASP 10 ? OD2 ? A ASP 10 OD2 6 1 Y 1 A GLU 13 ? CG ? A GLU 13 CG 7 1 Y 1 A GLU 13 ? CD ? A GLU 13 CD 8 1 Y 1 A GLU 13 ? OE1 ? A GLU 13 OE1 9 1 Y 1 A GLU 13 ? OE2 ? A GLU 13 OE2 10 1 Y 1 A MET 14 ? SD ? A MET 14 SD 11 1 Y 1 A MET 14 ? CE ? A MET 14 CE 12 1 Y 1 A LEU 15 ? CG ? A LEU 15 CG 13 1 Y 1 A LEU 15 ? CD1 ? A LEU 15 CD1 14 1 Y 1 A LEU 15 ? CD2 ? A LEU 15 CD2 15 1 Y 1 A LYS 16 ? CG ? A LYS 16 CG 16 1 Y 1 A LYS 16 ? CD ? A LYS 16 CD 17 1 Y 1 A LYS 16 ? CE ? A LYS 16 CE 18 1 Y 1 A LYS 16 ? NZ ? A LYS 16 NZ 19 1 Y 1 A GLU 19 ? CG ? A GLU 19 CG 20 1 Y 1 A GLU 19 ? CD ? A GLU 19 CD 21 1 Y 1 A GLU 19 ? OE1 ? A GLU 19 OE1 22 1 Y 1 A GLU 19 ? OE2 ? A GLU 19 OE2 23 1 Y 1 A ILE 20 ? CD1 ? A ILE 20 CD1 24 1 Y 1 A LYS 27 ? CD ? A LYS 27 CD 25 1 Y 1 A LYS 27 ? CE ? A LYS 27 CE 26 1 Y 1 A LYS 27 ? NZ ? A LYS 27 NZ 27 1 Y 1 A ASP 34 ? CG ? A ASP 34 CG 28 1 Y 1 A ASP 34 ? OD1 ? A ASP 34 OD1 29 1 Y 1 A ASP 34 ? OD2 ? A ASP 34 OD2 30 1 Y 1 A GLU 41 ? CD ? A GLU 41 CD 31 1 Y 1 A GLU 41 ? OE1 ? A GLU 41 OE1 32 1 Y 1 A GLU 41 ? OE2 ? A GLU 41 OE2 33 1 Y 1 A LYS 44 ? CD ? A LYS 44 CD 34 1 Y 1 A LYS 44 ? CE ? A LYS 44 CE 35 1 Y 1 A LYS 44 ? NZ ? A LYS 44 NZ 36 1 Y 1 A LYS 45 ? CD ? A LYS 45 CD 37 1 Y 1 A LYS 45 ? CE ? A LYS 45 CE 38 1 Y 1 A LYS 45 ? NZ ? A LYS 45 NZ 39 1 Y 1 A ASP 56 ? CG ? A ASP 56 CG 40 1 Y 1 A ASP 56 ? OD1 ? A ASP 56 OD1 41 1 Y 1 A ASP 56 ? OD2 ? A ASP 56 OD2 42 1 Y 1 A GLU 59 ? CD ? A GLU 59 CD 43 1 Y 1 A GLU 59 ? OE1 ? A GLU 59 OE1 44 1 Y 1 A GLU 59 ? OE2 ? A GLU 59 OE2 45 1 Y 1 A GLU 65 ? CD ? A GLU 65 CD 46 1 Y 1 A GLU 65 ? OE1 ? A GLU 65 OE1 47 1 Y 1 A GLU 65 ? OE2 ? A GLU 65 OE2 48 1 Y 1 A ARG 68 ? CD ? A ARG 68 CD 49 1 Y 1 A ARG 68 ? NE ? A ARG 68 NE 50 1 Y 1 A ARG 68 ? CZ ? A ARG 68 CZ 51 1 Y 1 A ARG 68 ? NH1 ? A ARG 68 NH1 52 1 Y 1 A ARG 68 ? NH2 ? A ARG 68 NH2 53 1 Y 1 A LYS 73 ? CE ? A LYS 73 CE 54 1 Y 1 A LYS 73 ? NZ ? A LYS 73 NZ 55 1 Y 1 A ILE 84 ? CD1 ? A ILE 84 CD1 56 1 Y 1 A GLU 87 ? OE1 ? A GLU 87 OE1 57 1 Y 1 A GLU 87 ? OE2 ? A GLU 87 OE2 58 1 Y 1 A LYS 90 ? CD ? A LYS 90 CD 59 1 Y 1 A LYS 90 ? CE ? A LYS 90 CE 60 1 Y 1 A LYS 90 ? NZ ? A LYS 90 NZ 61 1 Y 1 A LYS 91 ? CD ? A LYS 91 CD 62 1 Y 1 A LYS 91 ? CE ? A LYS 91 CE 63 1 Y 1 A LYS 91 ? NZ ? A LYS 91 NZ 64 1 Y 1 A ASP 102 ? OD1 ? A ASP 102 OD1 65 1 Y 1 A ASP 102 ? OD2 ? A ASP 102 OD2 66 1 Y 1 A GLU 105 ? CD ? A GLU 105 CD 67 1 Y 1 A GLU 105 ? OE1 ? A GLU 105 OE1 68 1 Y 1 A GLU 105 ? OE2 ? A GLU 105 OE2 69 1 Y 1 A LEU 107 ? CG ? A LEU 107 CG 70 1 Y 1 A LEU 107 ? CD1 ? A LEU 107 CD1 71 1 Y 1 A LEU 107 ? CD2 ? A LEU 107 CD2 72 1 Y 1 A LYS 108 ? CG ? A LYS 108 CG 73 1 Y 1 A LYS 108 ? CD ? A LYS 108 CD 74 1 Y 1 A LYS 108 ? CE ? A LYS 108 CE 75 1 Y 1 A LYS 108 ? NZ ? A LYS 108 NZ 76 1 Y 1 A ARG 115 ? NE ? A ARG 115 NE 77 1 Y 1 A ARG 115 ? CZ ? A ARG 115 CZ 78 1 Y 1 A ARG 115 ? NH1 ? A ARG 115 NH1 79 1 Y 1 A ARG 115 ? NH2 ? A ARG 115 NH2 80 1 Y 1 A LYS 119 ? CE ? A LYS 119 CE 81 1 Y 1 A LYS 119 ? NZ ? A LYS 119 NZ 82 1 Y 1 A ASP 127 ? CG ? A ASP 127 CG 83 1 Y 1 A ASP 127 ? OD1 ? A ASP 127 OD1 84 1 Y 1 A ASP 127 ? OD2 ? A ASP 127 OD2 85 1 Y 1 A ARG 129 ? CG ? A ARG 129 CG 86 1 Y 1 A ARG 129 ? CD ? A ARG 129 CD 87 1 Y 1 A ARG 129 ? NE ? A ARG 129 NE 88 1 Y 1 A ARG 129 ? CZ ? A ARG 129 CZ 89 1 Y 1 A ARG 129 ? NH1 ? A ARG 129 NH1 90 1 Y 1 A ARG 129 ? NH2 ? A ARG 129 NH2 91 1 Y 1 A LYS 136 ? CE ? A LYS 136 CE 92 1 Y 1 A LYS 136 ? NZ ? A LYS 136 NZ 93 1 Y 1 A LYS 137 ? CD ? A LYS 137 CD 94 1 Y 1 A LYS 137 ? CE ? A LYS 137 CE 95 1 Y 1 A LYS 137 ? NZ ? A LYS 137 NZ 96 1 Y 1 A THR 147 ? OG1 ? A THR 147 OG1 97 1 Y 1 A THR 147 ? CG2 ? A THR 147 CG2 98 1 Y 1 A ASP 148 ? CG ? A ASP 148 CG 99 1 Y 1 A ASP 148 ? OD1 ? A ASP 148 OD1 100 1 Y 1 A ASP 148 ? OD2 ? A ASP 148 OD2 101 1 Y 1 A ASP 150 ? CG ? A ASP 150 CG 102 1 Y 1 A ASP 150 ? OD1 ? A ASP 150 OD1 103 1 Y 1 A ASP 150 ? OD2 ? A ASP 150 OD2 104 1 Y 1 A GLU 151 ? CG ? A GLU 151 CG 105 1 Y 1 A GLU 151 ? CD ? A GLU 151 CD 106 1 Y 1 A GLU 151 ? OE1 ? A GLU 151 OE1 107 1 Y 1 A GLU 151 ? OE2 ? A GLU 151 OE2 108 1 Y 1 A LYS 154 ? CE ? A LYS 154 CE 109 1 Y 1 A LYS 154 ? NZ ? A LYS 154 NZ 110 1 Y 1 A GLU 157 ? CD ? A GLU 157 CD 111 1 Y 1 A GLU 157 ? OE1 ? A GLU 157 OE1 112 1 Y 1 A GLU 157 ? OE2 ? A GLU 157 OE2 113 1 Y 1 A SER 171 ? OG ? A SER 171 OG 114 1 Y 1 A TRP 174 ? CG ? A TRP 174 CG 115 1 Y 1 A TRP 174 ? CD1 ? A TRP 174 CD1 116 1 Y 1 A TRP 174 ? CD2 ? A TRP 174 CD2 117 1 Y 1 A TRP 174 ? NE1 ? A TRP 174 NE1 118 1 Y 1 A TRP 174 ? CE2 ? A TRP 174 CE2 119 1 Y 1 A TRP 174 ? CE3 ? A TRP 174 CE3 120 1 Y 1 A TRP 174 ? CZ2 ? A TRP 174 CZ2 121 1 Y 1 A TRP 174 ? CZ3 ? A TRP 174 CZ3 122 1 Y 1 A TRP 174 ? CH2 ? A TRP 174 CH2 123 1 Y 1 A ARG 175 ? CG ? A ARG 175 CG 124 1 Y 1 A ARG 175 ? CD ? A ARG 175 CD 125 1 Y 1 A ARG 175 ? NE ? A ARG 175 NE 126 1 Y 1 A ARG 175 ? CZ ? A ARG 175 CZ 127 1 Y 1 A ARG 175 ? NH1 ? A ARG 175 NH1 128 1 Y 1 A ARG 175 ? NH2 ? A ARG 175 NH2 129 1 Y 1 A GLN 178 ? CG ? A GLN 178 CG 130 1 Y 1 A GLN 178 ? CD ? A GLN 178 CD 131 1 Y 1 A GLN 178 ? OE1 ? A GLN 178 OE1 132 1 Y 1 A GLN 178 ? NE2 ? A GLN 178 NE2 133 1 Y 1 A GLU 179 ? CD ? A GLU 179 CD 134 1 Y 1 A GLU 179 ? OE1 ? A GLU 179 OE1 135 1 Y 1 A GLU 179 ? OE2 ? A GLU 179 OE2 136 1 Y 1 A LEU 181 ? CG ? A LEU 181 CG 137 1 Y 1 A LEU 181 ? CD1 ? A LEU 181 CD1 138 1 Y 1 A LEU 181 ? CD2 ? A LEU 181 CD2 139 1 Y 1 A LYS 182 ? CG ? A LYS 182 CG 140 1 Y 1 A LYS 182 ? CD ? A LYS 182 CD 141 1 Y 1 A LYS 182 ? CE ? A LYS 182 CE 142 1 Y 1 A LYS 182 ? NZ ? A LYS 182 NZ 143 1 Y 1 A LYS 183 ? CD ? A LYS 183 CD 144 1 Y 1 A LYS 183 ? CE ? A LYS 183 CE 145 1 Y 1 A LYS 183 ? NZ ? A LYS 183 NZ # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.18rc2_3793 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? DENZO ? ? ? . 2 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 3 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot ? ? ? . 4 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALEPACK ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 6WVS _cell.details ? _cell.formula_units_Z ? _cell.length_a 53.199 _cell.length_a_esd ? _cell.length_b 53.199 _cell.length_b_esd ? _cell.length_c 64.270 _cell.length_c_esd ? _cell.volume 157523.687 _cell.volume_esd ? _cell.Z_PDB 3 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6WVS _symmetry.cell_setting ? _symmetry.Int_Tables_number 145 _symmetry.space_group_name_Hall 'P 32' _symmetry.space_group_name_H-M 'P 32' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6WVS _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.41 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 48.88 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;10% w/v PEG 20 000, 20% v/v PEG MME 550, 0.02 M each of each 1,6-hexanediol, 1-butanol, (RS)-1,2-propanediol, 2-propanol, 1,4-butanediol, 1,3-propanediol, 0.1 M bicine/Trizma base pH 8.5 ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2017-07-21 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.000 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ALS BEAMLINE 8.2.1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.000 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 8.2.1 _diffrn_source.pdbx_synchrotron_site ALS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6WVS _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.202 _reflns.d_resolution_low 37.44 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 10232 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.54 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 9.1 _reflns.pdbx_Rmerge_I_obs 0.2038 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 8.32 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.2163 _reflns.pdbx_Rpim_I_all 0.07193 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.988 _reflns.pdbx_CC_star 0.997 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.202 _reflns_shell.d_res_low 2.281 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.31 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 7829 _reflns_shell.percent_possible_all 97.44 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 2.759 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 8.2 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 2.943 _reflns_shell.pdbx_Rpim_I_all 1.015 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.558 _reflns_shell.pdbx_CC_star 0.846 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 55.91 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6WVS _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.202 _refine.ls_d_res_low 37.44 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 10220 _refine.ls_number_reflns_R_free 982 _refine.ls_number_reflns_R_work 9238 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.55 _refine.ls_percent_reflns_R_free 9.61 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2025 _refine.ls_R_factor_R_free 0.2046 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1920 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.00 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 'Rosetta design model of protein' _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 30.6860 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.202 _refine_hist.d_res_low 37.44 _refine_hist.number_atoms_solvent 19 _refine_hist.number_atoms_total 1310 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1291 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0027 ? 1296 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.5094 ? 1764 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0475 ? 235 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0029 ? 222 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 13.7919 ? 189 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.20 2.32 . . 146 1286 88.08 . . . 0.5734 . 0.5156 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.32 2.46 . . 133 1307 90.58 . . . 0.2645 . 0.3010 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.46 2.65 . . 141 1346 90.40 . . . 0.2815 . 0.2828 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.66 2.92 . . 146 1303 89.86 . . . 0.2681 . 0.2659 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.92 3.34 . . 149 1329 89.86 . . . 0.2035 . 0.2193 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.34 4.21 . . 141 1328 90.40 . . . 0.1935 . 0.1644 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.21 37.44 . . 126 1339 90.72 . . . 0.1737 . 0.1511 . . . . . . . . . . . # _struct.entry_id 6WVS _struct.title 'Hyperstable de novo TIM barrel variant DeNovoTIM15' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6WVS _struct_keywords.text 'TIM barrel, hyperstable, symmetric, de novo, repeat protein, DE NOVO PROTEIN' _struct_keywords.pdbx_keywords 'DE NOVO PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 6WVS _struct_ref.pdbx_db_accession 6WVS _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6WVS _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 193 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 6WVS _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 193 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 193 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 10 ? LEU A 24 ? ASP A 10 LEU A 24 1 ? 15 HELX_P HELX_P2 AA2 ASP A 35 ? LYS A 45 ? ASP A 35 LYS A 45 1 ? 11 HELX_P HELX_P3 AA3 ASP A 56 ? LEU A 70 ? ASP A 56 LEU A 70 1 ? 15 HELX_P HELX_P4 AA4 ASP A 81 ? LYS A 91 ? ASP A 81 LYS A 91 1 ? 11 HELX_P HELX_P5 AA5 ASP A 102 ? LEU A 116 ? ASP A 102 LEU A 116 1 ? 15 HELX_P HELX_P6 AA6 ASP A 127 ? GLY A 138 ? ASP A 127 GLY A 138 1 ? 12 HELX_P HELX_P7 AA7 ASP A 148 ? LEU A 162 ? ASP A 148 LEU A 162 1 ? 15 HELX_P HELX_P8 AA8 ASP A 173 ? LYS A 183 ? ASP A 173 LYS A 183 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 9 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA1 5 6 ? parallel AA1 6 7 ? parallel AA1 7 8 ? parallel AA1 8 9 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 3 ? VAL A 6 ? ILE A 3 VAL A 6 AA1 2 ILE A 29 ? SER A 33 ? ILE A 29 SER A 33 AA1 3 ILE A 49 ? VAL A 52 ? ILE A 49 VAL A 52 AA1 4 GLN A 74 ? SER A 79 ? GLN A 74 SER A 79 AA1 5 ILE A 95 ? VAL A 98 ? ILE A 95 VAL A 98 AA1 6 ILE A 121 ? SER A 125 ? ILE A 121 SER A 125 AA1 7 ILE A 141 ? VAL A 144 ? ILE A 141 VAL A 144 AA1 8 GLN A 166 ? SER A 171 ? GLN A 166 SER A 171 AA1 9 ILE A 3 ? VAL A 6 ? ILE A 3 VAL A 6 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N VAL A 6 ? N VAL A 6 O ALA A 30 ? O ALA A 30 AA1 2 3 N ILE A 29 ? N ILE A 29 O ILE A 49 ? O ILE A 49 AA1 3 4 N LEU A 50 ? N LEU A 50 O ALA A 76 ? O ALA A 76 AA1 4 5 N VAL A 77 ? N VAL A 77 O ILE A 97 ? O ILE A 97 AA1 5 6 N LEU A 96 ? N LEU A 96 O ALA A 122 ? O ALA A 122 AA1 6 7 N VAL A 123 ? N VAL A 123 O ILE A 143 ? O ILE A 143 AA1 7 8 N VAL A 144 ? N VAL A 144 O ALA A 168 ? O ALA A 168 AA1 8 9 O VAL A 169 ? O VAL A 169 N ILE A 5 ? N ILE A 5 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 OD2 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 ASP _pdbx_validate_close_contact.auth_seq_id_1 2 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 HH22 _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 ARG _pdbx_validate_close_contact.auth_seq_id_2 160 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.57 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id SER _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 125 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -177.91 _pdbx_validate_torsion.psi 149.12 # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -y,x-y,z+2/3 3 -x+y,-x,z+1/3 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A GLY 184 ? A GLY 184 3 1 Y 1 A GLY 185 ? A GLY 185 4 1 Y 1 A LEU 186 ? A LEU 186 5 1 Y 1 A GLU 187 ? A GLU 187 6 1 Y 1 A HIS 188 ? A HIS 188 7 1 Y 1 A HIS 189 ? A HIS 189 8 1 Y 1 A HIS 190 ? A HIS 190 9 1 Y 1 A HIS 191 ? A HIS 191 10 1 Y 1 A HIS 192 ? A HIS 192 11 1 Y 1 A HIS 193 ? A HIS 193 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 HOH O O N N 144 HOH H1 H N N 145 HOH H2 H N N 146 ILE N N N N 147 ILE CA C N S 148 ILE C C N N 149 ILE O O N N 150 ILE CB C N S 151 ILE CG1 C N N 152 ILE CG2 C N N 153 ILE CD1 C N N 154 ILE OXT O N N 155 ILE H H N N 156 ILE H2 H N N 157 ILE HA H N N 158 ILE HB H N N 159 ILE HG12 H N N 160 ILE HG13 H N N 161 ILE HG21 H N N 162 ILE HG22 H N N 163 ILE HG23 H N N 164 ILE HD11 H N N 165 ILE HD12 H N N 166 ILE HD13 H N N 167 ILE HXT H N N 168 LEU N N N N 169 LEU CA C N S 170 LEU C C N N 171 LEU O O N N 172 LEU CB C N N 173 LEU CG C N N 174 LEU CD1 C N N 175 LEU CD2 C N N 176 LEU OXT O N N 177 LEU H H N N 178 LEU H2 H N N 179 LEU HA H N N 180 LEU HB2 H N N 181 LEU HB3 H N N 182 LEU HG H N N 183 LEU HD11 H N N 184 LEU HD12 H N N 185 LEU HD13 H N N 186 LEU HD21 H N N 187 LEU HD22 H N N 188 LEU HD23 H N N 189 LEU HXT H N N 190 LYS N N N N 191 LYS CA C N S 192 LYS C C N N 193 LYS O O N N 194 LYS CB C N N 195 LYS CG C N N 196 LYS CD C N N 197 LYS CE C N N 198 LYS NZ N N N 199 LYS OXT O N N 200 LYS H H N N 201 LYS H2 H N N 202 LYS HA H N N 203 LYS HB2 H N N 204 LYS HB3 H N N 205 LYS HG2 H N N 206 LYS HG3 H N N 207 LYS HD2 H N N 208 LYS HD3 H N N 209 LYS HE2 H N N 210 LYS HE3 H N N 211 LYS HZ1 H N N 212 LYS HZ2 H N N 213 LYS HZ3 H N N 214 LYS HXT H N N 215 MET N N N N 216 MET CA C N S 217 MET C C N N 218 MET O O N N 219 MET CB C N N 220 MET CG C N N 221 MET SD S N N 222 MET CE C N N 223 MET OXT O N N 224 MET H H N N 225 MET H2 H N N 226 MET HA H N N 227 MET HB2 H N N 228 MET HB3 H N N 229 MET HG2 H N N 230 MET HG3 H N N 231 MET HE1 H N N 232 MET HE2 H N N 233 MET HE3 H N N 234 MET HXT H N N 235 SER N N N N 236 SER CA C N S 237 SER C C N N 238 SER O O N N 239 SER CB C N N 240 SER OG O N N 241 SER OXT O N N 242 SER H H N N 243 SER H2 H N N 244 SER HA H N N 245 SER HB2 H N N 246 SER HB3 H N N 247 SER HG H N N 248 SER HXT H N N 249 THR N N N N 250 THR CA C N S 251 THR C C N N 252 THR O O N N 253 THR CB C N R 254 THR OG1 O N N 255 THR CG2 C N N 256 THR OXT O N N 257 THR H H N N 258 THR H2 H N N 259 THR HA H N N 260 THR HB H N N 261 THR HG1 H N N 262 THR HG21 H N N 263 THR HG22 H N N 264 THR HG23 H N N 265 THR HXT H N N 266 TRP N N N N 267 TRP CA C N S 268 TRP C C N N 269 TRP O O N N 270 TRP CB C N N 271 TRP CG C Y N 272 TRP CD1 C Y N 273 TRP CD2 C Y N 274 TRP NE1 N Y N 275 TRP CE2 C Y N 276 TRP CE3 C Y N 277 TRP CZ2 C Y N 278 TRP CZ3 C Y N 279 TRP CH2 C Y N 280 TRP OXT O N N 281 TRP H H N N 282 TRP H2 H N N 283 TRP HA H N N 284 TRP HB2 H N N 285 TRP HB3 H N N 286 TRP HD1 H N N 287 TRP HE1 H N N 288 TRP HE3 H N N 289 TRP HZ2 H N N 290 TRP HZ3 H N N 291 TRP HH2 H N N 292 TRP HXT H N N 293 VAL N N N N 294 VAL CA C N S 295 VAL C C N N 296 VAL O O N N 297 VAL CB C N N 298 VAL CG1 C N N 299 VAL CG2 C N N 300 VAL OXT O N N 301 VAL H H N N 302 VAL H2 H N N 303 VAL HA H N N 304 VAL HB H N N 305 VAL HG11 H N N 306 VAL HG12 H N N 307 VAL HG13 H N N 308 VAL HG21 H N N 309 VAL HG22 H N N 310 VAL HG23 H N N 311 VAL HXT H N N 312 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 HOH O H1 sing N N 137 HOH O H2 sing N N 138 ILE N CA sing N N 139 ILE N H sing N N 140 ILE N H2 sing N N 141 ILE CA C sing N N 142 ILE CA CB sing N N 143 ILE CA HA sing N N 144 ILE C O doub N N 145 ILE C OXT sing N N 146 ILE CB CG1 sing N N 147 ILE CB CG2 sing N N 148 ILE CB HB sing N N 149 ILE CG1 CD1 sing N N 150 ILE CG1 HG12 sing N N 151 ILE CG1 HG13 sing N N 152 ILE CG2 HG21 sing N N 153 ILE CG2 HG22 sing N N 154 ILE CG2 HG23 sing N N 155 ILE CD1 HD11 sing N N 156 ILE CD1 HD12 sing N N 157 ILE CD1 HD13 sing N N 158 ILE OXT HXT sing N N 159 LEU N CA sing N N 160 LEU N H sing N N 161 LEU N H2 sing N N 162 LEU CA C sing N N 163 LEU CA CB sing N N 164 LEU CA HA sing N N 165 LEU C O doub N N 166 LEU C OXT sing N N 167 LEU CB CG sing N N 168 LEU CB HB2 sing N N 169 LEU CB HB3 sing N N 170 LEU CG CD1 sing N N 171 LEU CG CD2 sing N N 172 LEU CG HG sing N N 173 LEU CD1 HD11 sing N N 174 LEU CD1 HD12 sing N N 175 LEU CD1 HD13 sing N N 176 LEU CD2 HD21 sing N N 177 LEU CD2 HD22 sing N N 178 LEU CD2 HD23 sing N N 179 LEU OXT HXT sing N N 180 LYS N CA sing N N 181 LYS N H sing N N 182 LYS N H2 sing N N 183 LYS CA C sing N N 184 LYS CA CB sing N N 185 LYS CA HA sing N N 186 LYS C O doub N N 187 LYS C OXT sing N N 188 LYS CB CG sing N N 189 LYS CB HB2 sing N N 190 LYS CB HB3 sing N N 191 LYS CG CD sing N N 192 LYS CG HG2 sing N N 193 LYS CG HG3 sing N N 194 LYS CD CE sing N N 195 LYS CD HD2 sing N N 196 LYS CD HD3 sing N N 197 LYS CE NZ sing N N 198 LYS CE HE2 sing N N 199 LYS CE HE3 sing N N 200 LYS NZ HZ1 sing N N 201 LYS NZ HZ2 sing N N 202 LYS NZ HZ3 sing N N 203 LYS OXT HXT sing N N 204 MET N CA sing N N 205 MET N H sing N N 206 MET N H2 sing N N 207 MET CA C sing N N 208 MET CA CB sing N N 209 MET CA HA sing N N 210 MET C O doub N N 211 MET C OXT sing N N 212 MET CB CG sing N N 213 MET CB HB2 sing N N 214 MET CB HB3 sing N N 215 MET CG SD sing N N 216 MET CG HG2 sing N N 217 MET CG HG3 sing N N 218 MET SD CE sing N N 219 MET CE HE1 sing N N 220 MET CE HE2 sing N N 221 MET CE HE3 sing N N 222 MET OXT HXT sing N N 223 SER N CA sing N N 224 SER N H sing N N 225 SER N H2 sing N N 226 SER CA C sing N N 227 SER CA CB sing N N 228 SER CA HA sing N N 229 SER C O doub N N 230 SER C OXT sing N N 231 SER CB OG sing N N 232 SER CB HB2 sing N N 233 SER CB HB3 sing N N 234 SER OG HG sing N N 235 SER OXT HXT sing N N 236 THR N CA sing N N 237 THR N H sing N N 238 THR N H2 sing N N 239 THR CA C sing N N 240 THR CA CB sing N N 241 THR CA HA sing N N 242 THR C O doub N N 243 THR C OXT sing N N 244 THR CB OG1 sing N N 245 THR CB CG2 sing N N 246 THR CB HB sing N N 247 THR OG1 HG1 sing N N 248 THR CG2 HG21 sing N N 249 THR CG2 HG22 sing N N 250 THR CG2 HG23 sing N N 251 THR OXT HXT sing N N 252 TRP N CA sing N N 253 TRP N H sing N N 254 TRP N H2 sing N N 255 TRP CA C sing N N 256 TRP CA CB sing N N 257 TRP CA HA sing N N 258 TRP C O doub N N 259 TRP C OXT sing N N 260 TRP CB CG sing N N 261 TRP CB HB2 sing N N 262 TRP CB HB3 sing N N 263 TRP CG CD1 doub Y N 264 TRP CG CD2 sing Y N 265 TRP CD1 NE1 sing Y N 266 TRP CD1 HD1 sing N N 267 TRP CD2 CE2 doub Y N 268 TRP CD2 CE3 sing Y N 269 TRP NE1 CE2 sing Y N 270 TRP NE1 HE1 sing N N 271 TRP CE2 CZ2 sing Y N 272 TRP CE3 CZ3 doub Y N 273 TRP CE3 HE3 sing N N 274 TRP CZ2 CH2 doub Y N 275 TRP CZ2 HZ2 sing N N 276 TRP CZ3 CH2 sing Y N 277 TRP CZ3 HZ3 sing N N 278 TRP CH2 HH2 sing N N 279 TRP OXT HXT sing N N 280 VAL N CA sing N N 281 VAL N H sing N N 282 VAL N H2 sing N N 283 VAL CA C sing N N 284 VAL CA CB sing N N 285 VAL CA HA sing N N 286 VAL C O doub N N 287 VAL C OXT sing N N 288 VAL CB CG1 sing N N 289 VAL CB CG2 sing N N 290 VAL CB HB sing N N 291 VAL CG1 HG11 sing N N 292 VAL CG1 HG12 sing N N 293 VAL CG1 HG13 sing N N 294 VAL CG2 HG21 sing N N 295 VAL CG2 HG22 sing N N 296 VAL CG2 HG23 sing N N 297 VAL OXT HXT sing N N 298 # _pdbx_audit_support.funding_organization 'Defense Threat Reduction Agency (DTRA)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number HDTRA1-19-1-0003 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'in silico model' _pdbx_initial_refinement_model.source_name ? _pdbx_initial_refinement_model.details 'Rosetta design model of protein' # _space_group.name_H-M_alt 'P 32' _space_group.name_Hall 'P 32' _space_group.IT_number 145 _space_group.crystal_system trigonal _space_group.id 1 # _atom_sites.entry_id 6WVS _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.018797 _atom_sites.fract_transf_matrix[1][2] 0.010853 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.021705 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.015559 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? H ? ? 0.51345 0.48472 ? ? 24.73122 6.32584 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_