data_6X3I # _entry.id 6X3I # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6X3I pdb_00006x3i 10.2210/pdb6x3i/pdb WWPDB D_1000249538 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-09-23 2 'Structure model' 1 1 2023-10-18 3 'Structure model' 1 2 2024-10-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Refinement description' 4 3 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_initial_refinement_model 5 3 'Structure model' pdbx_entry_details 6 3 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_entry_details.has_protein_modification' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6X3I _pdbx_database_status.recvd_initial_deposition_date 2020-05-21 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Wei, R.' 1 ? 'Zhou, Y.F.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Mabs _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1942-0870 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 12 _citation.language ? _citation.page_first 1814583 _citation.page_last 1814583 _citation.title 'Engineered Fc-glycosylation switch to eliminate antibody effector function.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1080/19420862.2020.1814583 _citation.pdbx_database_id_PubMed 32892677 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Zhou, Q.' 1 ? primary 'Jaworski, J.' 2 0000-0002-0633-287X primary 'Zhou, Y.' 3 ? primary 'Valente, D.' 4 ? primary 'Cotton, J.' 5 ? primary 'Honey, D.' 6 ? primary 'Boudanova, E.' 7 ? primary 'Beninga, J.' 8 0000-0003-3209-004X primary 'Rao, E.' 9 ? primary 'Wei, R.' 10 0000-0003-3606-6055 primary 'Mauriac, C.' 11 ? primary 'Pan, C.' 12 0000-0001-5110-1803 primary 'Park, A.' 13 0000-0002-6511-8363 primary 'Qiu, H.' 14 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Immunoglobulin gamma-1 heavy chain' 25018.336 1 ? ? Fc ? 2 branched man '2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose' 424.401 1 ? ? ? ? 3 non-polymer man beta-D-mannopyranose 180.156 1 ? ? ? ? 4 water nat water 18.015 36 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Immunoglobulin gamma-1 heavy chain NIE' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;TCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNNASRVVS VLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESN GQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK ; _entity_poly.pdbx_seq_one_letter_code_can ;TCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNNASRVVS VLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESN GQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 beta-D-mannopyranose BMA 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 THR n 1 2 CYS n 1 3 PRO n 1 4 PRO n 1 5 CYS n 1 6 PRO n 1 7 ALA n 1 8 PRO n 1 9 GLU n 1 10 LEU n 1 11 LEU n 1 12 GLY n 1 13 GLY n 1 14 PRO n 1 15 SER n 1 16 VAL n 1 17 PHE n 1 18 LEU n 1 19 PHE n 1 20 PRO n 1 21 PRO n 1 22 LYS n 1 23 PRO n 1 24 LYS n 1 25 ASP n 1 26 THR n 1 27 LEU n 1 28 MET n 1 29 ILE n 1 30 SER n 1 31 ARG n 1 32 THR n 1 33 PRO n 1 34 GLU n 1 35 VAL n 1 36 THR n 1 37 CYS n 1 38 VAL n 1 39 VAL n 1 40 VAL n 1 41 ASP n 1 42 VAL n 1 43 SER n 1 44 HIS n 1 45 GLU n 1 46 ASP n 1 47 PRO n 1 48 GLU n 1 49 VAL n 1 50 LYS n 1 51 PHE n 1 52 ASN n 1 53 TRP n 1 54 TYR n 1 55 VAL n 1 56 ASP n 1 57 GLY n 1 58 VAL n 1 59 GLU n 1 60 VAL n 1 61 HIS n 1 62 ASN n 1 63 ALA n 1 64 LYS n 1 65 THR n 1 66 LYS n 1 67 PRO n 1 68 ARG n 1 69 GLU n 1 70 GLU n 1 71 GLN n 1 72 TYR n 1 73 ASN n 1 74 ASN n 1 75 ALA n 1 76 SER n 1 77 ARG n 1 78 VAL n 1 79 VAL n 1 80 SER n 1 81 VAL n 1 82 LEU n 1 83 THR n 1 84 VAL n 1 85 LEU n 1 86 HIS n 1 87 GLN n 1 88 ASP n 1 89 TRP n 1 90 LEU n 1 91 ASN n 1 92 GLY n 1 93 LYS n 1 94 GLU n 1 95 TYR n 1 96 LYS n 1 97 CYS n 1 98 LYS n 1 99 VAL n 1 100 SER n 1 101 ASN n 1 102 LYS n 1 103 ALA n 1 104 LEU n 1 105 PRO n 1 106 ALA n 1 107 PRO n 1 108 ILE n 1 109 GLU n 1 110 LYS n 1 111 THR n 1 112 ILE n 1 113 SER n 1 114 LYS n 1 115 ALA n 1 116 LYS n 1 117 GLY n 1 118 GLN n 1 119 PRO n 1 120 ARG n 1 121 GLU n 1 122 PRO n 1 123 GLN n 1 124 VAL n 1 125 TYR n 1 126 THR n 1 127 LEU n 1 128 PRO n 1 129 PRO n 1 130 SER n 1 131 ARG n 1 132 ASP n 1 133 GLU n 1 134 LEU n 1 135 THR n 1 136 LYS n 1 137 ASN n 1 138 GLN n 1 139 VAL n 1 140 SER n 1 141 LEU n 1 142 THR n 1 143 CYS n 1 144 LEU n 1 145 VAL n 1 146 LYS n 1 147 GLY n 1 148 PHE n 1 149 TYR n 1 150 PRO n 1 151 SER n 1 152 ASP n 1 153 ILE n 1 154 ALA n 1 155 VAL n 1 156 GLU n 1 157 TRP n 1 158 GLU n 1 159 SER n 1 160 ASN n 1 161 GLY n 1 162 GLN n 1 163 PRO n 1 164 GLU n 1 165 ASN n 1 166 ASN n 1 167 TYR n 1 168 LYS n 1 169 THR n 1 170 THR n 1 171 PRO n 1 172 PRO n 1 173 VAL n 1 174 LEU n 1 175 ASP n 1 176 SER n 1 177 ASP n 1 178 GLY n 1 179 SER n 1 180 PHE n 1 181 PHE n 1 182 LEU n 1 183 TYR n 1 184 SER n 1 185 LYS n 1 186 LEU n 1 187 THR n 1 188 VAL n 1 189 ASP n 1 190 LYS n 1 191 SER n 1 192 ARG n 1 193 TRP n 1 194 GLN n 1 195 GLN n 1 196 GLY n 1 197 ASN n 1 198 VAL n 1 199 PHE n 1 200 SER n 1 201 CYS n 1 202 SER n 1 203 VAL n 1 204 MET n 1 205 HIS n 1 206 GLU n 1 207 ALA n 1 208 LEU n 1 209 HIS n 1 210 ASN n 1 211 HIS n 1 212 TYR n 1 213 THR n 1 214 GLN n 1 215 LYS n 1 216 SER n 1 217 LEU n 1 218 SER n 1 219 LEU n 1 220 SER n 1 221 PRO n 1 222 GLY n 1 223 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 223 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name human _entity_src_gen.pdbx_host_org_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 9606 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_branch.entity_id 2 _pdbx_entity_branch.type oligosaccharide # loop_ _pdbx_entity_branch_descriptor.ordinal _pdbx_entity_branch_descriptor.entity_id _pdbx_entity_branch_descriptor.descriptor _pdbx_entity_branch_descriptor.type _pdbx_entity_branch_descriptor.program _pdbx_entity_branch_descriptor.program_version 1 2 DGlcpNAcb1-4DGlcpNAcb1- 'Glycam Condensed Sequence' GMML 1.0 2 2 'WURCS=2.0/1,2,1/[a2122h-1b_1-5_2*NCC/3=O]/1-1/a4-b1' WURCS PDB2Glycan 1.1.0 3 2 '[]{[(4+1)][b-D-GlcpNAc]{[(4+1)][b-D-GlcpNAc]{}}}' LINUCS PDB-CARE ? # _pdbx_entity_branch_link.link_id 1 _pdbx_entity_branch_link.entity_id 2 _pdbx_entity_branch_link.entity_branch_list_num_1 2 _pdbx_entity_branch_link.comp_id_1 NAG _pdbx_entity_branch_link.atom_id_1 C1 _pdbx_entity_branch_link.leaving_atom_id_1 O1 _pdbx_entity_branch_link.entity_branch_list_num_2 1 _pdbx_entity_branch_link.comp_id_2 NAG _pdbx_entity_branch_link.atom_id_2 O4 _pdbx_entity_branch_link.leaving_atom_id_2 HO4 _pdbx_entity_branch_link.value_order sing _pdbx_entity_branch_link.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 BMA 'D-saccharide, beta linking' . beta-D-mannopyranose 'beta-D-mannose; D-mannose; mannose' 'C6 H12 O6' 180.156 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose ;N-acetyl-beta-D-glucosamine; 2-acetamido-2-deoxy-beta-D-glucose; 2-acetamido-2-deoxy-D-glucose; 2-acetamido-2-deoxy-glucose; N-ACETYL-D-GLUCOSAMINE ; 'C8 H15 N O6' 221.208 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier BMA 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DManpb BMA 'COMMON NAME' GMML 1.0 b-D-mannopyranose BMA 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 b-D-Manp BMA 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 Man NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DGlcpNAcb NAG 'COMMON NAME' GMML 1.0 N-acetyl-b-D-glucopyranosamine NAG 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 b-D-GlcpNAc NAG 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 GlcNAc # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 THR 1 225 ? ? ? A . n A 1 2 CYS 2 226 ? ? ? A . n A 1 3 PRO 3 227 ? ? ? A . n A 1 4 PRO 4 228 ? ? ? A . n A 1 5 CYS 5 229 ? ? ? A . n A 1 6 PRO 6 230 ? ? ? A . n A 1 7 ALA 7 231 ? ? ? A . n A 1 8 PRO 8 232 ? ? ? A . n A 1 9 GLU 9 233 ? ? ? A . n A 1 10 LEU 10 234 ? ? ? A . n A 1 11 LEU 11 235 ? ? ? A . n A 1 12 GLY 12 236 236 GLY GLY A . n A 1 13 GLY 13 237 237 GLY GLY A . n A 1 14 PRO 14 238 238 PRO PRO A . n A 1 15 SER 15 239 239 SER SER A . n A 1 16 VAL 16 240 240 VAL VAL A . n A 1 17 PHE 17 241 241 PHE PHE A . n A 1 18 LEU 18 242 242 LEU LEU A . n A 1 19 PHE 19 243 243 PHE PHE A . n A 1 20 PRO 20 244 244 PRO PRO A . n A 1 21 PRO 21 245 245 PRO PRO A . n A 1 22 LYS 22 246 246 LYS LYS A . n A 1 23 PRO 23 247 247 PRO PRO A . n A 1 24 LYS 24 248 248 LYS LYS A . n A 1 25 ASP 25 249 249 ASP ASP A . n A 1 26 THR 26 250 250 THR THR A . n A 1 27 LEU 27 251 251 LEU LEU A . n A 1 28 MET 28 252 252 MET MET A . n A 1 29 ILE 29 253 253 ILE ILE A . n A 1 30 SER 30 254 254 SER SER A . n A 1 31 ARG 31 255 255 ARG ARG A . n A 1 32 THR 32 256 256 THR THR A . n A 1 33 PRO 33 257 257 PRO PRO A . n A 1 34 GLU 34 258 258 GLU GLU A . n A 1 35 VAL 35 259 259 VAL VAL A . n A 1 36 THR 36 260 260 THR THR A . n A 1 37 CYS 37 261 261 CYS CYS A . n A 1 38 VAL 38 262 262 VAL VAL A . n A 1 39 VAL 39 263 263 VAL VAL A . n A 1 40 VAL 40 264 264 VAL VAL A . n A 1 41 ASP 41 265 265 ASP ASP A . n A 1 42 VAL 42 266 266 VAL VAL A . n A 1 43 SER 43 267 267 SER SER A . n A 1 44 HIS 44 268 268 HIS HIS A . n A 1 45 GLU 45 269 269 GLU GLU A . n A 1 46 ASP 46 270 270 ASP ASP A . n A 1 47 PRO 47 271 271 PRO PRO A . n A 1 48 GLU 48 272 272 GLU GLU A . n A 1 49 VAL 49 273 273 VAL VAL A . n A 1 50 LYS 50 274 274 LYS LYS A . n A 1 51 PHE 51 275 275 PHE PHE A . n A 1 52 ASN 52 276 276 ASN ASN A . n A 1 53 TRP 53 277 277 TRP TRP A . n A 1 54 TYR 54 278 278 TYR TYR A . n A 1 55 VAL 55 279 279 VAL VAL A . n A 1 56 ASP 56 280 280 ASP ASP A . n A 1 57 GLY 57 281 281 GLY GLY A . n A 1 58 VAL 58 282 282 VAL VAL A . n A 1 59 GLU 59 283 283 GLU GLU A . n A 1 60 VAL 60 284 284 VAL VAL A . n A 1 61 HIS 61 285 285 HIS HIS A . n A 1 62 ASN 62 286 286 ASN ASN A . n A 1 63 ALA 63 287 287 ALA ALA A . n A 1 64 LYS 64 288 288 LYS LYS A . n A 1 65 THR 65 289 289 THR THR A . n A 1 66 LYS 66 290 290 LYS LYS A . n A 1 67 PRO 67 291 291 PRO PRO A . n A 1 68 ARG 68 292 292 ARG ARG A . n A 1 69 GLU 69 293 293 GLU GLU A . n A 1 70 GLU 70 294 294 GLU GLU A . n A 1 71 GLN 71 295 295 GLN GLN A . n A 1 72 TYR 72 296 296 TYR TYR A . n A 1 73 ASN 73 297 297 ASN ASN A . n A 1 74 ASN 74 298 298 ASN ASN A . n A 1 75 ALA 75 299 299 ALA ALA A . n A 1 76 SER 76 300 300 SER SER A . n A 1 77 ARG 77 301 301 ARG ARG A . n A 1 78 VAL 78 302 302 VAL VAL A . n A 1 79 VAL 79 303 303 VAL VAL A . n A 1 80 SER 80 304 304 SER SER A . n A 1 81 VAL 81 305 305 VAL VAL A . n A 1 82 LEU 82 306 306 LEU LEU A . n A 1 83 THR 83 307 307 THR THR A . n A 1 84 VAL 84 308 308 VAL VAL A . n A 1 85 LEU 85 309 309 LEU LEU A . n A 1 86 HIS 86 310 310 HIS HIS A . n A 1 87 GLN 87 311 311 GLN GLN A . n A 1 88 ASP 88 312 312 ASP ASP A . n A 1 89 TRP 89 313 313 TRP TRP A . n A 1 90 LEU 90 314 314 LEU LEU A . n A 1 91 ASN 91 315 315 ASN ASN A . n A 1 92 GLY 92 316 316 GLY GLY A . n A 1 93 LYS 93 317 317 LYS LYS A . n A 1 94 GLU 94 318 318 GLU GLU A . n A 1 95 TYR 95 319 319 TYR TYR A . n A 1 96 LYS 96 320 320 LYS LYS A . n A 1 97 CYS 97 321 321 CYS CYS A . n A 1 98 LYS 98 322 322 LYS LYS A . n A 1 99 VAL 99 323 323 VAL VAL A . n A 1 100 SER 100 324 324 SER SER A . n A 1 101 ASN 101 325 325 ASN ASN A . n A 1 102 LYS 102 326 326 LYS LYS A . n A 1 103 ALA 103 327 327 ALA ALA A . n A 1 104 LEU 104 328 328 LEU LEU A . n A 1 105 PRO 105 329 329 PRO PRO A . n A 1 106 ALA 106 330 330 ALA ALA A . n A 1 107 PRO 107 331 331 PRO PRO A . n A 1 108 ILE 108 332 332 ILE ILE A . n A 1 109 GLU 109 333 333 GLU GLU A . n A 1 110 LYS 110 334 334 LYS LYS A . n A 1 111 THR 111 335 335 THR THR A . n A 1 112 ILE 112 336 336 ILE ILE A . n A 1 113 SER 113 337 337 SER SER A . n A 1 114 LYS 114 338 338 LYS LYS A . n A 1 115 ALA 115 339 339 ALA ALA A . n A 1 116 LYS 116 340 340 LYS LYS A . n A 1 117 GLY 117 341 341 GLY GLY A . n A 1 118 GLN 118 342 342 GLN GLN A . n A 1 119 PRO 119 343 343 PRO PRO A . n A 1 120 ARG 120 344 344 ARG ARG A . n A 1 121 GLU 121 345 345 GLU GLU A . n A 1 122 PRO 122 346 346 PRO PRO A . n A 1 123 GLN 123 347 347 GLN GLN A . n A 1 124 VAL 124 348 348 VAL VAL A . n A 1 125 TYR 125 349 349 TYR TYR A . n A 1 126 THR 126 350 350 THR THR A . n A 1 127 LEU 127 351 351 LEU LEU A . n A 1 128 PRO 128 352 352 PRO PRO A . n A 1 129 PRO 129 353 353 PRO PRO A . n A 1 130 SER 130 354 354 SER SER A . n A 1 131 ARG 131 355 355 ARG ARG A . n A 1 132 ASP 132 356 356 ASP ASP A . n A 1 133 GLU 133 357 357 GLU GLU A . n A 1 134 LEU 134 358 358 LEU LEU A . n A 1 135 THR 135 359 359 THR THR A . n A 1 136 LYS 136 360 360 LYS LYS A . n A 1 137 ASN 137 361 361 ASN ASN A . n A 1 138 GLN 138 362 362 GLN GLN A . n A 1 139 VAL 139 363 363 VAL VAL A . n A 1 140 SER 140 364 364 SER SER A . n A 1 141 LEU 141 365 365 LEU LEU A . n A 1 142 THR 142 366 366 THR THR A . n A 1 143 CYS 143 367 367 CYS CYS A . n A 1 144 LEU 144 368 368 LEU LEU A . n A 1 145 VAL 145 369 369 VAL VAL A . n A 1 146 LYS 146 370 370 LYS LYS A . n A 1 147 GLY 147 371 371 GLY GLY A . n A 1 148 PHE 148 372 372 PHE PHE A . n A 1 149 TYR 149 373 373 TYR TYR A . n A 1 150 PRO 150 374 374 PRO PRO A . n A 1 151 SER 151 375 375 SER SER A . n A 1 152 ASP 152 376 376 ASP ASP A . n A 1 153 ILE 153 377 377 ILE ILE A . n A 1 154 ALA 154 378 378 ALA ALA A . n A 1 155 VAL 155 379 379 VAL VAL A . n A 1 156 GLU 156 380 380 GLU GLU A . n A 1 157 TRP 157 381 381 TRP TRP A . n A 1 158 GLU 158 382 382 GLU GLU A . n A 1 159 SER 159 383 383 SER SER A . n A 1 160 ASN 160 384 384 ASN ASN A . n A 1 161 GLY 161 385 385 GLY GLY A . n A 1 162 GLN 162 386 386 GLN GLN A . n A 1 163 PRO 163 387 387 PRO PRO A . n A 1 164 GLU 164 388 388 GLU GLU A . n A 1 165 ASN 165 389 389 ASN ASN A . n A 1 166 ASN 166 390 390 ASN ASN A . n A 1 167 TYR 167 391 391 TYR TYR A . n A 1 168 LYS 168 392 392 LYS LYS A . n A 1 169 THR 169 393 393 THR THR A . n A 1 170 THR 170 394 394 THR THR A . n A 1 171 PRO 171 395 395 PRO PRO A . n A 1 172 PRO 172 396 396 PRO PRO A . n A 1 173 VAL 173 397 397 VAL VAL A . n A 1 174 LEU 174 398 398 LEU LEU A . n A 1 175 ASP 175 399 399 ASP ASP A . n A 1 176 SER 176 400 400 SER SER A . n A 1 177 ASP 177 401 401 ASP ASP A . n A 1 178 GLY 178 402 402 GLY GLY A . n A 1 179 SER 179 403 403 SER SER A . n A 1 180 PHE 180 404 404 PHE PHE A . n A 1 181 PHE 181 405 405 PHE PHE A . n A 1 182 LEU 182 406 406 LEU LEU A . n A 1 183 TYR 183 407 407 TYR TYR A . n A 1 184 SER 184 408 408 SER SER A . n A 1 185 LYS 185 409 409 LYS LYS A . n A 1 186 LEU 186 410 410 LEU LEU A . n A 1 187 THR 187 411 411 THR THR A . n A 1 188 VAL 188 412 412 VAL VAL A . n A 1 189 ASP 189 413 413 ASP ASP A . n A 1 190 LYS 190 414 414 LYS LYS A . n A 1 191 SER 191 415 415 SER SER A . n A 1 192 ARG 192 416 416 ARG ARG A . n A 1 193 TRP 193 417 417 TRP TRP A . n A 1 194 GLN 194 418 418 GLN GLN A . n A 1 195 GLN 195 419 419 GLN GLN A . n A 1 196 GLY 196 420 420 GLY GLY A . n A 1 197 ASN 197 421 421 ASN ASN A . n A 1 198 VAL 198 422 422 VAL VAL A . n A 1 199 PHE 199 423 423 PHE PHE A . n A 1 200 SER 200 424 424 SER SER A . n A 1 201 CYS 201 425 425 CYS CYS A . n A 1 202 SER 202 426 426 SER SER A . n A 1 203 VAL 203 427 427 VAL VAL A . n A 1 204 MET 204 428 428 MET MET A . n A 1 205 HIS 205 429 429 HIS HIS A . n A 1 206 GLU 206 430 430 GLU GLU A . n A 1 207 ALA 207 431 431 ALA ALA A . n A 1 208 LEU 208 432 432 LEU LEU A . n A 1 209 HIS 209 433 433 HIS HIS A . n A 1 210 ASN 210 434 434 ASN ASN A . n A 1 211 HIS 211 435 435 HIS HIS A . n A 1 212 TYR 212 436 436 TYR TYR A . n A 1 213 THR 213 437 437 THR THR A . n A 1 214 GLN 214 438 438 GLN GLN A . n A 1 215 LYS 215 439 439 LYS LYS A . n A 1 216 SER 216 440 440 SER SER A . n A 1 217 LEU 217 441 441 LEU LEU A . n A 1 218 SER 218 442 442 SER SER A . n A 1 219 LEU 219 443 443 LEU LEU A . n A 1 220 SER 220 444 444 SER SER A . n A 1 221 PRO 221 445 ? ? ? A . n A 1 222 GLY 222 446 ? ? ? A . n A 1 223 LYS 223 447 ? ? ? A . n # loop_ _pdbx_branch_scheme.asym_id _pdbx_branch_scheme.entity_id _pdbx_branch_scheme.mon_id _pdbx_branch_scheme.num _pdbx_branch_scheme.pdb_asym_id _pdbx_branch_scheme.pdb_mon_id _pdbx_branch_scheme.pdb_seq_num _pdbx_branch_scheme.auth_asym_id _pdbx_branch_scheme.auth_mon_id _pdbx_branch_scheme.auth_seq_num _pdbx_branch_scheme.hetero B 2 NAG 1 B NAG 1 A NAG 1453 n B 2 NAG 2 B NAG 2 A NAG 1454 n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 BMA 1 503 1455 BMA MAN A . D 4 HOH 1 601 17 HOH HOH A . D 4 HOH 2 602 35 HOH HOH A . D 4 HOH 3 603 20 HOH HOH A . D 4 HOH 4 604 7 HOH HOH A . D 4 HOH 5 605 2 HOH HOH A . D 4 HOH 6 606 15 HOH HOH A . D 4 HOH 7 607 8 HOH HOH A . D 4 HOH 8 608 11 HOH HOH A . D 4 HOH 9 609 21 HOH HOH A . D 4 HOH 10 610 14 HOH HOH A . D 4 HOH 11 611 12 HOH HOH A . D 4 HOH 12 612 10 HOH HOH A . D 4 HOH 13 613 32 HOH HOH A . D 4 HOH 14 614 4 HOH HOH A . D 4 HOH 15 615 1 HOH HOH A . D 4 HOH 16 616 28 HOH HOH A . D 4 HOH 17 617 3 HOH HOH A . D 4 HOH 18 618 23 HOH HOH A . D 4 HOH 19 619 5 HOH HOH A . D 4 HOH 20 620 19 HOH HOH A . D 4 HOH 21 621 16 HOH HOH A . D 4 HOH 22 622 13 HOH HOH A . D 4 HOH 23 623 36 HOH HOH A . D 4 HOH 24 624 25 HOH HOH A . D 4 HOH 25 625 18 HOH HOH A . D 4 HOH 26 626 24 HOH HOH A . D 4 HOH 27 627 33 HOH HOH A . D 4 HOH 28 628 26 HOH HOH A . D 4 HOH 29 629 34 HOH HOH A . D 4 HOH 30 630 22 HOH HOH A . D 4 HOH 31 631 9 HOH HOH A . D 4 HOH 32 632 30 HOH HOH A . D 4 HOH 33 633 27 HOH HOH A . D 4 HOH 34 634 29 HOH HOH A . D 4 HOH 35 635 6 HOH HOH A . D 4 HOH 36 636 31 HOH HOH A . # _pdbx_unobs_or_zero_occ_atoms.id 1 _pdbx_unobs_or_zero_occ_atoms.PDB_model_num 1 _pdbx_unobs_or_zero_occ_atoms.polymer_flag N _pdbx_unobs_or_zero_occ_atoms.occupancy_flag 1 _pdbx_unobs_or_zero_occ_atoms.auth_asym_id A _pdbx_unobs_or_zero_occ_atoms.auth_comp_id BMA _pdbx_unobs_or_zero_occ_atoms.auth_seq_id 503 _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code ? _pdbx_unobs_or_zero_occ_atoms.auth_atom_id O1 _pdbx_unobs_or_zero_occ_atoms.label_alt_id ? _pdbx_unobs_or_zero_occ_atoms.label_asym_id C _pdbx_unobs_or_zero_occ_atoms.label_comp_id BMA _pdbx_unobs_or_zero_occ_atoms.label_seq_id 1 _pdbx_unobs_or_zero_occ_atoms.label_atom_id O1 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? dev_1839 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6X3I _cell.details ? _cell.formula_units_Z ? _cell.length_a 52.091 _cell.length_a_esd ? _cell.length_b 142.504 _cell.length_b_esd ? _cell.length_c 75.235 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6X3I _symmetry.cell_setting ? _symmetry.Int_Tables_number 20 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6X3I _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.79 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 55.92 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 294 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '30% polyethylene glycol 1500' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'RAYONIX MX-300' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2014-09-14 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9795 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'CLSI BEAMLINE 08ID-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9795 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 08ID-1 _diffrn_source.pdbx_synchrotron_site CLSI # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6X3I _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.268 _reflns.d_resolution_low 50.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 13336 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.900 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 7.200 _reflns.pdbx_Rmerge_I_obs 0.089 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 9.200 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 1.046 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split 2.270 2.350 ? ? ? ? ? ? 1305 100.000 ? ? ? ? 0.971 ? ? ? ? ? ? ? ? 6.800 ? 1.043 ? ? ? ? ? 1 1 ? ? ? 2.350 2.450 ? ? ? ? ? ? 1305 100.000 ? ? ? ? 0.761 ? ? ? ? ? ? ? ? 7.300 ? 1.054 ? ? ? ? ? 2 1 ? ? ? 2.450 2.560 ? ? ? ? ? ? 1309 100.000 ? ? ? ? 0.560 ? ? ? ? ? ? ? ? 7.400 ? 1.086 ? ? ? ? ? 3 1 ? ? ? 2.560 2.690 ? ? ? ? ? ? 1321 100.000 ? ? ? ? 0.402 ? ? ? ? ? ? ? ? 7.400 ? 1.092 ? ? ? ? ? 4 1 ? ? ? 2.690 2.860 ? ? ? ? ? ? 1316 100.000 ? ? ? ? 0.262 ? ? ? ? ? ? ? ? 7.400 ? 1.058 ? ? ? ? ? 5 1 ? ? ? 2.860 3.080 ? ? ? ? ? ? 1322 100.000 ? ? ? ? 0.182 ? ? ? ? ? ? ? ? 7.400 ? 1.002 ? ? ? ? ? 6 1 ? ? ? 3.080 3.390 ? ? ? ? ? ? 1329 100.000 ? ? ? ? 0.110 ? ? ? ? ? ? ? ? 7.300 ? 1.017 ? ? ? ? ? 7 1 ? ? ? 3.390 3.880 ? ? ? ? ? ? 1334 100.000 ? ? ? ? 0.075 ? ? ? ? ? ? ? ? 7.300 ? 1.030 ? ? ? ? ? 8 1 ? ? ? 3.880 4.890 ? ? ? ? ? ? 1358 99.900 ? ? ? ? 0.066 ? ? ? ? ? ? ? ? 6.800 ? 1.055 ? ? ? ? ? 9 1 ? ? ? 4.890 50.000 ? ? ? ? ? ? 1437 99.400 ? ? ? ? 0.052 ? ? ? ? ? ? ? ? 6.600 ? 1.017 ? ? ? ? ? 10 1 ? ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 185.160 _refine.B_iso_mean 71.0965 _refine.B_iso_min 30.780 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6X3I _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.2680 _refine.ls_d_res_low 48.9250 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 13316 _refine.ls_number_reflns_R_free 651 _refine.ls_number_reflns_R_work 12665 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.6700 _refine.ls_percent_reflns_R_free 4.8900 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1803 _refine.ls_R_factor_R_free 0.2210 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1783 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.350 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 3AVE _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 26.2500 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3300 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.2680 _refine_hist.d_res_low 48.9250 _refine_hist.number_atoms_solvent 36 _refine_hist.number_atoms_total 1737 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 209 _refine_hist.pdbx_B_iso_mean_ligand 108.31 _refine_hist.pdbx_B_iso_mean_solvent 53.90 _refine_hist.pdbx_number_atoms_protein 1662 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 39 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.015 ? 1751 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.059 ? 2382 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.043 ? 268 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.005 ? 303 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 15.568 ? 662 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.2685 2.4436 . . 133 2450 99.0000 . . . 0.3405 0.0000 0.2587 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.4436 2.6895 . . 140 2494 100.0000 . . . 0.2658 0.0000 0.2286 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.6895 3.0787 . . 133 2509 100.0000 . . . 0.2719 0.0000 0.2135 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.0787 3.8785 . . 124 2542 100.0000 . . . 0.2382 0.0000 0.1913 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.8785 48.9250 . . 121 2670 100.0000 . . . 0.1710 0.0000 0.1467 . . . . . . . . . . . # _struct.entry_id 6X3I _struct.title 'NNAS Fc mutant' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6X3I _struct_keywords.text 'Antibody Fc, glycan engineering, IMMUNE SYSTEM' _struct_keywords.pdbx_keywords 'IMMUNE SYSTEM' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code IGG1_HUMAN _struct_ref.pdbx_db_accession P0DOX5 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;TCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVS VLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESN GQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK ; _struct_ref.pdbx_align_begin 227 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6X3I _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 223 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P0DOX5 _struct_ref_seq.db_align_beg 227 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 449 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 225 _struct_ref_seq.pdbx_auth_seq_align_end 447 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6X3I ASN A 74 ? UNP P0DOX5 SER 300 conflict 298 1 1 6X3I ALA A 75 ? UNP P0DOX5 THR 301 conflict 299 2 1 6X3I SER A 76 ? UNP P0DOX5 TYR 302 conflict 300 3 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 3350 ? 1 MORE 0 ? 1 'SSA (A^2)' 22830 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 3_555 -x,y,-z+1/2 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 37.6175000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LYS A 22 ? MET A 28 ? LYS A 246 MET A 252 1 ? 7 HELX_P HELX_P2 AA2 LEU A 85 ? ASN A 91 ? LEU A 309 ASN A 315 1 ? 7 HELX_P HELX_P3 AA3 SER A 130 ? LYS A 136 ? SER A 354 LYS A 360 5 ? 7 HELX_P HELX_P4 AA4 LYS A 190 ? GLY A 196 ? LYS A 414 GLY A 420 1 ? 7 HELX_P HELX_P5 AA5 LEU A 208 ? TYR A 212 ? LEU A 432 TYR A 436 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 37 SG ? ? ? 1_555 A CYS 97 SG ? ? A CYS 261 A CYS 321 1_555 ? ? ? ? ? ? ? 2.038 ? ? disulf2 disulf ? ? A CYS 143 SG ? ? ? 1_555 A CYS 201 SG ? ? A CYS 367 A CYS 425 1_555 ? ? ? ? ? ? ? 2.052 ? ? covale1 covale one ? A ASN 74 ND2 ? ? ? 1_555 B NAG . C1 ? ? A ASN 298 B NAG 1 1_555 ? ? ? ? ? ? ? 1.252 ? N-Glycosylation covale2 covale both ? B NAG . O4 ? ? ? 1_555 B NAG . C1 ? ? B NAG 1 B NAG 2 1_555 ? ? ? ? ? ? ? 1.198 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 NAG B . ? ASN A 74 ? NAG B 1 ? 1_555 ASN A 298 ? 1_555 C1 ND2 ASN 1 NAG N-Glycosylation Carbohydrate 2 CYS A 37 ? CYS A 97 ? CYS A 261 ? 1_555 CYS A 321 ? 1_555 SG SG . . . None 'Disulfide bridge' 3 CYS A 143 ? CYS A 201 ? CYS A 367 ? 1_555 CYS A 425 ? 1_555 SG SG . . . None 'Disulfide bridge' # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id TYR _struct_mon_prot_cis.label_seq_id 149 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id TYR _struct_mon_prot_cis.auth_seq_id 373 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 150 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 374 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -6.66 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 4 ? AA3 ? 4 ? AA4 ? 4 ? AA5 ? 4 ? AA6 ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel AA4 1 2 ? anti-parallel AA4 2 3 ? anti-parallel AA4 3 4 ? anti-parallel AA5 1 2 ? anti-parallel AA5 2 3 ? anti-parallel AA5 3 4 ? anti-parallel AA6 1 2 ? anti-parallel AA6 2 3 ? anti-parallel AA6 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 SER A 15 ? PHE A 19 ? SER A 239 PHE A 243 AA1 2 GLU A 34 ? SER A 43 ? GLU A 258 SER A 267 AA1 3 ALA A 75 ? THR A 83 ? ALA A 299 THR A 307 AA1 4 ALA A 63 ? THR A 65 ? ALA A 287 THR A 289 AA2 1 SER A 15 ? PHE A 19 ? SER A 239 PHE A 243 AA2 2 GLU A 34 ? SER A 43 ? GLU A 258 SER A 267 AA2 3 ALA A 75 ? THR A 83 ? ALA A 299 THR A 307 AA2 4 GLU A 69 ? GLU A 70 ? GLU A 293 GLU A 294 AA3 1 VAL A 58 ? VAL A 60 ? VAL A 282 VAL A 284 AA3 2 LYS A 50 ? VAL A 55 ? LYS A 274 VAL A 279 AA3 3 TYR A 95 ? SER A 100 ? TYR A 319 SER A 324 AA3 4 ILE A 108 ? ILE A 112 ? ILE A 332 ILE A 336 AA4 1 GLN A 123 ? LEU A 127 ? GLN A 347 LEU A 351 AA4 2 GLN A 138 ? PHE A 148 ? GLN A 362 PHE A 372 AA4 3 PHE A 180 ? ASP A 189 ? PHE A 404 ASP A 413 AA4 4 TYR A 167 ? THR A 169 ? TYR A 391 THR A 393 AA5 1 GLN A 123 ? LEU A 127 ? GLN A 347 LEU A 351 AA5 2 GLN A 138 ? PHE A 148 ? GLN A 362 PHE A 372 AA5 3 PHE A 180 ? ASP A 189 ? PHE A 404 ASP A 413 AA5 4 VAL A 173 ? LEU A 174 ? VAL A 397 LEU A 398 AA6 1 GLN A 162 ? PRO A 163 ? GLN A 386 PRO A 387 AA6 2 ALA A 154 ? SER A 159 ? ALA A 378 SER A 383 AA6 3 PHE A 199 ? MET A 204 ? PHE A 423 MET A 428 AA6 4 THR A 213 ? LEU A 217 ? THR A 437 LEU A 441 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N PHE A 17 ? N PHE A 241 O VAL A 38 ? O VAL A 262 AA1 2 3 N VAL A 35 ? N VAL A 259 O LEU A 82 ? O LEU A 306 AA1 3 4 O VAL A 81 ? O VAL A 305 N LYS A 64 ? N LYS A 288 AA2 1 2 N PHE A 17 ? N PHE A 241 O VAL A 38 ? O VAL A 262 AA2 2 3 N VAL A 35 ? N VAL A 259 O LEU A 82 ? O LEU A 306 AA2 3 4 O ARG A 77 ? O ARG A 301 N GLU A 69 ? N GLU A 293 AA3 1 2 O VAL A 58 ? O VAL A 282 N VAL A 55 ? N VAL A 279 AA3 2 3 N ASN A 52 ? N ASN A 276 O LYS A 98 ? O LYS A 322 AA3 3 4 N VAL A 99 ? N VAL A 323 O ILE A 108 ? O ILE A 332 AA4 1 2 N TYR A 125 ? N TYR A 349 O LEU A 144 ? O LEU A 368 AA4 2 3 N LEU A 141 ? N LEU A 365 O LEU A 186 ? O LEU A 410 AA4 3 4 O LYS A 185 ? O LYS A 409 N LYS A 168 ? N LYS A 392 AA5 1 2 N TYR A 125 ? N TYR A 349 O LEU A 144 ? O LEU A 368 AA5 2 3 N LEU A 141 ? N LEU A 365 O LEU A 186 ? O LEU A 410 AA5 3 4 O PHE A 181 ? O PHE A 405 N VAL A 173 ? N VAL A 397 AA6 1 2 O GLN A 162 ? O GLN A 386 N SER A 159 ? N SER A 383 AA6 2 3 N GLU A 158 ? N GLU A 382 O SER A 200 ? O SER A 424 AA6 3 4 N VAL A 203 ? N VAL A 427 O THR A 213 ? O THR A 437 # _pdbx_entry_details.entry_id 6X3I _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O4 B NAG 2 ? ? C1 A BMA 503 ? ? 1.68 2 1 ND2 A ASN 298 ? ? C2 B NAG 1 ? ? 1.88 3 1 CG A ASN 298 ? ? C1 B NAG 1 ? ? 2.02 4 1 O A HOH 602 ? ? O A HOH 629 ? ? 2.09 5 1 O A HOH 635 ? ? O A HOH 636 ? ? 2.10 6 1 ND2 A ASN 298 ? ? O5 B NAG 1 ? ? 2.12 7 1 O4 B NAG 1 ? ? O5 B NAG 2 ? ? 2.16 8 1 O4 B NAG 2 ? ? O5 A BMA 503 ? ? 2.18 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 286 ? ? -83.66 36.26 2 1 TYR A 296 ? ? -106.50 44.27 3 1 ASN A 297 ? ? -152.47 28.12 4 1 ASN A 434 ? ? 55.31 18.49 # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined 12.8511 17.5886 6.7108 0.6916 ? 0.1451 ? 0.0033 ? 0.5466 ? 0.1619 ? 0.4656 ? 1.7656 ? 0.0222 ? 0.4784 ? 2.0658 ? 0.1678 ? 0.1704 ? -0.1167 ? 0.3212 ? 0.2719 ? -0.2021 ? 0.3020 ? 0.6609 ? -0.8052 ? -0.4156 ? -0.1506 ? 2 'X-RAY DIFFRACTION' ? refined 11.7116 31.7574 4.1100 1.0932 ? 0.1022 ? -0.1603 ? 0.8262 ? 0.2056 ? 0.9185 ? 4.5040 ? -1.4969 ? 0.4517 ? 2.8062 ? 0.0385 ? 1.5309 ? -0.3147 ? 0.2007 ? 0.5880 ? -0.0088 ? 0.2395 ? 0.4058 ? -0.9696 ? -0.5254 ? -0.0130 ? 3 'X-RAY DIFFRACTION' ? refined 18.7226 24.7021 9.9991 0.9315 ? 0.0447 ? -0.1386 ? 0.5237 ? 0.0354 ? 0.5986 ? 2.2513 ? -0.3998 ? 0.2738 ? 1.9625 ? -0.8314 ? 2.1225 ? -0.2882 ? -0.0725 ? 0.8313 ? 0.1763 ? 0.2073 ? -0.2258 ? -1.1897 ? -0.0773 ? 0.0052 ? 4 'X-RAY DIFFRACTION' ? refined 5.4141 -5.4213 12.1632 0.3859 ? 0.0079 ? 0.0650 ? 0.4206 ? -0.0788 ? 0.4754 ? 4.3030 ? -0.1718 ? -0.8207 ? 2.0554 ? 0.0322 ? 2.4035 ? -0.2171 ? 0.5321 ? -0.8274 ? -0.0831 ? -0.0598 ? 0.0589 ? 0.3149 ? 0.0002 ? 0.2017 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? A 236 ? ? ? A 264 ? ? ;chain 'A' and (resid 236 through 264 ) ; 2 'X-RAY DIFFRACTION' 2 ? ? A 265 ? ? ? A 301 ? ? ;chain 'A' and (resid 265 through 301 ) ; 3 'X-RAY DIFFRACTION' 3 ? ? A 302 ? ? ? A 336 ? ? ;chain 'A' and (resid 302 through 336 ) ; 4 'X-RAY DIFFRACTION' 4 ? ? A 337 ? ? ? A 444 ? ? ;chain 'A' and (resid 337 through 444 ) ; # _pdbx_distant_solvent_atoms.id 1 _pdbx_distant_solvent_atoms.PDB_model_num 1 _pdbx_distant_solvent_atoms.auth_atom_id O _pdbx_distant_solvent_atoms.label_alt_id ? _pdbx_distant_solvent_atoms.auth_asym_id A _pdbx_distant_solvent_atoms.auth_comp_id HOH _pdbx_distant_solvent_atoms.auth_seq_id 636 _pdbx_distant_solvent_atoms.PDB_ins_code ? _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 6.27 _pdbx_distant_solvent_atoms.neighbor_ligand_distance . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A THR 225 ? A THR 1 2 1 Y 1 A CYS 226 ? A CYS 2 3 1 Y 1 A PRO 227 ? A PRO 3 4 1 Y 1 A PRO 228 ? A PRO 4 5 1 Y 1 A CYS 229 ? A CYS 5 6 1 Y 1 A PRO 230 ? A PRO 6 7 1 Y 1 A ALA 231 ? A ALA 7 8 1 Y 1 A PRO 232 ? A PRO 8 9 1 Y 1 A GLU 233 ? A GLU 9 10 1 Y 1 A LEU 234 ? A LEU 10 11 1 Y 1 A LEU 235 ? A LEU 11 12 1 Y 1 A PRO 445 ? A PRO 221 13 1 Y 1 A GLY 446 ? A GLY 222 14 1 Y 1 A LYS 447 ? A LYS 223 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 BMA C1 C N R 74 BMA C2 C N S 75 BMA C3 C N S 76 BMA C4 C N S 77 BMA C5 C N R 78 BMA C6 C N N 79 BMA O1 O N N 80 BMA O2 O N N 81 BMA O3 O N N 82 BMA O4 O N N 83 BMA O5 O N N 84 BMA O6 O N N 85 BMA H1 H N N 86 BMA H2 H N N 87 BMA H3 H N N 88 BMA H4 H N N 89 BMA H5 H N N 90 BMA H61 H N N 91 BMA H62 H N N 92 BMA HO1 H N N 93 BMA HO2 H N N 94 BMA HO3 H N N 95 BMA HO4 H N N 96 BMA HO6 H N N 97 CYS N N N N 98 CYS CA C N R 99 CYS C C N N 100 CYS O O N N 101 CYS CB C N N 102 CYS SG S N N 103 CYS OXT O N N 104 CYS H H N N 105 CYS H2 H N N 106 CYS HA H N N 107 CYS HB2 H N N 108 CYS HB3 H N N 109 CYS HG H N N 110 CYS HXT H N N 111 GLN N N N N 112 GLN CA C N S 113 GLN C C N N 114 GLN O O N N 115 GLN CB C N N 116 GLN CG C N N 117 GLN CD C N N 118 GLN OE1 O N N 119 GLN NE2 N N N 120 GLN OXT O N N 121 GLN H H N N 122 GLN H2 H N N 123 GLN HA H N N 124 GLN HB2 H N N 125 GLN HB3 H N N 126 GLN HG2 H N N 127 GLN HG3 H N N 128 GLN HE21 H N N 129 GLN HE22 H N N 130 GLN HXT H N N 131 GLU N N N N 132 GLU CA C N S 133 GLU C C N N 134 GLU O O N N 135 GLU CB C N N 136 GLU CG C N N 137 GLU CD C N N 138 GLU OE1 O N N 139 GLU OE2 O N N 140 GLU OXT O N N 141 GLU H H N N 142 GLU H2 H N N 143 GLU HA H N N 144 GLU HB2 H N N 145 GLU HB3 H N N 146 GLU HG2 H N N 147 GLU HG3 H N N 148 GLU HE2 H N N 149 GLU HXT H N N 150 GLY N N N N 151 GLY CA C N N 152 GLY C C N N 153 GLY O O N N 154 GLY OXT O N N 155 GLY H H N N 156 GLY H2 H N N 157 GLY HA2 H N N 158 GLY HA3 H N N 159 GLY HXT H N N 160 HIS N N N N 161 HIS CA C N S 162 HIS C C N N 163 HIS O O N N 164 HIS CB C N N 165 HIS CG C Y N 166 HIS ND1 N Y N 167 HIS CD2 C Y N 168 HIS CE1 C Y N 169 HIS NE2 N Y N 170 HIS OXT O N N 171 HIS H H N N 172 HIS H2 H N N 173 HIS HA H N N 174 HIS HB2 H N N 175 HIS HB3 H N N 176 HIS HD1 H N N 177 HIS HD2 H N N 178 HIS HE1 H N N 179 HIS HE2 H N N 180 HIS HXT H N N 181 HOH O O N N 182 HOH H1 H N N 183 HOH H2 H N N 184 ILE N N N N 185 ILE CA C N S 186 ILE C C N N 187 ILE O O N N 188 ILE CB C N S 189 ILE CG1 C N N 190 ILE CG2 C N N 191 ILE CD1 C N N 192 ILE OXT O N N 193 ILE H H N N 194 ILE H2 H N N 195 ILE HA H N N 196 ILE HB H N N 197 ILE HG12 H N N 198 ILE HG13 H N N 199 ILE HG21 H N N 200 ILE HG22 H N N 201 ILE HG23 H N N 202 ILE HD11 H N N 203 ILE HD12 H N N 204 ILE HD13 H N N 205 ILE HXT H N N 206 LEU N N N N 207 LEU CA C N S 208 LEU C C N N 209 LEU O O N N 210 LEU CB C N N 211 LEU CG C N N 212 LEU CD1 C N N 213 LEU CD2 C N N 214 LEU OXT O N N 215 LEU H H N N 216 LEU H2 H N N 217 LEU HA H N N 218 LEU HB2 H N N 219 LEU HB3 H N N 220 LEU HG H N N 221 LEU HD11 H N N 222 LEU HD12 H N N 223 LEU HD13 H N N 224 LEU HD21 H N N 225 LEU HD22 H N N 226 LEU HD23 H N N 227 LEU HXT H N N 228 LYS N N N N 229 LYS CA C N S 230 LYS C C N N 231 LYS O O N N 232 LYS CB C N N 233 LYS CG C N N 234 LYS CD C N N 235 LYS CE C N N 236 LYS NZ N N N 237 LYS OXT O N N 238 LYS H H N N 239 LYS H2 H N N 240 LYS HA H N N 241 LYS HB2 H N N 242 LYS HB3 H N N 243 LYS HG2 H N N 244 LYS HG3 H N N 245 LYS HD2 H N N 246 LYS HD3 H N N 247 LYS HE2 H N N 248 LYS HE3 H N N 249 LYS HZ1 H N N 250 LYS HZ2 H N N 251 LYS HZ3 H N N 252 LYS HXT H N N 253 MET N N N N 254 MET CA C N S 255 MET C C N N 256 MET O O N N 257 MET CB C N N 258 MET CG C N N 259 MET SD S N N 260 MET CE C N N 261 MET OXT O N N 262 MET H H N N 263 MET H2 H N N 264 MET HA H N N 265 MET HB2 H N N 266 MET HB3 H N N 267 MET HG2 H N N 268 MET HG3 H N N 269 MET HE1 H N N 270 MET HE2 H N N 271 MET HE3 H N N 272 MET HXT H N N 273 NAG C1 C N R 274 NAG C2 C N R 275 NAG C3 C N R 276 NAG C4 C N S 277 NAG C5 C N R 278 NAG C6 C N N 279 NAG C7 C N N 280 NAG C8 C N N 281 NAG N2 N N N 282 NAG O1 O N N 283 NAG O3 O N N 284 NAG O4 O N N 285 NAG O5 O N N 286 NAG O6 O N N 287 NAG O7 O N N 288 NAG H1 H N N 289 NAG H2 H N N 290 NAG H3 H N N 291 NAG H4 H N N 292 NAG H5 H N N 293 NAG H61 H N N 294 NAG H62 H N N 295 NAG H81 H N N 296 NAG H82 H N N 297 NAG H83 H N N 298 NAG HN2 H N N 299 NAG HO1 H N N 300 NAG HO3 H N N 301 NAG HO4 H N N 302 NAG HO6 H N N 303 PHE N N N N 304 PHE CA C N S 305 PHE C C N N 306 PHE O O N N 307 PHE CB C N N 308 PHE CG C Y N 309 PHE CD1 C Y N 310 PHE CD2 C Y N 311 PHE CE1 C Y N 312 PHE CE2 C Y N 313 PHE CZ C Y N 314 PHE OXT O N N 315 PHE H H N N 316 PHE H2 H N N 317 PHE HA H N N 318 PHE HB2 H N N 319 PHE HB3 H N N 320 PHE HD1 H N N 321 PHE HD2 H N N 322 PHE HE1 H N N 323 PHE HE2 H N N 324 PHE HZ H N N 325 PHE HXT H N N 326 PRO N N N N 327 PRO CA C N S 328 PRO C C N N 329 PRO O O N N 330 PRO CB C N N 331 PRO CG C N N 332 PRO CD C N N 333 PRO OXT O N N 334 PRO H H N N 335 PRO HA H N N 336 PRO HB2 H N N 337 PRO HB3 H N N 338 PRO HG2 H N N 339 PRO HG3 H N N 340 PRO HD2 H N N 341 PRO HD3 H N N 342 PRO HXT H N N 343 SER N N N N 344 SER CA C N S 345 SER C C N N 346 SER O O N N 347 SER CB C N N 348 SER OG O N N 349 SER OXT O N N 350 SER H H N N 351 SER H2 H N N 352 SER HA H N N 353 SER HB2 H N N 354 SER HB3 H N N 355 SER HG H N N 356 SER HXT H N N 357 THR N N N N 358 THR CA C N S 359 THR C C N N 360 THR O O N N 361 THR CB C N R 362 THR OG1 O N N 363 THR CG2 C N N 364 THR OXT O N N 365 THR H H N N 366 THR H2 H N N 367 THR HA H N N 368 THR HB H N N 369 THR HG1 H N N 370 THR HG21 H N N 371 THR HG22 H N N 372 THR HG23 H N N 373 THR HXT H N N 374 TRP N N N N 375 TRP CA C N S 376 TRP C C N N 377 TRP O O N N 378 TRP CB C N N 379 TRP CG C Y N 380 TRP CD1 C Y N 381 TRP CD2 C Y N 382 TRP NE1 N Y N 383 TRP CE2 C Y N 384 TRP CE3 C Y N 385 TRP CZ2 C Y N 386 TRP CZ3 C Y N 387 TRP CH2 C Y N 388 TRP OXT O N N 389 TRP H H N N 390 TRP H2 H N N 391 TRP HA H N N 392 TRP HB2 H N N 393 TRP HB3 H N N 394 TRP HD1 H N N 395 TRP HE1 H N N 396 TRP HE3 H N N 397 TRP HZ2 H N N 398 TRP HZ3 H N N 399 TRP HH2 H N N 400 TRP HXT H N N 401 TYR N N N N 402 TYR CA C N S 403 TYR C C N N 404 TYR O O N N 405 TYR CB C N N 406 TYR CG C Y N 407 TYR CD1 C Y N 408 TYR CD2 C Y N 409 TYR CE1 C Y N 410 TYR CE2 C Y N 411 TYR CZ C Y N 412 TYR OH O N N 413 TYR OXT O N N 414 TYR H H N N 415 TYR H2 H N N 416 TYR HA H N N 417 TYR HB2 H N N 418 TYR HB3 H N N 419 TYR HD1 H N N 420 TYR HD2 H N N 421 TYR HE1 H N N 422 TYR HE2 H N N 423 TYR HH H N N 424 TYR HXT H N N 425 VAL N N N N 426 VAL CA C N S 427 VAL C C N N 428 VAL O O N N 429 VAL CB C N N 430 VAL CG1 C N N 431 VAL CG2 C N N 432 VAL OXT O N N 433 VAL H H N N 434 VAL H2 H N N 435 VAL HA H N N 436 VAL HB H N N 437 VAL HG11 H N N 438 VAL HG12 H N N 439 VAL HG13 H N N 440 VAL HG21 H N N 441 VAL HG22 H N N 442 VAL HG23 H N N 443 VAL HXT H N N 444 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 BMA C1 C2 sing N N 70 BMA C1 O1 sing N N 71 BMA C1 O5 sing N N 72 BMA C1 H1 sing N N 73 BMA C2 C3 sing N N 74 BMA C2 O2 sing N N 75 BMA C2 H2 sing N N 76 BMA C3 C4 sing N N 77 BMA C3 O3 sing N N 78 BMA C3 H3 sing N N 79 BMA C4 C5 sing N N 80 BMA C4 O4 sing N N 81 BMA C4 H4 sing N N 82 BMA C5 C6 sing N N 83 BMA C5 O5 sing N N 84 BMA C5 H5 sing N N 85 BMA C6 O6 sing N N 86 BMA C6 H61 sing N N 87 BMA C6 H62 sing N N 88 BMA O1 HO1 sing N N 89 BMA O2 HO2 sing N N 90 BMA O3 HO3 sing N N 91 BMA O4 HO4 sing N N 92 BMA O6 HO6 sing N N 93 CYS N CA sing N N 94 CYS N H sing N N 95 CYS N H2 sing N N 96 CYS CA C sing N N 97 CYS CA CB sing N N 98 CYS CA HA sing N N 99 CYS C O doub N N 100 CYS C OXT sing N N 101 CYS CB SG sing N N 102 CYS CB HB2 sing N N 103 CYS CB HB3 sing N N 104 CYS SG HG sing N N 105 CYS OXT HXT sing N N 106 GLN N CA sing N N 107 GLN N H sing N N 108 GLN N H2 sing N N 109 GLN CA C sing N N 110 GLN CA CB sing N N 111 GLN CA HA sing N N 112 GLN C O doub N N 113 GLN C OXT sing N N 114 GLN CB CG sing N N 115 GLN CB HB2 sing N N 116 GLN CB HB3 sing N N 117 GLN CG CD sing N N 118 GLN CG HG2 sing N N 119 GLN CG HG3 sing N N 120 GLN CD OE1 doub N N 121 GLN CD NE2 sing N N 122 GLN NE2 HE21 sing N N 123 GLN NE2 HE22 sing N N 124 GLN OXT HXT sing N N 125 GLU N CA sing N N 126 GLU N H sing N N 127 GLU N H2 sing N N 128 GLU CA C sing N N 129 GLU CA CB sing N N 130 GLU CA HA sing N N 131 GLU C O doub N N 132 GLU C OXT sing N N 133 GLU CB CG sing N N 134 GLU CB HB2 sing N N 135 GLU CB HB3 sing N N 136 GLU CG CD sing N N 137 GLU CG HG2 sing N N 138 GLU CG HG3 sing N N 139 GLU CD OE1 doub N N 140 GLU CD OE2 sing N N 141 GLU OE2 HE2 sing N N 142 GLU OXT HXT sing N N 143 GLY N CA sing N N 144 GLY N H sing N N 145 GLY N H2 sing N N 146 GLY CA C sing N N 147 GLY CA HA2 sing N N 148 GLY CA HA3 sing N N 149 GLY C O doub N N 150 GLY C OXT sing N N 151 GLY OXT HXT sing N N 152 HIS N CA sing N N 153 HIS N H sing N N 154 HIS N H2 sing N N 155 HIS CA C sing N N 156 HIS CA CB sing N N 157 HIS CA HA sing N N 158 HIS C O doub N N 159 HIS C OXT sing N N 160 HIS CB CG sing N N 161 HIS CB HB2 sing N N 162 HIS CB HB3 sing N N 163 HIS CG ND1 sing Y N 164 HIS CG CD2 doub Y N 165 HIS ND1 CE1 doub Y N 166 HIS ND1 HD1 sing N N 167 HIS CD2 NE2 sing Y N 168 HIS CD2 HD2 sing N N 169 HIS CE1 NE2 sing Y N 170 HIS CE1 HE1 sing N N 171 HIS NE2 HE2 sing N N 172 HIS OXT HXT sing N N 173 HOH O H1 sing N N 174 HOH O H2 sing N N 175 ILE N CA sing N N 176 ILE N H sing N N 177 ILE N H2 sing N N 178 ILE CA C sing N N 179 ILE CA CB sing N N 180 ILE CA HA sing N N 181 ILE C O doub N N 182 ILE C OXT sing N N 183 ILE CB CG1 sing N N 184 ILE CB CG2 sing N N 185 ILE CB HB sing N N 186 ILE CG1 CD1 sing N N 187 ILE CG1 HG12 sing N N 188 ILE CG1 HG13 sing N N 189 ILE CG2 HG21 sing N N 190 ILE CG2 HG22 sing N N 191 ILE CG2 HG23 sing N N 192 ILE CD1 HD11 sing N N 193 ILE CD1 HD12 sing N N 194 ILE CD1 HD13 sing N N 195 ILE OXT HXT sing N N 196 LEU N CA sing N N 197 LEU N H sing N N 198 LEU N H2 sing N N 199 LEU CA C sing N N 200 LEU CA CB sing N N 201 LEU CA HA sing N N 202 LEU C O doub N N 203 LEU C OXT sing N N 204 LEU CB CG sing N N 205 LEU CB HB2 sing N N 206 LEU CB HB3 sing N N 207 LEU CG CD1 sing N N 208 LEU CG CD2 sing N N 209 LEU CG HG sing N N 210 LEU CD1 HD11 sing N N 211 LEU CD1 HD12 sing N N 212 LEU CD1 HD13 sing N N 213 LEU CD2 HD21 sing N N 214 LEU CD2 HD22 sing N N 215 LEU CD2 HD23 sing N N 216 LEU OXT HXT sing N N 217 LYS N CA sing N N 218 LYS N H sing N N 219 LYS N H2 sing N N 220 LYS CA C sing N N 221 LYS CA CB sing N N 222 LYS CA HA sing N N 223 LYS C O doub N N 224 LYS C OXT sing N N 225 LYS CB CG sing N N 226 LYS CB HB2 sing N N 227 LYS CB HB3 sing N N 228 LYS CG CD sing N N 229 LYS CG HG2 sing N N 230 LYS CG HG3 sing N N 231 LYS CD CE sing N N 232 LYS CD HD2 sing N N 233 LYS CD HD3 sing N N 234 LYS CE NZ sing N N 235 LYS CE HE2 sing N N 236 LYS CE HE3 sing N N 237 LYS NZ HZ1 sing N N 238 LYS NZ HZ2 sing N N 239 LYS NZ HZ3 sing N N 240 LYS OXT HXT sing N N 241 MET N CA sing N N 242 MET N H sing N N 243 MET N H2 sing N N 244 MET CA C sing N N 245 MET CA CB sing N N 246 MET CA HA sing N N 247 MET C O doub N N 248 MET C OXT sing N N 249 MET CB CG sing N N 250 MET CB HB2 sing N N 251 MET CB HB3 sing N N 252 MET CG SD sing N N 253 MET CG HG2 sing N N 254 MET CG HG3 sing N N 255 MET SD CE sing N N 256 MET CE HE1 sing N N 257 MET CE HE2 sing N N 258 MET CE HE3 sing N N 259 MET OXT HXT sing N N 260 NAG C1 C2 sing N N 261 NAG C1 O1 sing N N 262 NAG C1 O5 sing N N 263 NAG C1 H1 sing N N 264 NAG C2 C3 sing N N 265 NAG C2 N2 sing N N 266 NAG C2 H2 sing N N 267 NAG C3 C4 sing N N 268 NAG C3 O3 sing N N 269 NAG C3 H3 sing N N 270 NAG C4 C5 sing N N 271 NAG C4 O4 sing N N 272 NAG C4 H4 sing N N 273 NAG C5 C6 sing N N 274 NAG C5 O5 sing N N 275 NAG C5 H5 sing N N 276 NAG C6 O6 sing N N 277 NAG C6 H61 sing N N 278 NAG C6 H62 sing N N 279 NAG C7 C8 sing N N 280 NAG C7 N2 sing N N 281 NAG C7 O7 doub N N 282 NAG C8 H81 sing N N 283 NAG C8 H82 sing N N 284 NAG C8 H83 sing N N 285 NAG N2 HN2 sing N N 286 NAG O1 HO1 sing N N 287 NAG O3 HO3 sing N N 288 NAG O4 HO4 sing N N 289 NAG O6 HO6 sing N N 290 PHE N CA sing N N 291 PHE N H sing N N 292 PHE N H2 sing N N 293 PHE CA C sing N N 294 PHE CA CB sing N N 295 PHE CA HA sing N N 296 PHE C O doub N N 297 PHE C OXT sing N N 298 PHE CB CG sing N N 299 PHE CB HB2 sing N N 300 PHE CB HB3 sing N N 301 PHE CG CD1 doub Y N 302 PHE CG CD2 sing Y N 303 PHE CD1 CE1 sing Y N 304 PHE CD1 HD1 sing N N 305 PHE CD2 CE2 doub Y N 306 PHE CD2 HD2 sing N N 307 PHE CE1 CZ doub Y N 308 PHE CE1 HE1 sing N N 309 PHE CE2 CZ sing Y N 310 PHE CE2 HE2 sing N N 311 PHE CZ HZ sing N N 312 PHE OXT HXT sing N N 313 PRO N CA sing N N 314 PRO N CD sing N N 315 PRO N H sing N N 316 PRO CA C sing N N 317 PRO CA CB sing N N 318 PRO CA HA sing N N 319 PRO C O doub N N 320 PRO C OXT sing N N 321 PRO CB CG sing N N 322 PRO CB HB2 sing N N 323 PRO CB HB3 sing N N 324 PRO CG CD sing N N 325 PRO CG HG2 sing N N 326 PRO CG HG3 sing N N 327 PRO CD HD2 sing N N 328 PRO CD HD3 sing N N 329 PRO OXT HXT sing N N 330 SER N CA sing N N 331 SER N H sing N N 332 SER N H2 sing N N 333 SER CA C sing N N 334 SER CA CB sing N N 335 SER CA HA sing N N 336 SER C O doub N N 337 SER C OXT sing N N 338 SER CB OG sing N N 339 SER CB HB2 sing N N 340 SER CB HB3 sing N N 341 SER OG HG sing N N 342 SER OXT HXT sing N N 343 THR N CA sing N N 344 THR N H sing N N 345 THR N H2 sing N N 346 THR CA C sing N N 347 THR CA CB sing N N 348 THR CA HA sing N N 349 THR C O doub N N 350 THR C OXT sing N N 351 THR CB OG1 sing N N 352 THR CB CG2 sing N N 353 THR CB HB sing N N 354 THR OG1 HG1 sing N N 355 THR CG2 HG21 sing N N 356 THR CG2 HG22 sing N N 357 THR CG2 HG23 sing N N 358 THR OXT HXT sing N N 359 TRP N CA sing N N 360 TRP N H sing N N 361 TRP N H2 sing N N 362 TRP CA C sing N N 363 TRP CA CB sing N N 364 TRP CA HA sing N N 365 TRP C O doub N N 366 TRP C OXT sing N N 367 TRP CB CG sing N N 368 TRP CB HB2 sing N N 369 TRP CB HB3 sing N N 370 TRP CG CD1 doub Y N 371 TRP CG CD2 sing Y N 372 TRP CD1 NE1 sing Y N 373 TRP CD1 HD1 sing N N 374 TRP CD2 CE2 doub Y N 375 TRP CD2 CE3 sing Y N 376 TRP NE1 CE2 sing Y N 377 TRP NE1 HE1 sing N N 378 TRP CE2 CZ2 sing Y N 379 TRP CE3 CZ3 doub Y N 380 TRP CE3 HE3 sing N N 381 TRP CZ2 CH2 doub Y N 382 TRP CZ2 HZ2 sing N N 383 TRP CZ3 CH2 sing Y N 384 TRP CZ3 HZ3 sing N N 385 TRP CH2 HH2 sing N N 386 TRP OXT HXT sing N N 387 TYR N CA sing N N 388 TYR N H sing N N 389 TYR N H2 sing N N 390 TYR CA C sing N N 391 TYR CA CB sing N N 392 TYR CA HA sing N N 393 TYR C O doub N N 394 TYR C OXT sing N N 395 TYR CB CG sing N N 396 TYR CB HB2 sing N N 397 TYR CB HB3 sing N N 398 TYR CG CD1 doub Y N 399 TYR CG CD2 sing Y N 400 TYR CD1 CE1 sing Y N 401 TYR CD1 HD1 sing N N 402 TYR CD2 CE2 doub Y N 403 TYR CD2 HD2 sing N N 404 TYR CE1 CZ doub Y N 405 TYR CE1 HE1 sing N N 406 TYR CE2 CZ sing Y N 407 TYR CE2 HE2 sing N N 408 TYR CZ OH sing N N 409 TYR OH HH sing N N 410 TYR OXT HXT sing N N 411 VAL N CA sing N N 412 VAL N H sing N N 413 VAL N H2 sing N N 414 VAL CA C sing N N 415 VAL CA CB sing N N 416 VAL CA HA sing N N 417 VAL C O doub N N 418 VAL C OXT sing N N 419 VAL CB CG1 sing N N 420 VAL CB CG2 sing N N 421 VAL CB HB sing N N 422 VAL CG1 HG11 sing N N 423 VAL CG1 HG12 sing N N 424 VAL CG1 HG13 sing N N 425 VAL CG2 HG21 sing N N 426 VAL CG2 HG22 sing N N 427 VAL CG2 HG23 sing N N 428 VAL OXT HXT sing N N 429 # loop_ _pdbx_entity_branch_list.entity_id _pdbx_entity_branch_list.comp_id _pdbx_entity_branch_list.num _pdbx_entity_branch_list.hetero 2 NAG 1 n 2 NAG 2 n # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3AVE _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 6X3I _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.019197 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.007017 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.013292 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_