data_6X46 # _entry.id 6X46 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.391 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6X46 pdb_00006x46 10.2210/pdb6x46/pdb WWPDB D_1000249457 ? ? BMRB 30754 ? 10.13018/BMR30754 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-03-03 2 'Structure model' 1 1 2021-04-14 3 'Structure model' 1 2 2024-05-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.pdbx_database_id_PubMed' 10 2 'Structure model' '_citation.title' 11 2 'Structure model' '_citation.year' 12 2 'Structure model' '_citation_author.identifier_ORCID' 13 3 'Structure model' '_database_2.pdbx_DOI' 14 3 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 6X46 _pdbx_database_status.recvd_initial_deposition_date 2020-05-22 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'NMR solution structure of Asterix/Gtsf1 from mouse (CHHC zinc finger domains)' _pdbx_database_related.db_id 30754 _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Ipsaro, J.J.' 1 0000-0002-2743-3776 ;O'Brien, P.A. ; 2 ? 'Bhattacharya, S.' 3 ? 'Palmer III, A.G.' 4 0000-0002-2770-0053 'Joshua-Tor, L.' 5 0000-0001-8185-8049 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Cell Rep' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2211-1247 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 34 _citation.language ? _citation.page_first 108914 _citation.page_last 108914 _citation.title 'Asterix/Gtsf1 links tRNAs and piRNA silencing of retrotransposons.' _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.celrep.2021.108914 _citation.pdbx_database_id_PubMed 33789107 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ipsaro, J.J.' 1 ? primary ;O'Brien, P.A. ; 2 ? primary 'Bhattacharya, S.' 3 ? primary 'Palmer III, A.G.' 4 ? primary 'Joshua-Tor, L.' 5 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Gametocyte-specific factor 1' 14217.607 1 ? 'C28S, C76S, C100S, C103S' ? ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Protein FAM112B' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MEDTYIDSLDPEKLLQCPYDKNHQIRASRFPYHLIKCRKNHPDVANKLATCPFNARHQVPRAEISHHISSCDDKSSIEQD VVNQTRNLGQETLAESTWQSPPSDEDWDKDLWEQTENLYFQ ; _entity_poly.pdbx_seq_one_letter_code_can ;MEDTYIDSLDPEKLLQCPYDKNHQIRASRFPYHLIKCRKNHPDVANKLATCPFNARHQVPRAEISHHISSCDDKSSIEQD VVNQTRNLGQETLAESTWQSPPSDEDWDKDLWEQTENLYFQ ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLU n 1 3 ASP n 1 4 THR n 1 5 TYR n 1 6 ILE n 1 7 ASP n 1 8 SER n 1 9 LEU n 1 10 ASP n 1 11 PRO n 1 12 GLU n 1 13 LYS n 1 14 LEU n 1 15 LEU n 1 16 GLN n 1 17 CYS n 1 18 PRO n 1 19 TYR n 1 20 ASP n 1 21 LYS n 1 22 ASN n 1 23 HIS n 1 24 GLN n 1 25 ILE n 1 26 ARG n 1 27 ALA n 1 28 SER n 1 29 ARG n 1 30 PHE n 1 31 PRO n 1 32 TYR n 1 33 HIS n 1 34 LEU n 1 35 ILE n 1 36 LYS n 1 37 CYS n 1 38 ARG n 1 39 LYS n 1 40 ASN n 1 41 HIS n 1 42 PRO n 1 43 ASP n 1 44 VAL n 1 45 ALA n 1 46 ASN n 1 47 LYS n 1 48 LEU n 1 49 ALA n 1 50 THR n 1 51 CYS n 1 52 PRO n 1 53 PHE n 1 54 ASN n 1 55 ALA n 1 56 ARG n 1 57 HIS n 1 58 GLN n 1 59 VAL n 1 60 PRO n 1 61 ARG n 1 62 ALA n 1 63 GLU n 1 64 ILE n 1 65 SER n 1 66 HIS n 1 67 HIS n 1 68 ILE n 1 69 SER n 1 70 SER n 1 71 CYS n 1 72 ASP n 1 73 ASP n 1 74 LYS n 1 75 SER n 1 76 SER n 1 77 ILE n 1 78 GLU n 1 79 GLN n 1 80 ASP n 1 81 VAL n 1 82 VAL n 1 83 ASN n 1 84 GLN n 1 85 THR n 1 86 ARG n 1 87 ASN n 1 88 LEU n 1 89 GLY n 1 90 GLN n 1 91 GLU n 1 92 THR n 1 93 LEU n 1 94 ALA n 1 95 GLU n 1 96 SER n 1 97 THR n 1 98 TRP n 1 99 GLN n 1 100 SER n 1 101 PRO n 1 102 PRO n 1 103 SER n 1 104 ASP n 1 105 GLU n 1 106 ASP n 1 107 TRP n 1 108 ASP n 1 109 LYS n 1 110 ASP n 1 111 LEU n 1 112 TRP n 1 113 GLU n 1 114 GLN n 1 115 THR n 1 116 GLU n 1 117 ASN n 1 118 LEU n 1 119 TYR n 1 120 PHE n 1 121 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 121 _entity_src_gen.gene_src_common_name Mouse _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'Gtsf1, Cue110, Fam112b' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name 'fall armyworm' _entity_src_gen.pdbx_host_org_scientific_name 'Spodoptera frugiperda' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 7108 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ovary _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line Sf9 _entity_src_gen.pdbx_host_org_atcc CRL-1711 _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Bacmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pFL _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 ASP 3 3 3 ASP ASP A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 TYR 5 5 5 TYR TYR A . n A 1 6 ILE 6 6 6 ILE ILE A . n A 1 7 ASP 7 7 7 ASP ASP A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 PRO 11 11 11 PRO PRO A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 GLN 16 16 16 GLN GLN A . n A 1 17 CYS 17 17 17 CYS CYS A . n A 1 18 PRO 18 18 18 PRO PRO A . n A 1 19 TYR 19 19 19 TYR TYR A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 ASN 22 22 22 ASN ASN A . n A 1 23 HIS 23 23 23 HIS HIS A . n A 1 24 GLN 24 24 24 GLN GLN A . n A 1 25 ILE 25 25 25 ILE ILE A . n A 1 26 ARG 26 26 26 ARG ARG A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 ARG 29 29 29 ARG ARG A . n A 1 30 PHE 30 30 30 PHE PHE A . n A 1 31 PRO 31 31 31 PRO PRO A . n A 1 32 TYR 32 32 32 TYR TYR A . n A 1 33 HIS 33 33 33 HIS HIS A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 ILE 35 35 35 ILE ILE A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 CYS 37 37 37 CYS CYS A . n A 1 38 ARG 38 38 38 ARG ARG A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 ASN 40 40 40 ASN ASN A . n A 1 41 HIS 41 41 41 HIS HIS A . n A 1 42 PRO 42 42 42 PRO PRO A . n A 1 43 ASP 43 43 43 ASP ASP A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 ALA 45 45 45 ALA ALA A . n A 1 46 ASN 46 46 46 ASN ASN A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 ALA 49 49 49 ALA ALA A . n A 1 50 THR 50 50 50 THR THR A . n A 1 51 CYS 51 51 51 CYS CYS A . n A 1 52 PRO 52 52 52 PRO PRO A . n A 1 53 PHE 53 53 53 PHE PHE A . n A 1 54 ASN 54 54 54 ASN ASN A . n A 1 55 ALA 55 55 55 ALA ALA A . n A 1 56 ARG 56 56 56 ARG ARG A . n A 1 57 HIS 57 57 57 HIS HIS A . n A 1 58 GLN 58 58 58 GLN GLN A . n A 1 59 VAL 59 59 59 VAL VAL A . n A 1 60 PRO 60 60 60 PRO PRO A . n A 1 61 ARG 61 61 61 ARG ARG A . n A 1 62 ALA 62 62 62 ALA ALA A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 ILE 64 64 64 ILE ILE A . n A 1 65 SER 65 65 65 SER SER A . n A 1 66 HIS 66 66 66 HIS HIS A . n A 1 67 HIS 67 67 67 HIS HIS A . n A 1 68 ILE 68 68 68 ILE ILE A . n A 1 69 SER 69 69 69 SER SER A . n A 1 70 SER 70 70 70 SER SER A . n A 1 71 CYS 71 71 71 CYS CYS A . n A 1 72 ASP 72 72 72 ASP ASP A . n A 1 73 ASP 73 73 73 ASP ASP A . n A 1 74 LYS 74 74 74 LYS LYS A . n A 1 75 SER 75 75 75 SER SER A . n A 1 76 SER 76 76 76 SER SER A . n A 1 77 ILE 77 77 77 ILE ILE A . n A 1 78 GLU 78 78 78 GLU GLU A . n A 1 79 GLN 79 79 79 GLN GLN A . n A 1 80 ASP 80 80 80 ASP ASP A . n A 1 81 VAL 81 81 ? ? ? A . n A 1 82 VAL 82 82 ? ? ? A . n A 1 83 ASN 83 83 ? ? ? A . n A 1 84 GLN 84 84 ? ? ? A . n A 1 85 THR 85 85 ? ? ? A . n A 1 86 ARG 86 86 ? ? ? A . n A 1 87 ASN 87 87 ? ? ? A . n A 1 88 LEU 88 88 ? ? ? A . n A 1 89 GLY 89 89 ? ? ? A . n A 1 90 GLN 90 90 ? ? ? A . n A 1 91 GLU 91 91 ? ? ? A . n A 1 92 THR 92 92 ? ? ? A . n A 1 93 LEU 93 93 ? ? ? A . n A 1 94 ALA 94 94 ? ? ? A . n A 1 95 GLU 95 95 ? ? ? A . n A 1 96 SER 96 96 ? ? ? A . n A 1 97 THR 97 97 ? ? ? A . n A 1 98 TRP 98 98 ? ? ? A . n A 1 99 GLN 99 99 ? ? ? A . n A 1 100 SER 100 100 ? ? ? A . n A 1 101 PRO 101 101 ? ? ? A . n A 1 102 PRO 102 102 ? ? ? A . n A 1 103 SER 103 103 ? ? ? A . n A 1 104 ASP 104 104 ? ? ? A . n A 1 105 GLU 105 105 ? ? ? A . n A 1 106 ASP 106 106 ? ? ? A . n A 1 107 TRP 107 107 ? ? ? A . n A 1 108 ASP 108 108 ? ? ? A . n A 1 109 LYS 109 109 ? ? ? A . n A 1 110 ASP 110 110 ? ? ? A . n A 1 111 LEU 111 111 ? ? ? A . n A 1 112 TRP 112 112 ? ? ? A . n A 1 113 GLU 113 113 ? ? ? A . n A 1 114 GLN 114 114 ? ? ? A . n A 1 115 THR 115 115 ? ? ? A . n A 1 116 GLU 116 116 ? ? ? A . n A 1 117 ASN 117 117 ? ? ? A . n A 1 118 LEU 118 118 ? ? ? A . n A 1 119 TYR 119 119 ? ? ? A . n A 1 120 PHE 120 120 ? ? ? A . n A 1 121 GLN 121 121 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 201 150 ZN ZN A . C 2 ZN 1 202 200 ZN ZN A . # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6X46 _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 6X46 _struct.title 'NMR solution structure of Asterix/Gtsf1 from mouse (CHHC zinc finger domains)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6X46 _struct_keywords.text 'CHHC zinc finger, RNA binding, RNA BINDING PROTEIN' _struct_keywords.pdbx_keywords 'RNA BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code GTSF1_MOUSE _struct_ref.pdbx_db_accession Q9DAN6 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MEDTYIDSLDPEKLLQCPYDKNHQIRACRFPYHLIKCRKNHPDVANKLATCPFNARHQVPRAEISHHISSCDDKSCIEQD VVNQTRNLGQETLAESTWQCPPCDEDWDKDLWEQT ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6X46 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 115 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9DAN6 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 115 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 115 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6X46 SER A 28 ? UNP Q9DAN6 CYS 28 'engineered mutation' 28 1 1 6X46 SER A 76 ? UNP Q9DAN6 CYS 76 'engineered mutation' 76 2 1 6X46 SER A 100 ? UNP Q9DAN6 CYS 100 'engineered mutation' 100 3 1 6X46 SER A 103 ? UNP Q9DAN6 CYS 103 'engineered mutation' 103 4 1 6X46 GLU A 116 ? UNP Q9DAN6 ? ? 'expression tag' 116 5 1 6X46 ASN A 117 ? UNP Q9DAN6 ? ? 'expression tag' 117 6 1 6X46 LEU A 118 ? UNP Q9DAN6 ? ? 'expression tag' 118 7 1 6X46 TYR A 119 ? UNP Q9DAN6 ? ? 'expression tag' 119 8 1 6X46 PHE A 120 ? UNP Q9DAN6 ? ? 'expression tag' 120 9 1 6X46 GLN A 121 ? UNP Q9DAN6 ? ? 'expression tag' 121 10 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details 'The elution profile of the purified protein most closely matches with that expected of a monomer.' # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ARG A 29 ? ASN A 40 ? ARG A 29 ASN A 40 1 ? 12 HELX_P HELX_P2 AA2 HIS A 41 ? ASN A 46 ? HIS A 41 ASN A 46 1 ? 6 HELX_P HELX_P3 AA3 GLU A 63 ? SER A 70 ? GLU A 63 SER A 70 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 17 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 17 A ZN 201 1_555 ? ? ? ? ? ? ? 2.301 ? ? metalc2 metalc ? ? A HIS 23 ND1 ? ? ? 1_555 B ZN . ZN ? ? A HIS 23 A ZN 201 1_555 ? ? ? ? ? ? ? 2.002 ? ? metalc3 metalc ? ? A HIS 33 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 33 A ZN 201 1_555 ? ? ? ? ? ? ? 1.999 ? ? metalc4 metalc ? ? A CYS 37 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 37 A ZN 201 1_555 ? ? ? ? ? ? ? 2.297 ? ? metalc5 metalc ? ? A CYS 51 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 51 A ZN 202 1_555 ? ? ? ? ? ? ? 2.302 ? ? metalc6 metalc ? ? A HIS 57 ND1 ? ? ? 1_555 C ZN . ZN ? ? A HIS 57 A ZN 202 1_555 ? ? ? ? ? ? ? 2.003 ? ? metalc7 metalc ? ? A HIS 67 NE2 ? ? ? 1_555 C ZN . ZN ? ? A HIS 67 A ZN 202 1_555 ? ? ? ? ? ? ? 2.002 ? ? metalc8 metalc ? ? A CYS 71 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 71 A ZN 202 1_555 ? ? ? ? ? ? ? 2.301 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 17 ? A CYS 17 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 ND1 ? A HIS 23 ? A HIS 23 ? 1_555 110.3 ? 2 SG ? A CYS 17 ? A CYS 17 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 33 ? A HIS 33 ? 1_555 109.4 ? 3 ND1 ? A HIS 23 ? A HIS 23 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 33 ? A HIS 33 ? 1_555 110.1 ? 4 SG ? A CYS 17 ? A CYS 17 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 37 ? A CYS 37 ? 1_555 107.9 ? 5 ND1 ? A HIS 23 ? A HIS 23 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 37 ? A CYS 37 ? 1_555 108.7 ? 6 NE2 ? A HIS 33 ? A HIS 33 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 37 ? A CYS 37 ? 1_555 110.3 ? 7 SG ? A CYS 51 ? A CYS 51 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 ND1 ? A HIS 57 ? A HIS 57 ? 1_555 109.2 ? 8 SG ? A CYS 51 ? A CYS 51 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 NE2 ? A HIS 67 ? A HIS 67 ? 1_555 107.7 ? 9 ND1 ? A HIS 57 ? A HIS 57 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 NE2 ? A HIS 67 ? A HIS 67 ? 1_555 110.1 ? 10 SG ? A CYS 51 ? A CYS 51 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 SG ? A CYS 71 ? A CYS 71 ? 1_555 109.2 ? 11 ND1 ? A HIS 57 ? A HIS 57 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 SG ? A CYS 71 ? A CYS 71 ? 1_555 109.6 ? 12 NE2 ? A HIS 67 ? A HIS 67 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 SG ? A CYS 71 ? A CYS 71 ? 1_555 110.9 ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 2 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LEU A 14 ? GLN A 16 ? LEU A 14 GLN A 16 AA1 2 GLN A 24 ? ARG A 26 ? GLN A 24 ARG A 26 AA2 1 LEU A 48 ? CYS A 51 ? LEU A 48 CYS A 51 AA2 2 ASN A 54 ? PRO A 60 ? ASN A 54 PRO A 60 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LEU A 15 ? N LEU A 15 O ILE A 25 ? O ILE A 25 AA2 1 2 N ALA A 49 ? N ALA A 49 O VAL A 59 ? O VAL A 59 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 201 ? 4 'binding site for residue ZN A 201' AC2 Software A ZN 202 ? 5 'binding site for residue ZN A 202' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 17 ? CYS A 17 . ? 1_555 ? 2 AC1 4 HIS A 23 ? HIS A 23 . ? 1_555 ? 3 AC1 4 HIS A 33 ? HIS A 33 . ? 1_555 ? 4 AC1 4 CYS A 37 ? CYS A 37 . ? 1_555 ? 5 AC2 5 CYS A 51 ? CYS A 51 . ? 1_555 ? 6 AC2 5 HIS A 57 ? HIS A 57 . ? 1_555 ? 7 AC2 5 HIS A 67 ? HIS A 67 . ? 1_555 ? 8 AC2 5 CYS A 71 ? CYS A 71 . ? 1_555 ? 9 AC2 5 SER A 76 ? SER A 76 . ? 1_555 ? # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 7 _pdbx_validate_close_contact.auth_atom_id_1 HE2 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 HIS _pdbx_validate_close_contact.auth_seq_id_1 41 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 OE1 _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 GLU _pdbx_validate_close_contact.auth_seq_id_2 63 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.60 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 8 ? ? 67.81 91.62 2 1 PRO A 11 ? ? -74.82 37.78 3 1 GLU A 12 ? ? 65.34 109.61 4 1 LYS A 47 ? ? 66.48 163.92 5 1 ASN A 54 ? ? -171.06 130.99 6 1 LYS A 74 ? ? 65.92 -166.06 7 2 GLU A 2 ? ? -158.85 72.57 8 2 ILE A 6 ? ? 71.76 -59.31 9 2 ASP A 20 ? ? -167.09 119.33 10 3 ASP A 3 ? ? -143.96 -36.55 11 3 THR A 4 ? ? -155.78 89.29 12 3 LEU A 9 ? ? 65.83 103.40 13 3 LYS A 47 ? ? -80.58 43.11 14 3 ASN A 54 ? ? -170.41 118.59 15 3 ILE A 77 ? ? 65.46 68.42 16 4 ASP A 20 ? ? -169.34 115.35 17 4 ASN A 46 ? ? -90.15 41.46 18 4 SER A 75 ? ? -147.76 15.89 19 4 SER A 76 ? ? -153.12 -66.97 20 5 GLU A 2 ? ? -131.61 -43.81 21 5 GLU A 12 ? ? 61.58 73.91 22 5 ASN A 46 ? ? -105.83 43.08 23 5 LYS A 47 ? ? -77.28 44.03 24 6 ASN A 54 ? ? -161.28 116.66 25 7 ASN A 40 ? ? -118.66 64.90 26 7 HIS A 41 ? ? -117.65 74.27 27 7 LYS A 47 ? ? -103.62 79.67 28 7 CYS A 71 ? ? -151.16 36.31 29 7 ASP A 73 ? ? -103.65 -62.18 30 7 LYS A 74 ? ? -172.69 -57.99 31 7 SER A 76 ? ? -102.28 41.87 32 7 GLN A 79 ? ? 60.11 60.21 33 8 ILE A 6 ? ? 60.23 68.15 34 8 ASP A 10 ? ? 47.04 101.43 35 8 PRO A 11 ? ? -70.33 40.52 36 8 LYS A 13 ? ? 72.92 134.52 37 8 LYS A 47 ? ? 73.63 -28.40 38 8 HIS A 57 ? ? -109.87 79.24 39 8 ASP A 72 ? ? -157.78 71.60 40 9 ILE A 6 ? ? 71.99 -59.26 41 9 ASN A 54 ? ? -169.97 114.98 42 9 ASP A 73 ? ? -148.00 -69.04 43 9 ILE A 77 ? ? 50.72 77.14 44 10 GLU A 2 ? ? -86.60 -77.02 45 10 LEU A 9 ? ? 66.60 143.67 46 10 ASP A 73 ? ? -71.13 -73.54 47 10 SER A 76 ? ? -139.84 -59.40 48 11 GLU A 2 ? ? -100.87 71.00 49 11 GLU A 12 ? ? 63.47 81.74 50 11 LYS A 13 ? ? -87.40 -70.48 51 11 ASP A 20 ? ? -169.36 116.48 52 11 LYS A 47 ? ? 57.09 84.11 53 11 CYS A 71 ? ? -166.34 100.18 54 11 SER A 76 ? ? -79.00 44.75 55 12 THR A 4 ? ? -150.13 20.59 56 12 LYS A 47 ? ? 53.63 76.60 57 13 GLU A 2 ? ? -168.63 -77.98 58 13 ASP A 3 ? ? -104.73 -80.45 59 13 THR A 4 ? ? -95.15 57.45 60 13 TYR A 5 ? ? 71.29 -55.44 61 13 HIS A 41 ? ? -119.08 73.76 62 13 SER A 75 ? ? -158.28 -61.11 63 13 GLN A 79 ? ? 59.57 84.86 64 14 THR A 4 ? ? 51.47 -173.49 65 14 SER A 8 ? ? 61.15 69.63 66 14 GLU A 12 ? ? 67.69 112.34 67 14 LYS A 47 ? ? 57.25 76.12 68 15 SER A 8 ? ? -169.37 93.01 69 15 ASP A 73 ? ? -121.50 -74.77 70 16 GLU A 2 ? ? -88.53 46.79 71 16 LEU A 9 ? ? -99.41 31.28 72 16 LYS A 47 ? ? 73.00 125.85 73 16 ASN A 54 ? ? -170.43 121.46 74 17 LYS A 13 ? ? -131.84 -75.20 75 17 ASP A 20 ? ? -162.28 118.93 76 17 ASP A 73 ? ? -151.36 -156.42 77 18 ASP A 3 ? ? 63.07 99.11 78 18 GLU A 12 ? ? 45.82 -151.81 79 18 LYS A 13 ? ? 72.90 155.50 80 18 LYS A 47 ? ? 65.76 -74.59 81 19 GLU A 2 ? ? -139.39 -37.03 82 19 ASP A 7 ? ? 53.03 82.72 83 19 LEU A 9 ? ? 72.16 127.72 84 19 ASP A 20 ? ? -170.35 122.01 85 19 ASN A 54 ? ? -168.76 118.03 86 19 ASP A 73 ? ? -118.10 67.50 87 19 GLU A 78 ? ? 57.31 -91.00 88 20 GLU A 2 ? ? -115.98 68.50 89 20 LEU A 9 ? ? 70.29 -49.20 90 20 PRO A 11 ? ? -59.54 97.05 91 20 LYS A 13 ? ? -124.49 -84.10 92 20 ASN A 46 ? ? -99.11 47.26 93 20 ASN A 54 ? ? -173.60 123.70 94 20 CYS A 71 ? ? -144.00 23.48 95 20 ASP A 73 ? ? -151.75 75.45 96 20 SER A 75 ? ? -167.23 61.42 97 20 SER A 76 ? ? -80.02 49.90 # _pdbx_entry_details.entry_id 6X46 _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # _pdbx_nmr_ensemble.entry_id 6X46 _pdbx_nmr_ensemble.conformers_calculated_total_number 500 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 6X46 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 '0.5 mM [U-15N] Gtsf1, 90% H2O/10% D2O' '90% H2O/10% D2O' 15N_sample solution ? 2 '0.8 mM [U-13C; U-15N] Gtsf1, 90% H2O/10% D2O' '90% H2O/10% D2O' 13C_15N_sample solution ? 3 '0.8 mM [U-13C; U-15N] Gtsf1, 100% D2O' '100% D2O' 13C_15N_D2O_sample solution ? # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 Gtsf1 0.5 ? mM '[U-15N]' 2 Gtsf1 0.8 ? mM '[U-13C; U-15N]' 3 Gtsf1 0.8 ? mM '[U-13C; U-15N]' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength '200 mM NaCl' _pdbx_nmr_exptl_sample_conditions.details ;Buffer composition was 50 mM MES, pH 6.5, 200 mM NaCl, 5 mM TCEP, 2:1 stoichiometric ZnCl2, 4:1 stoichiometric MgCl2, and 0.02% azide. 0.1 mM DSS was included in samples for internal referencing of 1H chemical shifts. ; _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label conditions _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 7 isotropic 2 1 3 '2D 1H-13C HSQC' 7 isotropic 3 1 2 '3D HNCA' 5 isotropic 4 1 2 '3D HN(CO)CA' 9 isotropic 5 1 2 '3D HNCO' 9 isotropic 6 1 2 '3D HN(CA)CO' 7 isotropic 7 1 2 '3D HNCACB' 7 isotropic 8 1 2 '3D HN(COCA)CB' 9 isotropic 9 1 2 '3D HCCH-TOCSY' 7 isotropic 10 1 2 '3D HBHA(CO)NH' 6 isotropic 11 1 2 '3D H(CCO)NH' 6 isotropic 12 1 2 '3D (H)C(CCO)NH' 6 isotropic 13 1 1 '3D 1H-15N NOESY' 7 isotropic 14 1 3 '3D 1H-13C NOESY' 7 isotropic 15 1 3 '3D 1H-13C NOESY aromatic' 7 isotropic # _pdbx_nmr_refine.entry_id 6X46 _pdbx_nmr_refine.method 'DGSA-distance geometry simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 6 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 processing NMRPipe ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer, Bax' 2 'peak picking' Sparky ? 'Lee, Tonelli, Markley' 3 'chemical shift assignment' Sparky ? 'Lee, Tonelli, Markley' 4 'structure calculation' ARIA 2.3 'Linge, Habeck, Rieping, Nilges' 5 refinement ARIA 2.3 'Linge, Habeck, Rieping, Nilges' 6 refinement CNS 1.2 Brunger # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A VAL 81 ? A VAL 81 2 1 Y 1 A VAL 82 ? A VAL 82 3 1 Y 1 A ASN 83 ? A ASN 83 4 1 Y 1 A GLN 84 ? A GLN 84 5 1 Y 1 A THR 85 ? A THR 85 6 1 Y 1 A ARG 86 ? A ARG 86 7 1 Y 1 A ASN 87 ? A ASN 87 8 1 Y 1 A LEU 88 ? A LEU 88 9 1 Y 1 A GLY 89 ? A GLY 89 10 1 Y 1 A GLN 90 ? A GLN 90 11 1 Y 1 A GLU 91 ? A GLU 91 12 1 Y 1 A THR 92 ? A THR 92 13 1 Y 1 A LEU 93 ? A LEU 93 14 1 Y 1 A ALA 94 ? A ALA 94 15 1 Y 1 A GLU 95 ? A GLU 95 16 1 Y 1 A SER 96 ? A SER 96 17 1 Y 1 A THR 97 ? A THR 97 18 1 Y 1 A TRP 98 ? A TRP 98 19 1 Y 1 A GLN 99 ? A GLN 99 20 1 Y 1 A SER 100 ? A SER 100 21 1 Y 1 A PRO 101 ? A PRO 101 22 1 Y 1 A PRO 102 ? A PRO 102 23 1 Y 1 A SER 103 ? A SER 103 24 1 Y 1 A ASP 104 ? A ASP 104 25 1 Y 1 A GLU 105 ? A GLU 105 26 1 Y 1 A ASP 106 ? A ASP 106 27 1 Y 1 A TRP 107 ? A TRP 107 28 1 Y 1 A ASP 108 ? A ASP 108 29 1 Y 1 A LYS 109 ? A LYS 109 30 1 Y 1 A ASP 110 ? A ASP 110 31 1 Y 1 A LEU 111 ? A LEU 111 32 1 Y 1 A TRP 112 ? A TRP 112 33 1 Y 1 A GLU 113 ? A GLU 113 34 1 Y 1 A GLN 114 ? A GLN 114 35 1 Y 1 A THR 115 ? A THR 115 36 1 Y 1 A GLU 116 ? A GLU 116 37 1 Y 1 A ASN 117 ? A ASN 117 38 1 Y 1 A LEU 118 ? A LEU 118 39 1 Y 1 A TYR 119 ? A TYR 119 40 1 Y 1 A PHE 120 ? A PHE 120 41 1 Y 1 A GLN 121 ? A GLN 121 42 2 Y 1 A VAL 81 ? A VAL 81 43 2 Y 1 A VAL 82 ? A VAL 82 44 2 Y 1 A ASN 83 ? A ASN 83 45 2 Y 1 A GLN 84 ? A GLN 84 46 2 Y 1 A THR 85 ? A THR 85 47 2 Y 1 A ARG 86 ? A ARG 86 48 2 Y 1 A ASN 87 ? A ASN 87 49 2 Y 1 A LEU 88 ? A LEU 88 50 2 Y 1 A GLY 89 ? A GLY 89 51 2 Y 1 A GLN 90 ? A GLN 90 52 2 Y 1 A GLU 91 ? A GLU 91 53 2 Y 1 A THR 92 ? A THR 92 54 2 Y 1 A LEU 93 ? A LEU 93 55 2 Y 1 A ALA 94 ? A ALA 94 56 2 Y 1 A GLU 95 ? A GLU 95 57 2 Y 1 A SER 96 ? A SER 96 58 2 Y 1 A THR 97 ? A THR 97 59 2 Y 1 A TRP 98 ? A TRP 98 60 2 Y 1 A GLN 99 ? A GLN 99 61 2 Y 1 A SER 100 ? A SER 100 62 2 Y 1 A PRO 101 ? A PRO 101 63 2 Y 1 A PRO 102 ? A PRO 102 64 2 Y 1 A SER 103 ? A SER 103 65 2 Y 1 A ASP 104 ? A ASP 104 66 2 Y 1 A GLU 105 ? A GLU 105 67 2 Y 1 A ASP 106 ? A ASP 106 68 2 Y 1 A TRP 107 ? A TRP 107 69 2 Y 1 A ASP 108 ? A ASP 108 70 2 Y 1 A LYS 109 ? A LYS 109 71 2 Y 1 A ASP 110 ? A ASP 110 72 2 Y 1 A LEU 111 ? A LEU 111 73 2 Y 1 A TRP 112 ? A TRP 112 74 2 Y 1 A GLU 113 ? A GLU 113 75 2 Y 1 A GLN 114 ? A GLN 114 76 2 Y 1 A THR 115 ? A THR 115 77 2 Y 1 A GLU 116 ? A GLU 116 78 2 Y 1 A ASN 117 ? A ASN 117 79 2 Y 1 A LEU 118 ? A LEU 118 80 2 Y 1 A TYR 119 ? A TYR 119 81 2 Y 1 A PHE 120 ? A PHE 120 82 2 Y 1 A GLN 121 ? A GLN 121 83 3 Y 1 A VAL 81 ? A VAL 81 84 3 Y 1 A VAL 82 ? A VAL 82 85 3 Y 1 A ASN 83 ? A ASN 83 86 3 Y 1 A GLN 84 ? A GLN 84 87 3 Y 1 A THR 85 ? A THR 85 88 3 Y 1 A ARG 86 ? A ARG 86 89 3 Y 1 A ASN 87 ? A ASN 87 90 3 Y 1 A LEU 88 ? A LEU 88 91 3 Y 1 A GLY 89 ? A GLY 89 92 3 Y 1 A GLN 90 ? A GLN 90 93 3 Y 1 A GLU 91 ? A GLU 91 94 3 Y 1 A THR 92 ? A THR 92 95 3 Y 1 A LEU 93 ? A LEU 93 96 3 Y 1 A ALA 94 ? A ALA 94 97 3 Y 1 A GLU 95 ? A GLU 95 98 3 Y 1 A SER 96 ? A SER 96 99 3 Y 1 A THR 97 ? A THR 97 100 3 Y 1 A TRP 98 ? A TRP 98 101 3 Y 1 A GLN 99 ? A GLN 99 102 3 Y 1 A SER 100 ? A SER 100 103 3 Y 1 A PRO 101 ? A PRO 101 104 3 Y 1 A PRO 102 ? A PRO 102 105 3 Y 1 A SER 103 ? A SER 103 106 3 Y 1 A ASP 104 ? A ASP 104 107 3 Y 1 A GLU 105 ? A GLU 105 108 3 Y 1 A ASP 106 ? A ASP 106 109 3 Y 1 A TRP 107 ? A TRP 107 110 3 Y 1 A ASP 108 ? A ASP 108 111 3 Y 1 A LYS 109 ? A LYS 109 112 3 Y 1 A ASP 110 ? A ASP 110 113 3 Y 1 A LEU 111 ? A LEU 111 114 3 Y 1 A TRP 112 ? A TRP 112 115 3 Y 1 A GLU 113 ? A GLU 113 116 3 Y 1 A GLN 114 ? A GLN 114 117 3 Y 1 A THR 115 ? A THR 115 118 3 Y 1 A GLU 116 ? A GLU 116 119 3 Y 1 A ASN 117 ? A ASN 117 120 3 Y 1 A LEU 118 ? A LEU 118 121 3 Y 1 A TYR 119 ? A TYR 119 122 3 Y 1 A PHE 120 ? A PHE 120 123 3 Y 1 A GLN 121 ? A GLN 121 124 4 Y 1 A VAL 81 ? A VAL 81 125 4 Y 1 A VAL 82 ? A VAL 82 126 4 Y 1 A ASN 83 ? A ASN 83 127 4 Y 1 A GLN 84 ? A GLN 84 128 4 Y 1 A THR 85 ? A THR 85 129 4 Y 1 A ARG 86 ? A ARG 86 130 4 Y 1 A ASN 87 ? A ASN 87 131 4 Y 1 A LEU 88 ? A LEU 88 132 4 Y 1 A GLY 89 ? A GLY 89 133 4 Y 1 A GLN 90 ? A GLN 90 134 4 Y 1 A GLU 91 ? A GLU 91 135 4 Y 1 A THR 92 ? A THR 92 136 4 Y 1 A LEU 93 ? A LEU 93 137 4 Y 1 A ALA 94 ? A ALA 94 138 4 Y 1 A GLU 95 ? A GLU 95 139 4 Y 1 A SER 96 ? A SER 96 140 4 Y 1 A THR 97 ? A THR 97 141 4 Y 1 A TRP 98 ? A TRP 98 142 4 Y 1 A GLN 99 ? A GLN 99 143 4 Y 1 A SER 100 ? A SER 100 144 4 Y 1 A PRO 101 ? A PRO 101 145 4 Y 1 A PRO 102 ? A PRO 102 146 4 Y 1 A SER 103 ? A SER 103 147 4 Y 1 A ASP 104 ? A ASP 104 148 4 Y 1 A GLU 105 ? A GLU 105 149 4 Y 1 A ASP 106 ? A ASP 106 150 4 Y 1 A TRP 107 ? A TRP 107 151 4 Y 1 A ASP 108 ? A ASP 108 152 4 Y 1 A LYS 109 ? A LYS 109 153 4 Y 1 A ASP 110 ? A ASP 110 154 4 Y 1 A LEU 111 ? A LEU 111 155 4 Y 1 A TRP 112 ? A TRP 112 156 4 Y 1 A GLU 113 ? A GLU 113 157 4 Y 1 A GLN 114 ? A GLN 114 158 4 Y 1 A THR 115 ? A THR 115 159 4 Y 1 A GLU 116 ? A GLU 116 160 4 Y 1 A ASN 117 ? A ASN 117 161 4 Y 1 A LEU 118 ? A LEU 118 162 4 Y 1 A TYR 119 ? A TYR 119 163 4 Y 1 A PHE 120 ? A PHE 120 164 4 Y 1 A GLN 121 ? A GLN 121 165 5 Y 1 A VAL 81 ? A VAL 81 166 5 Y 1 A VAL 82 ? A VAL 82 167 5 Y 1 A ASN 83 ? A ASN 83 168 5 Y 1 A GLN 84 ? A GLN 84 169 5 Y 1 A THR 85 ? A THR 85 170 5 Y 1 A ARG 86 ? A ARG 86 171 5 Y 1 A ASN 87 ? A ASN 87 172 5 Y 1 A LEU 88 ? A LEU 88 173 5 Y 1 A GLY 89 ? A GLY 89 174 5 Y 1 A GLN 90 ? A GLN 90 175 5 Y 1 A GLU 91 ? A GLU 91 176 5 Y 1 A THR 92 ? A THR 92 177 5 Y 1 A LEU 93 ? A LEU 93 178 5 Y 1 A ALA 94 ? A ALA 94 179 5 Y 1 A GLU 95 ? A GLU 95 180 5 Y 1 A SER 96 ? A SER 96 181 5 Y 1 A THR 97 ? A THR 97 182 5 Y 1 A TRP 98 ? A TRP 98 183 5 Y 1 A GLN 99 ? A GLN 99 184 5 Y 1 A SER 100 ? A SER 100 185 5 Y 1 A PRO 101 ? A PRO 101 186 5 Y 1 A PRO 102 ? A PRO 102 187 5 Y 1 A SER 103 ? A SER 103 188 5 Y 1 A ASP 104 ? A ASP 104 189 5 Y 1 A GLU 105 ? A GLU 105 190 5 Y 1 A ASP 106 ? A ASP 106 191 5 Y 1 A TRP 107 ? A TRP 107 192 5 Y 1 A ASP 108 ? A ASP 108 193 5 Y 1 A LYS 109 ? A LYS 109 194 5 Y 1 A ASP 110 ? A ASP 110 195 5 Y 1 A LEU 111 ? A LEU 111 196 5 Y 1 A TRP 112 ? A TRP 112 197 5 Y 1 A GLU 113 ? A GLU 113 198 5 Y 1 A GLN 114 ? A GLN 114 199 5 Y 1 A THR 115 ? A THR 115 200 5 Y 1 A GLU 116 ? A GLU 116 201 5 Y 1 A ASN 117 ? A ASN 117 202 5 Y 1 A LEU 118 ? A LEU 118 203 5 Y 1 A TYR 119 ? A TYR 119 204 5 Y 1 A PHE 120 ? A PHE 120 205 5 Y 1 A GLN 121 ? A GLN 121 206 6 Y 1 A VAL 81 ? A VAL 81 207 6 Y 1 A VAL 82 ? A VAL 82 208 6 Y 1 A ASN 83 ? A ASN 83 209 6 Y 1 A GLN 84 ? A GLN 84 210 6 Y 1 A THR 85 ? A THR 85 211 6 Y 1 A ARG 86 ? A ARG 86 212 6 Y 1 A ASN 87 ? A ASN 87 213 6 Y 1 A LEU 88 ? A LEU 88 214 6 Y 1 A GLY 89 ? A GLY 89 215 6 Y 1 A GLN 90 ? A GLN 90 216 6 Y 1 A GLU 91 ? A GLU 91 217 6 Y 1 A THR 92 ? A THR 92 218 6 Y 1 A LEU 93 ? A LEU 93 219 6 Y 1 A ALA 94 ? A ALA 94 220 6 Y 1 A GLU 95 ? A GLU 95 221 6 Y 1 A SER 96 ? A SER 96 222 6 Y 1 A THR 97 ? A THR 97 223 6 Y 1 A TRP 98 ? A TRP 98 224 6 Y 1 A GLN 99 ? A GLN 99 225 6 Y 1 A SER 100 ? A SER 100 226 6 Y 1 A PRO 101 ? A PRO 101 227 6 Y 1 A PRO 102 ? A PRO 102 228 6 Y 1 A SER 103 ? A SER 103 229 6 Y 1 A ASP 104 ? A ASP 104 230 6 Y 1 A GLU 105 ? A GLU 105 231 6 Y 1 A ASP 106 ? A ASP 106 232 6 Y 1 A TRP 107 ? A TRP 107 233 6 Y 1 A ASP 108 ? A ASP 108 234 6 Y 1 A LYS 109 ? A LYS 109 235 6 Y 1 A ASP 110 ? A ASP 110 236 6 Y 1 A LEU 111 ? A LEU 111 237 6 Y 1 A TRP 112 ? A TRP 112 238 6 Y 1 A GLU 113 ? A GLU 113 239 6 Y 1 A GLN 114 ? A GLN 114 240 6 Y 1 A THR 115 ? A THR 115 241 6 Y 1 A GLU 116 ? A GLU 116 242 6 Y 1 A ASN 117 ? A ASN 117 243 6 Y 1 A LEU 118 ? A LEU 118 244 6 Y 1 A TYR 119 ? A TYR 119 245 6 Y 1 A PHE 120 ? A PHE 120 246 6 Y 1 A GLN 121 ? A GLN 121 247 7 Y 1 A VAL 81 ? A VAL 81 248 7 Y 1 A VAL 82 ? A VAL 82 249 7 Y 1 A ASN 83 ? A ASN 83 250 7 Y 1 A GLN 84 ? A GLN 84 251 7 Y 1 A THR 85 ? A THR 85 252 7 Y 1 A ARG 86 ? A ARG 86 253 7 Y 1 A ASN 87 ? A ASN 87 254 7 Y 1 A LEU 88 ? A LEU 88 255 7 Y 1 A GLY 89 ? A GLY 89 256 7 Y 1 A GLN 90 ? A GLN 90 257 7 Y 1 A GLU 91 ? A GLU 91 258 7 Y 1 A THR 92 ? A THR 92 259 7 Y 1 A LEU 93 ? A LEU 93 260 7 Y 1 A ALA 94 ? A ALA 94 261 7 Y 1 A GLU 95 ? A GLU 95 262 7 Y 1 A SER 96 ? A SER 96 263 7 Y 1 A THR 97 ? A THR 97 264 7 Y 1 A TRP 98 ? A TRP 98 265 7 Y 1 A GLN 99 ? A GLN 99 266 7 Y 1 A SER 100 ? A SER 100 267 7 Y 1 A PRO 101 ? A PRO 101 268 7 Y 1 A PRO 102 ? A PRO 102 269 7 Y 1 A SER 103 ? A SER 103 270 7 Y 1 A ASP 104 ? A ASP 104 271 7 Y 1 A GLU 105 ? A GLU 105 272 7 Y 1 A ASP 106 ? A ASP 106 273 7 Y 1 A TRP 107 ? A TRP 107 274 7 Y 1 A ASP 108 ? A ASP 108 275 7 Y 1 A LYS 109 ? A LYS 109 276 7 Y 1 A ASP 110 ? A ASP 110 277 7 Y 1 A LEU 111 ? A LEU 111 278 7 Y 1 A TRP 112 ? A TRP 112 279 7 Y 1 A GLU 113 ? A GLU 113 280 7 Y 1 A GLN 114 ? A GLN 114 281 7 Y 1 A THR 115 ? A THR 115 282 7 Y 1 A GLU 116 ? A GLU 116 283 7 Y 1 A ASN 117 ? A ASN 117 284 7 Y 1 A LEU 118 ? A LEU 118 285 7 Y 1 A TYR 119 ? A TYR 119 286 7 Y 1 A PHE 120 ? A PHE 120 287 7 Y 1 A GLN 121 ? A GLN 121 288 8 Y 1 A VAL 81 ? A VAL 81 289 8 Y 1 A VAL 82 ? A VAL 82 290 8 Y 1 A ASN 83 ? A ASN 83 291 8 Y 1 A GLN 84 ? A GLN 84 292 8 Y 1 A THR 85 ? A THR 85 293 8 Y 1 A ARG 86 ? A ARG 86 294 8 Y 1 A ASN 87 ? A ASN 87 295 8 Y 1 A LEU 88 ? A LEU 88 296 8 Y 1 A GLY 89 ? A GLY 89 297 8 Y 1 A GLN 90 ? A GLN 90 298 8 Y 1 A GLU 91 ? A GLU 91 299 8 Y 1 A THR 92 ? A THR 92 300 8 Y 1 A LEU 93 ? A LEU 93 301 8 Y 1 A ALA 94 ? A ALA 94 302 8 Y 1 A GLU 95 ? A GLU 95 303 8 Y 1 A SER 96 ? A SER 96 304 8 Y 1 A THR 97 ? A THR 97 305 8 Y 1 A TRP 98 ? A TRP 98 306 8 Y 1 A GLN 99 ? A GLN 99 307 8 Y 1 A SER 100 ? A SER 100 308 8 Y 1 A PRO 101 ? A PRO 101 309 8 Y 1 A PRO 102 ? A PRO 102 310 8 Y 1 A SER 103 ? A SER 103 311 8 Y 1 A ASP 104 ? A ASP 104 312 8 Y 1 A GLU 105 ? A GLU 105 313 8 Y 1 A ASP 106 ? A ASP 106 314 8 Y 1 A TRP 107 ? A TRP 107 315 8 Y 1 A ASP 108 ? A ASP 108 316 8 Y 1 A LYS 109 ? A LYS 109 317 8 Y 1 A ASP 110 ? A ASP 110 318 8 Y 1 A LEU 111 ? A LEU 111 319 8 Y 1 A TRP 112 ? A TRP 112 320 8 Y 1 A GLU 113 ? A GLU 113 321 8 Y 1 A GLN 114 ? A GLN 114 322 8 Y 1 A THR 115 ? A THR 115 323 8 Y 1 A GLU 116 ? A GLU 116 324 8 Y 1 A ASN 117 ? A ASN 117 325 8 Y 1 A LEU 118 ? A LEU 118 326 8 Y 1 A TYR 119 ? A TYR 119 327 8 Y 1 A PHE 120 ? A PHE 120 328 8 Y 1 A GLN 121 ? A GLN 121 329 9 Y 1 A VAL 81 ? A VAL 81 330 9 Y 1 A VAL 82 ? A VAL 82 331 9 Y 1 A ASN 83 ? A ASN 83 332 9 Y 1 A GLN 84 ? A GLN 84 333 9 Y 1 A THR 85 ? A THR 85 334 9 Y 1 A ARG 86 ? A ARG 86 335 9 Y 1 A ASN 87 ? A ASN 87 336 9 Y 1 A LEU 88 ? A LEU 88 337 9 Y 1 A GLY 89 ? A GLY 89 338 9 Y 1 A GLN 90 ? A GLN 90 339 9 Y 1 A GLU 91 ? A GLU 91 340 9 Y 1 A THR 92 ? A THR 92 341 9 Y 1 A LEU 93 ? A LEU 93 342 9 Y 1 A ALA 94 ? A ALA 94 343 9 Y 1 A GLU 95 ? A GLU 95 344 9 Y 1 A SER 96 ? A SER 96 345 9 Y 1 A THR 97 ? A THR 97 346 9 Y 1 A TRP 98 ? A TRP 98 347 9 Y 1 A GLN 99 ? A GLN 99 348 9 Y 1 A SER 100 ? A SER 100 349 9 Y 1 A PRO 101 ? A PRO 101 350 9 Y 1 A PRO 102 ? A PRO 102 351 9 Y 1 A SER 103 ? A SER 103 352 9 Y 1 A ASP 104 ? A ASP 104 353 9 Y 1 A GLU 105 ? A GLU 105 354 9 Y 1 A ASP 106 ? A ASP 106 355 9 Y 1 A TRP 107 ? A TRP 107 356 9 Y 1 A ASP 108 ? A ASP 108 357 9 Y 1 A LYS 109 ? A LYS 109 358 9 Y 1 A ASP 110 ? A ASP 110 359 9 Y 1 A LEU 111 ? A LEU 111 360 9 Y 1 A TRP 112 ? A TRP 112 361 9 Y 1 A GLU 113 ? A GLU 113 362 9 Y 1 A GLN 114 ? A GLN 114 363 9 Y 1 A THR 115 ? A THR 115 364 9 Y 1 A GLU 116 ? A GLU 116 365 9 Y 1 A ASN 117 ? A ASN 117 366 9 Y 1 A LEU 118 ? A LEU 118 367 9 Y 1 A TYR 119 ? A TYR 119 368 9 Y 1 A PHE 120 ? A PHE 120 369 9 Y 1 A GLN 121 ? A GLN 121 370 10 Y 1 A VAL 81 ? A VAL 81 371 10 Y 1 A VAL 82 ? A VAL 82 372 10 Y 1 A ASN 83 ? A ASN 83 373 10 Y 1 A GLN 84 ? A GLN 84 374 10 Y 1 A THR 85 ? A THR 85 375 10 Y 1 A ARG 86 ? A ARG 86 376 10 Y 1 A ASN 87 ? A ASN 87 377 10 Y 1 A LEU 88 ? A LEU 88 378 10 Y 1 A GLY 89 ? A GLY 89 379 10 Y 1 A GLN 90 ? A GLN 90 380 10 Y 1 A GLU 91 ? A GLU 91 381 10 Y 1 A THR 92 ? A THR 92 382 10 Y 1 A LEU 93 ? A LEU 93 383 10 Y 1 A ALA 94 ? A ALA 94 384 10 Y 1 A GLU 95 ? A GLU 95 385 10 Y 1 A SER 96 ? A SER 96 386 10 Y 1 A THR 97 ? A THR 97 387 10 Y 1 A TRP 98 ? A TRP 98 388 10 Y 1 A GLN 99 ? A GLN 99 389 10 Y 1 A SER 100 ? A SER 100 390 10 Y 1 A PRO 101 ? A PRO 101 391 10 Y 1 A PRO 102 ? A PRO 102 392 10 Y 1 A SER 103 ? A SER 103 393 10 Y 1 A ASP 104 ? A ASP 104 394 10 Y 1 A GLU 105 ? A GLU 105 395 10 Y 1 A ASP 106 ? A ASP 106 396 10 Y 1 A TRP 107 ? A TRP 107 397 10 Y 1 A ASP 108 ? A ASP 108 398 10 Y 1 A LYS 109 ? A LYS 109 399 10 Y 1 A ASP 110 ? A ASP 110 400 10 Y 1 A LEU 111 ? A LEU 111 401 10 Y 1 A TRP 112 ? A TRP 112 402 10 Y 1 A GLU 113 ? A GLU 113 403 10 Y 1 A GLN 114 ? A GLN 114 404 10 Y 1 A THR 115 ? A THR 115 405 10 Y 1 A GLU 116 ? A GLU 116 406 10 Y 1 A ASN 117 ? A ASN 117 407 10 Y 1 A LEU 118 ? A LEU 118 408 10 Y 1 A TYR 119 ? A TYR 119 409 10 Y 1 A PHE 120 ? A PHE 120 410 10 Y 1 A GLN 121 ? A GLN 121 411 11 Y 1 A VAL 81 ? A VAL 81 412 11 Y 1 A VAL 82 ? A VAL 82 413 11 Y 1 A ASN 83 ? A ASN 83 414 11 Y 1 A GLN 84 ? A GLN 84 415 11 Y 1 A THR 85 ? A THR 85 416 11 Y 1 A ARG 86 ? A ARG 86 417 11 Y 1 A ASN 87 ? A ASN 87 418 11 Y 1 A LEU 88 ? A LEU 88 419 11 Y 1 A GLY 89 ? A GLY 89 420 11 Y 1 A GLN 90 ? A GLN 90 421 11 Y 1 A GLU 91 ? A GLU 91 422 11 Y 1 A THR 92 ? A THR 92 423 11 Y 1 A LEU 93 ? A LEU 93 424 11 Y 1 A ALA 94 ? A ALA 94 425 11 Y 1 A GLU 95 ? A GLU 95 426 11 Y 1 A SER 96 ? A SER 96 427 11 Y 1 A THR 97 ? A THR 97 428 11 Y 1 A TRP 98 ? A TRP 98 429 11 Y 1 A GLN 99 ? A GLN 99 430 11 Y 1 A SER 100 ? A SER 100 431 11 Y 1 A PRO 101 ? A PRO 101 432 11 Y 1 A PRO 102 ? A PRO 102 433 11 Y 1 A SER 103 ? A SER 103 434 11 Y 1 A ASP 104 ? A ASP 104 435 11 Y 1 A GLU 105 ? A GLU 105 436 11 Y 1 A ASP 106 ? A ASP 106 437 11 Y 1 A TRP 107 ? A TRP 107 438 11 Y 1 A ASP 108 ? A ASP 108 439 11 Y 1 A LYS 109 ? A LYS 109 440 11 Y 1 A ASP 110 ? A ASP 110 441 11 Y 1 A LEU 111 ? A LEU 111 442 11 Y 1 A TRP 112 ? A TRP 112 443 11 Y 1 A GLU 113 ? A GLU 113 444 11 Y 1 A GLN 114 ? A GLN 114 445 11 Y 1 A THR 115 ? A THR 115 446 11 Y 1 A GLU 116 ? A GLU 116 447 11 Y 1 A ASN 117 ? A ASN 117 448 11 Y 1 A LEU 118 ? A LEU 118 449 11 Y 1 A TYR 119 ? A TYR 119 450 11 Y 1 A PHE 120 ? A PHE 120 451 11 Y 1 A GLN 121 ? A GLN 121 452 12 Y 1 A VAL 81 ? A VAL 81 453 12 Y 1 A VAL 82 ? A VAL 82 454 12 Y 1 A ASN 83 ? A ASN 83 455 12 Y 1 A GLN 84 ? A GLN 84 456 12 Y 1 A THR 85 ? A THR 85 457 12 Y 1 A ARG 86 ? A ARG 86 458 12 Y 1 A ASN 87 ? A ASN 87 459 12 Y 1 A LEU 88 ? A LEU 88 460 12 Y 1 A GLY 89 ? A GLY 89 461 12 Y 1 A GLN 90 ? A GLN 90 462 12 Y 1 A GLU 91 ? A GLU 91 463 12 Y 1 A THR 92 ? A THR 92 464 12 Y 1 A LEU 93 ? A LEU 93 465 12 Y 1 A ALA 94 ? A ALA 94 466 12 Y 1 A GLU 95 ? A GLU 95 467 12 Y 1 A SER 96 ? A SER 96 468 12 Y 1 A THR 97 ? A THR 97 469 12 Y 1 A TRP 98 ? A TRP 98 470 12 Y 1 A GLN 99 ? A GLN 99 471 12 Y 1 A SER 100 ? A SER 100 472 12 Y 1 A PRO 101 ? A PRO 101 473 12 Y 1 A PRO 102 ? A PRO 102 474 12 Y 1 A SER 103 ? A SER 103 475 12 Y 1 A ASP 104 ? A ASP 104 476 12 Y 1 A GLU 105 ? A GLU 105 477 12 Y 1 A ASP 106 ? A ASP 106 478 12 Y 1 A TRP 107 ? A TRP 107 479 12 Y 1 A ASP 108 ? A ASP 108 480 12 Y 1 A LYS 109 ? A LYS 109 481 12 Y 1 A ASP 110 ? A ASP 110 482 12 Y 1 A LEU 111 ? A LEU 111 483 12 Y 1 A TRP 112 ? A TRP 112 484 12 Y 1 A GLU 113 ? A GLU 113 485 12 Y 1 A GLN 114 ? A GLN 114 486 12 Y 1 A THR 115 ? A THR 115 487 12 Y 1 A GLU 116 ? A GLU 116 488 12 Y 1 A ASN 117 ? A ASN 117 489 12 Y 1 A LEU 118 ? A LEU 118 490 12 Y 1 A TYR 119 ? A TYR 119 491 12 Y 1 A PHE 120 ? A PHE 120 492 12 Y 1 A GLN 121 ? A GLN 121 493 13 Y 1 A VAL 81 ? A VAL 81 494 13 Y 1 A VAL 82 ? A VAL 82 495 13 Y 1 A ASN 83 ? A ASN 83 496 13 Y 1 A GLN 84 ? A GLN 84 497 13 Y 1 A THR 85 ? A THR 85 498 13 Y 1 A ARG 86 ? A ARG 86 499 13 Y 1 A ASN 87 ? A ASN 87 500 13 Y 1 A LEU 88 ? A LEU 88 501 13 Y 1 A GLY 89 ? A GLY 89 502 13 Y 1 A GLN 90 ? A GLN 90 503 13 Y 1 A GLU 91 ? A GLU 91 504 13 Y 1 A THR 92 ? A THR 92 505 13 Y 1 A LEU 93 ? A LEU 93 506 13 Y 1 A ALA 94 ? A ALA 94 507 13 Y 1 A GLU 95 ? A GLU 95 508 13 Y 1 A SER 96 ? A SER 96 509 13 Y 1 A THR 97 ? A THR 97 510 13 Y 1 A TRP 98 ? A TRP 98 511 13 Y 1 A GLN 99 ? A GLN 99 512 13 Y 1 A SER 100 ? A SER 100 513 13 Y 1 A PRO 101 ? A PRO 101 514 13 Y 1 A PRO 102 ? A PRO 102 515 13 Y 1 A SER 103 ? A SER 103 516 13 Y 1 A ASP 104 ? A ASP 104 517 13 Y 1 A GLU 105 ? A GLU 105 518 13 Y 1 A ASP 106 ? A ASP 106 519 13 Y 1 A TRP 107 ? A TRP 107 520 13 Y 1 A ASP 108 ? A ASP 108 521 13 Y 1 A LYS 109 ? A LYS 109 522 13 Y 1 A ASP 110 ? A ASP 110 523 13 Y 1 A LEU 111 ? A LEU 111 524 13 Y 1 A TRP 112 ? A TRP 112 525 13 Y 1 A GLU 113 ? A GLU 113 526 13 Y 1 A GLN 114 ? A GLN 114 527 13 Y 1 A THR 115 ? A THR 115 528 13 Y 1 A GLU 116 ? A GLU 116 529 13 Y 1 A ASN 117 ? A ASN 117 530 13 Y 1 A LEU 118 ? A LEU 118 531 13 Y 1 A TYR 119 ? A TYR 119 532 13 Y 1 A PHE 120 ? A PHE 120 533 13 Y 1 A GLN 121 ? A GLN 121 534 14 Y 1 A VAL 81 ? A VAL 81 535 14 Y 1 A VAL 82 ? A VAL 82 536 14 Y 1 A ASN 83 ? A ASN 83 537 14 Y 1 A GLN 84 ? A GLN 84 538 14 Y 1 A THR 85 ? A THR 85 539 14 Y 1 A ARG 86 ? A ARG 86 540 14 Y 1 A ASN 87 ? A ASN 87 541 14 Y 1 A LEU 88 ? A LEU 88 542 14 Y 1 A GLY 89 ? A GLY 89 543 14 Y 1 A GLN 90 ? A GLN 90 544 14 Y 1 A GLU 91 ? A GLU 91 545 14 Y 1 A THR 92 ? A THR 92 546 14 Y 1 A LEU 93 ? A LEU 93 547 14 Y 1 A ALA 94 ? A ALA 94 548 14 Y 1 A GLU 95 ? A GLU 95 549 14 Y 1 A SER 96 ? A SER 96 550 14 Y 1 A THR 97 ? A THR 97 551 14 Y 1 A TRP 98 ? A TRP 98 552 14 Y 1 A GLN 99 ? A GLN 99 553 14 Y 1 A SER 100 ? A SER 100 554 14 Y 1 A PRO 101 ? A PRO 101 555 14 Y 1 A PRO 102 ? A PRO 102 556 14 Y 1 A SER 103 ? A SER 103 557 14 Y 1 A ASP 104 ? A ASP 104 558 14 Y 1 A GLU 105 ? A GLU 105 559 14 Y 1 A ASP 106 ? A ASP 106 560 14 Y 1 A TRP 107 ? A TRP 107 561 14 Y 1 A ASP 108 ? A ASP 108 562 14 Y 1 A LYS 109 ? A LYS 109 563 14 Y 1 A ASP 110 ? A ASP 110 564 14 Y 1 A LEU 111 ? A LEU 111 565 14 Y 1 A TRP 112 ? A TRP 112 566 14 Y 1 A GLU 113 ? A GLU 113 567 14 Y 1 A GLN 114 ? A GLN 114 568 14 Y 1 A THR 115 ? A THR 115 569 14 Y 1 A GLU 116 ? A GLU 116 570 14 Y 1 A ASN 117 ? A ASN 117 571 14 Y 1 A LEU 118 ? A LEU 118 572 14 Y 1 A TYR 119 ? A TYR 119 573 14 Y 1 A PHE 120 ? A PHE 120 574 14 Y 1 A GLN 121 ? A GLN 121 575 15 Y 1 A VAL 81 ? A VAL 81 576 15 Y 1 A VAL 82 ? A VAL 82 577 15 Y 1 A ASN 83 ? A ASN 83 578 15 Y 1 A GLN 84 ? A GLN 84 579 15 Y 1 A THR 85 ? A THR 85 580 15 Y 1 A ARG 86 ? A ARG 86 581 15 Y 1 A ASN 87 ? A ASN 87 582 15 Y 1 A LEU 88 ? A LEU 88 583 15 Y 1 A GLY 89 ? A GLY 89 584 15 Y 1 A GLN 90 ? A GLN 90 585 15 Y 1 A GLU 91 ? A GLU 91 586 15 Y 1 A THR 92 ? A THR 92 587 15 Y 1 A LEU 93 ? A LEU 93 588 15 Y 1 A ALA 94 ? A ALA 94 589 15 Y 1 A GLU 95 ? A GLU 95 590 15 Y 1 A SER 96 ? A SER 96 591 15 Y 1 A THR 97 ? A THR 97 592 15 Y 1 A TRP 98 ? A TRP 98 593 15 Y 1 A GLN 99 ? A GLN 99 594 15 Y 1 A SER 100 ? A SER 100 595 15 Y 1 A PRO 101 ? A PRO 101 596 15 Y 1 A PRO 102 ? A PRO 102 597 15 Y 1 A SER 103 ? A SER 103 598 15 Y 1 A ASP 104 ? A ASP 104 599 15 Y 1 A GLU 105 ? A GLU 105 600 15 Y 1 A ASP 106 ? A ASP 106 601 15 Y 1 A TRP 107 ? A TRP 107 602 15 Y 1 A ASP 108 ? A ASP 108 603 15 Y 1 A LYS 109 ? A LYS 109 604 15 Y 1 A ASP 110 ? A ASP 110 605 15 Y 1 A LEU 111 ? A LEU 111 606 15 Y 1 A TRP 112 ? A TRP 112 607 15 Y 1 A GLU 113 ? A GLU 113 608 15 Y 1 A GLN 114 ? A GLN 114 609 15 Y 1 A THR 115 ? A THR 115 610 15 Y 1 A GLU 116 ? A GLU 116 611 15 Y 1 A ASN 117 ? A ASN 117 612 15 Y 1 A LEU 118 ? A LEU 118 613 15 Y 1 A TYR 119 ? A TYR 119 614 15 Y 1 A PHE 120 ? A PHE 120 615 15 Y 1 A GLN 121 ? A GLN 121 616 16 Y 1 A VAL 81 ? A VAL 81 617 16 Y 1 A VAL 82 ? A VAL 82 618 16 Y 1 A ASN 83 ? A ASN 83 619 16 Y 1 A GLN 84 ? A GLN 84 620 16 Y 1 A THR 85 ? A THR 85 621 16 Y 1 A ARG 86 ? A ARG 86 622 16 Y 1 A ASN 87 ? A ASN 87 623 16 Y 1 A LEU 88 ? A LEU 88 624 16 Y 1 A GLY 89 ? A GLY 89 625 16 Y 1 A GLN 90 ? A GLN 90 626 16 Y 1 A GLU 91 ? A GLU 91 627 16 Y 1 A THR 92 ? A THR 92 628 16 Y 1 A LEU 93 ? A LEU 93 629 16 Y 1 A ALA 94 ? A ALA 94 630 16 Y 1 A GLU 95 ? A GLU 95 631 16 Y 1 A SER 96 ? A SER 96 632 16 Y 1 A THR 97 ? A THR 97 633 16 Y 1 A TRP 98 ? A TRP 98 634 16 Y 1 A GLN 99 ? A GLN 99 635 16 Y 1 A SER 100 ? A SER 100 636 16 Y 1 A PRO 101 ? A PRO 101 637 16 Y 1 A PRO 102 ? A PRO 102 638 16 Y 1 A SER 103 ? A SER 103 639 16 Y 1 A ASP 104 ? A ASP 104 640 16 Y 1 A GLU 105 ? A GLU 105 641 16 Y 1 A ASP 106 ? A ASP 106 642 16 Y 1 A TRP 107 ? A TRP 107 643 16 Y 1 A ASP 108 ? A ASP 108 644 16 Y 1 A LYS 109 ? A LYS 109 645 16 Y 1 A ASP 110 ? A ASP 110 646 16 Y 1 A LEU 111 ? A LEU 111 647 16 Y 1 A TRP 112 ? A TRP 112 648 16 Y 1 A GLU 113 ? A GLU 113 649 16 Y 1 A GLN 114 ? A GLN 114 650 16 Y 1 A THR 115 ? A THR 115 651 16 Y 1 A GLU 116 ? A GLU 116 652 16 Y 1 A ASN 117 ? A ASN 117 653 16 Y 1 A LEU 118 ? A LEU 118 654 16 Y 1 A TYR 119 ? A TYR 119 655 16 Y 1 A PHE 120 ? A PHE 120 656 16 Y 1 A GLN 121 ? A GLN 121 657 17 Y 1 A VAL 81 ? A VAL 81 658 17 Y 1 A VAL 82 ? A VAL 82 659 17 Y 1 A ASN 83 ? A ASN 83 660 17 Y 1 A GLN 84 ? A GLN 84 661 17 Y 1 A THR 85 ? A THR 85 662 17 Y 1 A ARG 86 ? A ARG 86 663 17 Y 1 A ASN 87 ? A ASN 87 664 17 Y 1 A LEU 88 ? A LEU 88 665 17 Y 1 A GLY 89 ? A GLY 89 666 17 Y 1 A GLN 90 ? A GLN 90 667 17 Y 1 A GLU 91 ? A GLU 91 668 17 Y 1 A THR 92 ? A THR 92 669 17 Y 1 A LEU 93 ? A LEU 93 670 17 Y 1 A ALA 94 ? A ALA 94 671 17 Y 1 A GLU 95 ? A GLU 95 672 17 Y 1 A SER 96 ? A SER 96 673 17 Y 1 A THR 97 ? A THR 97 674 17 Y 1 A TRP 98 ? A TRP 98 675 17 Y 1 A GLN 99 ? A GLN 99 676 17 Y 1 A SER 100 ? A SER 100 677 17 Y 1 A PRO 101 ? A PRO 101 678 17 Y 1 A PRO 102 ? A PRO 102 679 17 Y 1 A SER 103 ? A SER 103 680 17 Y 1 A ASP 104 ? A ASP 104 681 17 Y 1 A GLU 105 ? A GLU 105 682 17 Y 1 A ASP 106 ? A ASP 106 683 17 Y 1 A TRP 107 ? A TRP 107 684 17 Y 1 A ASP 108 ? A ASP 108 685 17 Y 1 A LYS 109 ? A LYS 109 686 17 Y 1 A ASP 110 ? A ASP 110 687 17 Y 1 A LEU 111 ? A LEU 111 688 17 Y 1 A TRP 112 ? A TRP 112 689 17 Y 1 A GLU 113 ? A GLU 113 690 17 Y 1 A GLN 114 ? A GLN 114 691 17 Y 1 A THR 115 ? A THR 115 692 17 Y 1 A GLU 116 ? A GLU 116 693 17 Y 1 A ASN 117 ? A ASN 117 694 17 Y 1 A LEU 118 ? A LEU 118 695 17 Y 1 A TYR 119 ? A TYR 119 696 17 Y 1 A PHE 120 ? A PHE 120 697 17 Y 1 A GLN 121 ? A GLN 121 698 18 Y 1 A VAL 81 ? A VAL 81 699 18 Y 1 A VAL 82 ? A VAL 82 700 18 Y 1 A ASN 83 ? A ASN 83 701 18 Y 1 A GLN 84 ? A GLN 84 702 18 Y 1 A THR 85 ? A THR 85 703 18 Y 1 A ARG 86 ? A ARG 86 704 18 Y 1 A ASN 87 ? A ASN 87 705 18 Y 1 A LEU 88 ? A LEU 88 706 18 Y 1 A GLY 89 ? A GLY 89 707 18 Y 1 A GLN 90 ? A GLN 90 708 18 Y 1 A GLU 91 ? A GLU 91 709 18 Y 1 A THR 92 ? A THR 92 710 18 Y 1 A LEU 93 ? A LEU 93 711 18 Y 1 A ALA 94 ? A ALA 94 712 18 Y 1 A GLU 95 ? A GLU 95 713 18 Y 1 A SER 96 ? A SER 96 714 18 Y 1 A THR 97 ? A THR 97 715 18 Y 1 A TRP 98 ? A TRP 98 716 18 Y 1 A GLN 99 ? A GLN 99 717 18 Y 1 A SER 100 ? A SER 100 718 18 Y 1 A PRO 101 ? A PRO 101 719 18 Y 1 A PRO 102 ? A PRO 102 720 18 Y 1 A SER 103 ? A SER 103 721 18 Y 1 A ASP 104 ? A ASP 104 722 18 Y 1 A GLU 105 ? A GLU 105 723 18 Y 1 A ASP 106 ? A ASP 106 724 18 Y 1 A TRP 107 ? A TRP 107 725 18 Y 1 A ASP 108 ? A ASP 108 726 18 Y 1 A LYS 109 ? A LYS 109 727 18 Y 1 A ASP 110 ? A ASP 110 728 18 Y 1 A LEU 111 ? A LEU 111 729 18 Y 1 A TRP 112 ? A TRP 112 730 18 Y 1 A GLU 113 ? A GLU 113 731 18 Y 1 A GLN 114 ? A GLN 114 732 18 Y 1 A THR 115 ? A THR 115 733 18 Y 1 A GLU 116 ? A GLU 116 734 18 Y 1 A ASN 117 ? A ASN 117 735 18 Y 1 A LEU 118 ? A LEU 118 736 18 Y 1 A TYR 119 ? A TYR 119 737 18 Y 1 A PHE 120 ? A PHE 120 738 18 Y 1 A GLN 121 ? A GLN 121 739 19 Y 1 A VAL 81 ? A VAL 81 740 19 Y 1 A VAL 82 ? A VAL 82 741 19 Y 1 A ASN 83 ? A ASN 83 742 19 Y 1 A GLN 84 ? A GLN 84 743 19 Y 1 A THR 85 ? A THR 85 744 19 Y 1 A ARG 86 ? A ARG 86 745 19 Y 1 A ASN 87 ? A ASN 87 746 19 Y 1 A LEU 88 ? A LEU 88 747 19 Y 1 A GLY 89 ? A GLY 89 748 19 Y 1 A GLN 90 ? A GLN 90 749 19 Y 1 A GLU 91 ? A GLU 91 750 19 Y 1 A THR 92 ? A THR 92 751 19 Y 1 A LEU 93 ? A LEU 93 752 19 Y 1 A ALA 94 ? A ALA 94 753 19 Y 1 A GLU 95 ? A GLU 95 754 19 Y 1 A SER 96 ? A SER 96 755 19 Y 1 A THR 97 ? A THR 97 756 19 Y 1 A TRP 98 ? A TRP 98 757 19 Y 1 A GLN 99 ? A GLN 99 758 19 Y 1 A SER 100 ? A SER 100 759 19 Y 1 A PRO 101 ? A PRO 101 760 19 Y 1 A PRO 102 ? A PRO 102 761 19 Y 1 A SER 103 ? A SER 103 762 19 Y 1 A ASP 104 ? A ASP 104 763 19 Y 1 A GLU 105 ? A GLU 105 764 19 Y 1 A ASP 106 ? A ASP 106 765 19 Y 1 A TRP 107 ? A TRP 107 766 19 Y 1 A ASP 108 ? A ASP 108 767 19 Y 1 A LYS 109 ? A LYS 109 768 19 Y 1 A ASP 110 ? A ASP 110 769 19 Y 1 A LEU 111 ? A LEU 111 770 19 Y 1 A TRP 112 ? A TRP 112 771 19 Y 1 A GLU 113 ? A GLU 113 772 19 Y 1 A GLN 114 ? A GLN 114 773 19 Y 1 A THR 115 ? A THR 115 774 19 Y 1 A GLU 116 ? A GLU 116 775 19 Y 1 A ASN 117 ? A ASN 117 776 19 Y 1 A LEU 118 ? A LEU 118 777 19 Y 1 A TYR 119 ? A TYR 119 778 19 Y 1 A PHE 120 ? A PHE 120 779 19 Y 1 A GLN 121 ? A GLN 121 780 20 Y 1 A VAL 81 ? A VAL 81 781 20 Y 1 A VAL 82 ? A VAL 82 782 20 Y 1 A ASN 83 ? A ASN 83 783 20 Y 1 A GLN 84 ? A GLN 84 784 20 Y 1 A THR 85 ? A THR 85 785 20 Y 1 A ARG 86 ? A ARG 86 786 20 Y 1 A ASN 87 ? A ASN 87 787 20 Y 1 A LEU 88 ? A LEU 88 788 20 Y 1 A GLY 89 ? A GLY 89 789 20 Y 1 A GLN 90 ? A GLN 90 790 20 Y 1 A GLU 91 ? A GLU 91 791 20 Y 1 A THR 92 ? A THR 92 792 20 Y 1 A LEU 93 ? A LEU 93 793 20 Y 1 A ALA 94 ? A ALA 94 794 20 Y 1 A GLU 95 ? A GLU 95 795 20 Y 1 A SER 96 ? A SER 96 796 20 Y 1 A THR 97 ? A THR 97 797 20 Y 1 A TRP 98 ? A TRP 98 798 20 Y 1 A GLN 99 ? A GLN 99 799 20 Y 1 A SER 100 ? A SER 100 800 20 Y 1 A PRO 101 ? A PRO 101 801 20 Y 1 A PRO 102 ? A PRO 102 802 20 Y 1 A SER 103 ? A SER 103 803 20 Y 1 A ASP 104 ? A ASP 104 804 20 Y 1 A GLU 105 ? A GLU 105 805 20 Y 1 A ASP 106 ? A ASP 106 806 20 Y 1 A TRP 107 ? A TRP 107 807 20 Y 1 A ASP 108 ? A ASP 108 808 20 Y 1 A LYS 109 ? A LYS 109 809 20 Y 1 A ASP 110 ? A ASP 110 810 20 Y 1 A LEU 111 ? A LEU 111 811 20 Y 1 A TRP 112 ? A TRP 112 812 20 Y 1 A GLU 113 ? A GLU 113 813 20 Y 1 A GLN 114 ? A GLN 114 814 20 Y 1 A THR 115 ? A THR 115 815 20 Y 1 A GLU 116 ? A GLU 116 816 20 Y 1 A ASN 117 ? A ASN 117 817 20 Y 1 A LEU 118 ? A LEU 118 818 20 Y 1 A TYR 119 ? A TYR 119 819 20 Y 1 A PHE 120 ? A PHE 120 820 20 Y 1 A GLN 121 ? A GLN 121 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 VAL N N N N 369 VAL CA C N S 370 VAL C C N N 371 VAL O O N N 372 VAL CB C N N 373 VAL CG1 C N N 374 VAL CG2 C N N 375 VAL OXT O N N 376 VAL H H N N 377 VAL H2 H N N 378 VAL HA H N N 379 VAL HB H N N 380 VAL HG11 H N N 381 VAL HG12 H N N 382 VAL HG13 H N N 383 VAL HG21 H N N 384 VAL HG22 H N N 385 VAL HG23 H N N 386 VAL HXT H N N 387 ZN ZN ZN N N 388 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Howard Hughes Medical Institute (HHMI)' 'United States' ? 1 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' F32GM097888 2 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' R01GM050291 3 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' R35GM130398 4 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' T32GM008281-28 5 'National Institutes of Health/National Center for Research Resources (NIH/NCRR)' 'United States' S10RR026540 6 'National Institutes of Health/Office of the Director' 'United States' S10OD016432 7 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id ZN _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id ZN _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 5 DRX ? Bruker 600 ? 6 'AVANCE III' ? Bruker 700 ? 7 AVANCE ? Bruker 800 ? 9 AVANCE ? Bruker 900 ? # _atom_sites.entry_id 6X46 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S ZN # loop_